/home/lnzliplg/public_html/gl.zip
PK�m�\1,{yAyALC_MESSAGES/util-linux.monu�[�������%l
���(�
�
��:)Y�1�9�
$/<Uamy��9��
(GMZjW���2
G+U-��������$�	)0MYx.�+��� /?EJ/]@�
���
��$C@����
�9�	#1?qx����-��)�' $H(m&����5N2U��
������7 !Xz���'�*;Jj�&������	,	6@M5b��,�,� ) 
A O o 
� � � � � �  !
2!
@!N!
`!
k!v!�!1�!�!�!�!%"
*"5"+>"j"z"�"�"�"�"�"
�"�"�"
#&#
5#C#]#$z#�#�#�#�#$&$C$I$]$	m$%w$�$%�$�$�$
%-%>%S%�d%�^'(6(*Q(|(�(�(�(B�()
)"4)9W)A�)	�)�)�)
�)�)*!*.*;*!G*i*}*C�*!�*4�*-)+W+]+r+�+e�+	,,,,E,R,k,
�,9�,;�,	- -,-8-H-[-b-.k-
�-�-�-�-�-�-6�-%*.FP."�.�.�.8�.// /&/S@/Y�/�/
	00
0,01060S0p0M�0"�0�01.141GA1	�16�1E�122&2 22S2"[20~2�29�28�21'37Y36�3*�3�3%4,84 e4*�4�46�4�45!535C5\5m5/}5�5L�5*6$.6S6g6,�60�6�6(�6"$7G7)d7$�7�7<�78&838!I8k8�8�8
�8	�8�8$�8I�8=9 D9Ee9B�9*�9':A:#U:1y:�:'�:*�:);B;a;,�;�;�;�;
�;
�;</<FB<�<�<�<5�<�<	=@=Q=#f=!�=!�=�=�=�=
�=�=>3>J>g>*�>$�>5�>&?2-?/`?)�?�?%�?�?�?@	 @4*@!_@7�@&�@�@9�@0A#CAgA\9�g3��a_K��u��^&�Y�R�X6����V{/T��e��}���O�sAG�J�W+����tp�l�#c;)�����j�o,�-��1����]����LFvb�r�k$�!7I*m�h�����xN��	�S�@:8<�q�MzD� U[�Q�|(?�
>0�w�2��B`4�
y�"n��.�d�fiE��~�����'5=C�P��H%Z
%6d regular files
%6d directories
%6d character device files
%6d block device files
%6d links
%6d symbolic links
------
%6d files

%6ld inodes used (%ld%%)

*** %s: directory ***


******** %s: Not a text file ********


***Back***


...Skipping 
Pattern not found
  Overflow
  b          Toggle bootable flag of the current partition  d          Delete the current partition  h          Print this screen  n          Create new partition from free space  q          Quit program without writing partition table Remove badsect ecc removable"%s" line %d%6ld zones used (%ld%%)
%ld blocks
%ld inodes
%s failed.
%s is clean, no check.
%s is mounted.	 %s succeeded.
%s-sided, %d tracks, %d sec/track. Total capacity %d kB.
%s: assuming RTC uses UTC ...
%s: cannot add inotify watch.%s: cannot read inotify events(EOF)(Next file: (Next file: %s)-------      -----------------------------------
FILE SYSTEM HAS BEEN CHANGED
----------------------------
--More--...Skipping back to file ...Skipping to file ...skipping
...skipping backward
...skipping forward
Architecture:Block %d in file `%s' is marked not in use.Block has been used before. Now in file `%s'.BlockSize: %d
BootableCPU MHz:CPU family:CPU op-mode(s):ClearCorrectCreate new partition from free spaceCylindersDeleteDelete the current partitionDevice: %s
Do you really want to continueDoubleDown Arrow   Move cursor to the next partitionFSname: <%-6s>
Filesystem on %s is dirty, needs checking.
Filesystem state=%d
First %sFlagsForcing filesystem check on %s.
Formatting ... HeadsHelpHypervisor vendor:Inode %d marked unused, but used for file '%s'
Internal error: trying to write bad block
Write request ignored
Line too longMark in useModel:NUMA node(s):NameNewNo next fileNo previous fileNo remembered search stringNote: All of the commands can be entered with either upper or lowerOnly 1k blocks/zones supportedPattern not foundPrint help screenQuitRE error: RO    RA   SSZ   BSZ   StartSec            Size   Device
ROM imageRead error: bad block in file '%s'
Read error: unable to seek to block in file '%s'
Read: Remove blockSetSet i_nlinks to countSingleThe file `%s' has mode %05o
Toggle bootable flag of the current partitionTypeUnable to allocate buffer for inode countUnable to allocate buffer for inode mapUnable to allocate buffer for inodesUnable to allocate buffer for zone countUnable to allocate buffer for zone mapUnable to read inode mapUnable to read inodesUnable to read zone mapUnable to write inode mapUnable to write inodesUnable to write zone mapUnmarkUp Arrow     Move cursor to the previous partitionUsing UTC time.
Using local time.
Vendor ID:Verifying ... Virtualization type:Virtualization:Volume: <%-6s>
Warning: inode count too big.
WriteWrite partition table to disk (this might destroy data)Zone nr < FIRSTZONE in file `%s'.Zone nr >= ZONES in file `%s'.Zonesize=%d
[Not a file] line %d[Press 'h' for instructions.][Press space to continue, 'q' to quit.][Use q or Q to quit]bad filename lengthbad inode offsetbad inode sizebad magic number in super-blockbad root offset (%lu)bad v2 inode sizeblocks argument too large, max is %llubogus mode: %s (%o)bytes/sectorcan't fork
cannot get size of %scannot open %scheck aborted.
chown failed: %scrc errorcylinderscylinderskewdata block too largedirectory inode has zero offset and non-zero size: %sdone
fifo has non-zero size: %sfile inode has zero offset and non-zero sizefile inode has zero size and non-zero offsetfile length too shortfilename length is zeroflush buffersfork() failed, try again later
fsname name too longget blocksizeget filesystem readaheadget logical block (sector) sizeget max sectors per requestget minimum I/O sizeget optimal I/O sizeget physical block (sector) sizeget read-onlyget readaheadget size in bytesheadswitchinterleaveinternal errorinvalid file data offsetioctl failed: unable to determine device size: %slchown failed: %smkdir failed: %smknod failed: %sneed terminal for interactive repairsno label, no uuid
not enough space, need at least %llu blocksparse error: %sreread partition tableroot inode is not directoryroot inode isn't a directoryrpmsavedsectors/cylindersectors/trackseek failedset filesystem readaheadset read-onlyset read-writeset readaheadsize error in symlink: %ssocket has non-zero size: %sspecial file has non-zero offset: %ssuperblock magic not foundsuperblock size (%d) too smallsymbolic link has zero offsetsymbolic link has zero sizesymlink failed: %stoo many inodes - max is 512totaltrack-to-track seektracks/cylindertrackskewunable to alloc buffer for superblockunable to read super blockunable to test CRC: old cramfs formatunable to write super-blockunknown column: %sunsupported filesystem featuresutime failed: %svolume name too longwrite failed: %sProject-Id-Version: util-linux-ng 2.18-rc2
Report-Msgid-Bugs-To: util-linux@vger.kernel.org
POT-Creation-Date: 2018-07-16 12:35+0200
PO-Revision-Date: 2010-08-23 18:09+0200
Last-Translator: Fran Diéguez <frandieguez@ubuntu.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Launchpad-Export-Date: 2010-08-23 14:24+0000
X-Generator: Launchpad (build Unknown)
Plural-Forms: nplurals=2; plural=(n!=1);

%6d ficheiros normais
%6d directorios
%6d ficheiros de dispositivos de caracteres
%6d ficheiros de dispositivos de bloques
%6d ligazóns
%6d ligazóns simbólicas
------
%6d ficheiros

%6ld nodos-i usados (%ld%%)

*** %s: directorio	 ***


*** %s: Non é un ficheiro de texto ***


***Atrás***


...Saltando
Non se encontrou o patrón
  Desbordamento
  b          Trocar a opción de arrinque para a partición actual  d          Eliminar a partición actual  h          Imprime esta pantalla  n          Crea unha nova partición desde espazo libre  q          Sae do programa sen escribir a táboa de particións Eliminar badsect ecc removable«%s» liña %d%6ld zonas usadas (%ld%%)
%ld bloques
%ld nodos-i
%s fallou.
%s está limpo, non se comproba.
%s está montado.	 %s tivo éxito.
%s caras, %d pistas, %d sectores/pista. Capacidade total de %d kB.
%s: asumindo que RTC usa UTC ...
%s: non é posíbel engadir un vixilante de inotify.%s: non é posíbel ler os eventos de inotify(EOF)(Seguinte ficheiro: (Seguinte ficheiro: %s)-------      -----------------------------------------
O SISTEMA DE FICHEIROS CAMBIOU
----------------------------------
--Máis--...Retrocedendo ao ficheiro ...Saltando ao ficheiro ...omitindo
...omitindo cara atrás
...omitindo cara adiante
Arquitectura:O bloque %d no ficheiro «%s» está marcado como en uso.O bloque foi usado anteriormente. Agora no ficheiro «%s».Tamaño do bloque: %d
ArrincábelMhz do CPU:Familia do CPU:Modo(s) OP da CPU:BorrarCorrectoCrea unha nova partición desde o espazo libreCilíndrosEliminarElimina a partición actualDispositivo: %s
Desexa continuar?DobreFrecha Abaixo     Move o cursor á seguinte particiónNome do sistema de ficheiros: <%-6s>
O sistema de ficheiros en %s está sucio, precisa unha comprobación.
Estado do sistema de ficheriso=%d
Primeiro %sOpciónsForzando a comprobación do sistema de ficheiros en %s.
Formateando... CabezasAxudaFabricante do hypervisor:O nodo-i %d marcouse como non utilizado, pero estase usando para o ficheiro «%s»
Erro interno: tentando escribir un bloque incorrecto
Ignorouse a solicitude de escritura
A liña é demasiado longaMarcar en usoModeloNodo(s) NUMA:NomeNovaNon hai un seguinte ficheiroNon hai un ficheiro anteriorCadea de busca non lembradaNota: Todas as ordes poden inserirse tanto en maiúsculas como en minúsculasSó se admiten bloques/zonas de 1kNon se encontrou o patrónImprime esta pantallaSaírErro de RE: RO    RA   SSZ   BSZ   SectordeInicio            Tamaño   Dispositivo
Imaxe ROMErro de lectura: bloque incorrecto no ficheiro «%s»
Erro de lectura: non é posíbel buscar nun bloque o ficheiro «%s»
Ler: Eliminar bloqueEstabelecerEstabelecer i_nlinks para contarSinxeloO ficheiro «%s» ten o modo %05o
Troca a opción de arrinque da partición actualtipoNon é posíbel reservar o búfer para a conta de nodos-iNon é posíbel reservar o búfer para o mapa de nodos-iNon é posíbel reservar o búfer para os nodos-iNon é posíbel reservar o búfer para a conta de zonasNon é posíbel reservar o búfer para o mapa de zonasNon é posíbel reservar o mapa de nodos-iNon é posíbel ler os nodos-iNon é posíbel ler a táboa de zonasNon é posíbel escribir a táboa de nodos-iNon é posíbel escribir nodos-iNon é posíbel escribir a táboa de zonasEliminar marcaFrecha Arriba     Move o cursor á anterior particiónUsando a hora UTC.
Usando a hora local.
ID do fabricante:Verificando... Tipo de virtualización:Virtualización:Volume: <%-6s>
Aviso: a conta de nodos-i é demasiado grande.
EscribirEscribir a táboa de particións ao disco (isto podería destruír os datos)Zona nr < PRIMEIRAZONA no ficheiro «%s».Zona nr >= ZONAS no ficheiro «%s».Tamaño da zona=%d
[Non é un ficheiro] liña %d[Prema «h» para consultar as instrucións][Prema espacio para continuar, «q» para saír][Use q ou Q para saír]lonxitude do nome de ficheiro incorrectadesprazamento do nodo-i incorrectotamaño de nodo-i incorrectonúmero máxico incorrecto no superbloquedesprazamento raíz incorrecto (%lu)tamaño de nodo-i v2 incorrectoo argumento de bloques é demasiado longo, o máximo é %llumodo bogus: %s : (%o)bytes/sectornon se pode bifurcar
non se pode obter o tamaño de %snon se pode abrir %scomprobación abortada.
chown fallou: (%s)crc falloucilindroscylinderskewo bloque de datos é demasiado longoo nodo-i do cartafol ten un desprazamento cero ou un tamaño non cero: %sfeito
fifo ten un tamaño non cero: %so nodo-i do ficheiro ten un desprazamento cero ou un tamaño non ceroo ficheiro nodo-i ten un tamaño cero ou un desprazamento non ceroa lonxitude do ficheiro é demasiado curtaa lonxitude do nome do ficheiro é cerobaleira os búferesfork() fallou, ténteo máis tarde
o nome do sistema de ficheiros é demasiado longoobter o tamaño do bloqueobtén sistema de ficheiros `readahead'obter o tamaño do bloque lóxico (sector)obter os sectores máximos por solicitudeobter o tamaño de E/S mínimoobter o tamaño de E/S óptimoobtener o tamaño do bloque físico (sector)obtén só lecturaobtén «readahead»obtén o tamaño en bytesheadswitchinterleaveErro internodesprazamento dos datos do ficheiro non válidoioctl fallou: non foi posíbel determinar o tamaño do dispositivo: %slchown fallou: (%s)mkdir fallou: (%s)mknot fallou: %sNecesítase a terminal para reparacións interactivassen etiqueta, sen uuid
non hai espazo suficiente, necesítanse cando menos %llu bloqueserro de análise: %svolve a ler a táboa de particiónso nodo-i raíz non é un cartafolo nodo-i raíz non é un cartafolr.p.m.gardadosectores/cilindrosectors/pistaproduciuse un fallo na buscaestabelece «readahead»estabelece só lecturaestabelece lectura/escrituraestabelece «readahead»erro de tamaño na ligazón simbólica: %so socket ten un tamaño non cero: %so ficheiro especial ten un desprazamento non cero: %snon se encontrou o superbloque máxicoO tamaño do superbloque (%d) é demasiado pequenoa ligazón simbólica ten un desprazamento ceroa ligazón simbólica ten un tamaño cerosymlink fallou: %sdemasiados nodos-i - o máximo é 512totalbusca de pista-a-pistapistas/cilindrotrackskewnon é posíbel reserver o búfer para o superbloquenon é posíbel ler o superbloquenon foi posíbel probar o CRC: formato de cramfs antigoNon é posíbel escribir o superbloqueOrde descoñecida: %sCaracterísticas do sistema de ficheiros non compatíbeisutime fallou: (%s)o nome do volume é demasiado longowrite falou: (%s)PK�m�\(A�M��LC_MESSAGES/iso_15924.monu�[��������,	018AIR	Xbhp|������������
!
>
E
`
h
&q
�
�
(�
�
�
	&8
MX_gmv�����	+A.X�����
��#��
/FU[d
m{��	��
�����
	(&O	a-k���#�"�)�
#.:Leks	��
���� �
	#
*5DP	Xbow~������	'.3;M%V|�����cj	r|�	�������������� 
#.$R$w��	�	�3�/+[m�����������0Kex�#���/� '09	BL+R!~��������
!'-6GPfx�
��6��->SX!^%������	(2HP`"z#�
��
��
���	 *7FOl��	�������

2+=im��nE�0NZtHKW3@s�w><f�~*�a8h?r:�1IdP\ YkO)
T�y'l]pL�x	+j!R_e5�,Cb�G7}X"&�JQ�%F{qAcS$�9z4�(^�m�|VB�.gv�/u=6i-[
�;2MoU`#DArabicArmenianAvestanBalineseBamumBassa VahBatakBengaliBlissymbolsBook PahlaviBopomofoBrahmiBrailleBugineseBuhidCarianChakmaChamCherokeeCirthCode for inherited scriptCode for uncoded scriptCode for undetermined scriptCode for unwritten documentsCopticCuneiform, Sumero-AkkadianCypriotCyrillicCyrillic (Old Church Slavonic variant)Deseret (Mormon)Devanagari (Nagari)Duployan shorthand, Duployan stenographyEgyptian demoticEgyptian hieraticEgyptian hieroglyphsElbasanEthiopic (Geʻez)Georgian (Mkhedruli)GlagoliticGothicGranthaGreekGujaratiGurmukhiHan (Hanzi, Kanji, Hanja)Han (Simplified variant)Han (Traditional variant)Hangul (Hangŭl, Hangeul)Hanunoo (Hanunóo)HebrewHiraganaImperial AramaicIndus (Harappan)Inscriptional PahlaviInscriptional ParthianJapanese (alias for Han + Hiragana + Katakana)JavaneseKaithiKannadaKatakanaKayah LiKharoshthiKhmerKhutsuri (Asomtavruli and Nuskhuri)Korean (alias for Hangul + Han)KpelleLaoLatinLatin (Fraktur variant)Latin (Gaelic variant)Lepcha (Róng)LimbuLinear ALinear BLisu (Fraser)LomaLycianLydianMalayalamMandaic, MandaeanManichaeanMathematical notationMayan hieroglyphsMeitei Mayek (Meithei, Meetei)Meroitic CursiveMiao (Pollard)MongolianMoon (Moon code, Moon script, Moon type)Myanmar (Burmese)NabataeanNakhi Geba ('Na-'Khi ²Ggŏ-¹baw, Naxi Geba)New Tai LueN’KoOghamOl Chiki (Ol Cemet’, Ol, Santali)Old Italic (Etruscan, Oscan, etc.)Old North Arabian (Ancient North Arabian)Old PermicOld PersianOld South ArabianOld Turkic, Orkhon RunicOriyaOsmanyaPahawh HmongPalmyrenePhags-paPhoenicianPsalter PahlaviRejang (Redjang, Kaganga)Reserved for private use (end)Reserved for private use (start)RongorongoRunicSamaritanSaratiSaurashtraShavian (Shaw)SignWritingSinhalaSundaneseSyloti NagriSymbolsSyriacSyriac (Eastern variant)Syriac (Estrangelo variant)Syriac (Western variant)Tagalog (Baybayin, Alibata)TagbanwaTai LeTai Tham (Lanna)Tai VietTamilTeluguTengwarThaanaThaiTibetanTifinagh (Berber)UgariticUnified Canadian Aboriginal SyllabicsVaiVisible SpeechWarang Citi (Varang Kshiti)YiProject-Id-Version: iso_15924
Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues
POT-Creation-Date: 2018-01-17 22:10+0100
PO-Revision-Date: 2010-10-07 10:51+0200
Last-Translator: Fran Diéguez <frandieguez@ubuntu.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n!=1);
ÁrabeArmenioAvésticoBalineseBamumBassa VahBatakBengalíSímbolos BlissPahlavi de libroBopomofoBrahmiBrailleBuxinésBuhidCarioChakmaChamCherokeeCirthCódigo para escrita non herdadaCódigo para escrita non codificadaCódigo para escrita non determinadaCódigo para documentos non escritosCoptoCuneiforme, sumerio-acadioChipriotaCirílicoCirílico (alfabeto do eslavo eclesiástico antigo)Deseret (mormón)Devanagari (Nagari)Taquigrafía Duployan, Esteganografía DuployanExipcio demóticoExipcio hieráticoXeroglifos exipciosElbasanEtiópico (Geʻez)Xeorxiano (Mkhedruli)GlagolíticoGóticoGranthaGregoGuxaratiGurmukhiHan (Hanzi, Kanji, Hanja)Han (variante simplificada)Han (variante tradicional)Hangul (Hangŭl, Hangeul)Hanunoo (Hanunóo)HebreoHiraganaArameo imperialProto-índico (alfabeto de Harappa)Pahlavi InscricionalParthian inscricionalXaponés (alias para han + hiragana + katakana)XavanésKaithiCanarésKatakanaKayah LiKharosthiKhmerKhutsuri xeorxiano (Asomtavruli y Nuskhuri)Coreano (alias para hangul + han)KpellelaoLatinoLatino (variante fraktur)Latino (variante gaélica)Lepcha (Róng)LimbuLineal ALineal BLisu (Fraser)LomaLicioLidioMalaialaMandeo, MandaicoManiqueoNotación matemáticaXeroglífos MaiasMeitei Mayek (Meithei, Meetei)Meroítico cursivoMiao (Polaco)MongolMoon (código moon, alfabeto moon, tipo de letra moon)Myanmar (birmano)NabateoNakhi Geba ('Na-'Khi ²Ggŏ-¹baw, Naxi Geba)Tai Lue simplificadoN'KoOghamOl Chiki (Ol Cemet', Ol, Santali)Itálico antigo (etrusco, osco, etc.)Árabe antigo do nortePérmico antigoPersa antigoÁrabe antigo do surTurco antigo, Orkhon RúnicoOrixaOsmaniyaPahawh hmongPalmyrenepassepa (hor gsar yi)FenicioPsalter PahlaviRejang (redjang, kaganga)Reservado para uso privado (final)Reservado para uso privado (inicio)RongorongoRúnicoSamaritanoSaratiSaurashtrashavianoSignWriting (escrita xestual)SinhalaSundanésSyloti NagriSímbolos blisSiríacoSiríaco (variante oriental)Siríaco (variante Estrangelo)Siríaco (variante occidental)Tagalog (baybayin, alibata)TagbanúaTai LeTai Tham (Lanna)Tai leTamilTeluguTengwarThaanaTailandésTibetanoTifinagh (Bereber)UgaríticoSilabarios indíxenas canadenses unificadosVaiLocución visíbelWarang citi (Varang kshiti)yiPK�m�\w��c�K�KLC_MESSAGES/shadow.monu�[�������L
��&�_�:D-�#��#&
3>bG
�����%�%,Er%�����<2C+v�$�"�%
0(Ir$� �#��J$o� ���� 7U"m���� #"Fa"} ��=�" ;+\%�,�%� ,"(Ox� �>�bk�%�$���$,Ql~&� �#�%**Uh}��3 Op	�G�
��� !/ Q i ~ 9� � � � 6!<!6Q!�!�!$�!�!�!�!@"8C"|"�"�"�""�"�"�"
#2#Q#i#�# �#'�#"�#$$;$
M$X$"n$�$
�$�$�$�$'�$1&%2X%�%�%
�% �%�%�%&&&>&Y&'t& �&#�&�&�&'?'#V'z'�'�'�'�'�'(-(F(\(u(�(�("�(�())!#)E)d)	j)#t)&�)�)%�)&�)*1*+9*e*�*	�*�*
�*,�*z�*\,1h,q�,M-<Z-�-)�-�-2�-0.B.N.zW.
�.�.�.�.
/)%/)O/(y/�/2�/�/0$0;0CV0@�07�0&1=:1=x15�1�1+242.S2#�2,�2!�2�2Q3c3"�3%�3 �3�34($4(M4v4)�4(�4*�4%5,65/c53�5 �5#�5'6'46\6Xq6�6�6$�677.W76�7.�7!�7983H8|8#�8 �8L�8a+9$�9�9-�9(�9:#1:U:.s:!�:�:�:-�:');$Q;*v;E�; �;+<%4<�Z<>�<)$=(N=
w=T�=�= �=
>")>*L>w>�>#�>:�>
?"?5?<R?�?<�?�?�?*@:@/J@"z@U�@B�@6AKA"QAtA+�A�A�A
�A8�A%4B$ZBB7�B)�B#�BC4CSCmC|C)�C�C�C�C�CD(7D2`D?�D�D�D
E&#EJEVEgE'}E�E!�E+�E"F$1FVF eF"�FM�F'�FG7GPG kG!�G'�G5�G.H";H)^H�H/�H0�H6	I!@IbI�I#�I'�I�I�I>�ID)JnJ0zJ.�J�J�J8�J)7KaKvK�K�K4�K@Q��iT_K��}�L�W'7|��"Vp�u�b�	)�P3t���E?�,���N�Yz��GqB�~U:���I�5�kl��� 1e<��f�=0[�h�X�(OR�
H���/������;Cc-�F�*�&$��#rD�>�4���s
�9��j��y�a�����J\����w�{o8g.A^�x]�m`6�v+M�nd�%����2�SZ�!
%s login: 
System closed for routine maintenance
Type control-d to proceed with normal startup,
(or give root password for system maintenance):
Warning: weak password (enter it again to use it anyway).
[Disconnect bypassed -- root login allowed.]       %s [-p] -r host
       %s [-p] [-h host] [-f name]
  Choose a new password.  Contact the system administrator. [%lds lock] from %.*s groups=%d failure since last login.
Last was %s on %s.
%d failures since last login.
Last was %s on %s.
%s login: %s's Password: %s: %s
%s: %s
(Ignored)
%s: %s is the NIS master
%s: %s not owned by %s, not removing
%s: '%s' contains illegal characters
%s: '%s' is the NIS master for this client.
%s: -K requires KEY=VALUE
%s: Cannot determine your user name.
%s: Invalid entry: %s
%s: Not a tty
%s: Permission denied.
%s: Try again later
%s: You may not view or modify password information for %s.
%s: can't restore %s: %s (your changes are in %s)
%s: cannot change user '%s' on NIS client.
%s: cannot create directory %s
%s: cannot create new defaults file
%s: cannot open new defaults file
%s: cannot rename directory %s to %s
%s: directory %s exists
%s: do not include "l" with other flags
%s: error changing fields
%s: error detected, changes ignored
%s: error removing directory %s
%s: failed to drop privileges (%s)
%s: failure forking: %s%s: fields too long
%s: group %s exists - if you want to add this user to that group, use -g.
%s: group %s is a NIS group
%s: group '%s' is a NIS group.
%s: invalid base directory '%s'
%s: invalid comment '%s'
%s: invalid date '%s'
%s: invalid field '%s'
%s: invalid home directory '%s'
%s: invalid home phone: '%s'
%s: invalid name: '%s'
%s: invalid numeric argument '%s'
%s: invalid room number: '%s'
%s: invalid shell '%s'
%s: invalid user name '%s'
%s: invalid work phone: '%s'
%s: line %d: can't update entry
%s: line %d: can't update password
%s: line %d: invalid line
%s: line %d: line too long
%s: line %d: missing new password
%s: must be run from a terminal
%s: no changes
%s: not removing directory %s (would remove home of user %s)
%s: out of memory
%s: pam_start: error %d
%s: repository %s not supported
%s: shadow group passwords required for -A
%s: shadow passwords required for -e
%s: shadow passwords required for -e and -f
%s: shadow passwords required for -f
%s: the files have been updated
%s: the shadow password file is not present
%s: too many groups specified (max %d).
%s: unknown user %s
%s: user %s is a NIS user
%s: warning: %s not owned by %s
%s: warning: failed to completely remove old home directory %s%s: warning: the home directory already exists.
Not copying any file from skel directory into it.
(Enter your own password)**Never logged in**Access to su to that account DENIED.
Account Expiration Date (YYYY-MM-DD)Account expires						: Adding user %s to group %s
Bad password: %s.  Can't change root directory to '%s'
Cannot change ID to root.
Cannot execute %sChanging password for %s
Changing the aging information for %s
Changing the login shell for %s
Changing the password for group %s
Changing the user information for %s
Could not allocate space for config info.
Couldn't lock fileCouldn't make backupCreating mailbox fileEnter the new password (minimum of %d, maximum of %d characters)
Please use a combination of upper and lower case letters and numbers.
Enter the new value, or press ENTER for the defaultEntering System Maintenance ModeEnvironment overflow
Full NameGroup 'mail' not found. Creating the user mailbox file with 0600 mode.
Home PhoneIncorrect password for %s.
Invalid login timeInvalid root directory '%s'
Last Password Change (YYYY-MM-DD)Last login: %.19s on %sLast login: %s on %sLast password change					: Login       Failures Maximum Latest                   On
Login ShellLogin incorrectMaximum Password AgeMaximum number of days between password change		: %ld
Minimum Password AgeMinimum number of days between password change		: %ld
New Password: New password: No directory, logging in with HOME=/No mail.No password entry for 'root'No password fileNo utmp entry.  You must exec "login" from the lowest level "sh"Number of days of warning before password expires	: %ld
Old password: OtherPassword Expiration WarningPassword InactivePassword authentication bypassed.
Password expires					: Password inactive					: Password: Please enter your OWN password as authentication.
Re-enter new password: Removing user %s from group %s
Room NumberSetting mailbox file permissionsThe password for %s cannot be changed.
The password for %s is unchanged.
They don't match; try againThey don't match; try again.
Too many logins.
Try again.Unable to cd to '%s'
Unable to determine your tty name.Usage: %s [-p] [name]
Usage: id
Usage: id [-a]
Usage: newgrp [-] [group]
Usage: sg group [[-c] command]
Username                Port     LatestUsername         Port     From             LatestWarning: login re-enabled after temporary lockout.Warning: too many groups
Warning: unknown group %s
Work PhoneYou are not authorized to su %s
You have mail.You have new mail.You may not change $%s
Your login has expired.Your password has expired.Your password is inactive.Your password will expire in %ld days.
Your password will expire today.Your password will expire tomorrow.a palindromeadd user '%s' in %s? case changes onlyconfiguration error - unknown item '%s' (notify administrator)
delete administrative member '%s'? delete line '%s'? delete member '%s'? duplicate group entryduplicate password entryduplicate shadow group entryduplicate shadow password entryfailed to change mailbox ownerfailed to rename mailboxgroup %s: no user %s
invalid group file entryinvalid group name '%s'
invalid password file entryinvalid shadow group file entryinvalid shadow password file entryinvalid user name '%s'
login time exceeded

login: login: PAM Failure, aborting: %s
login: abort requested by PAM
neverno changeno matching group file entry in %s
no matching password file entry in %s
passwd: %s
passwd: pam_start() failed, error %d
passwd: password updated successfully
password must be changedrotatedshadow group %s: no administrative user %s
shadow group %s: no user %s
too many groups
too shorttoo similartoo simpleuser %s: last password change in the future
Project-Id-Version: shadow 4.0.18
Report-Msgid-Bugs-To: pkg-shadow-devel@lists.alioth.debian.org
PO-Revision-Date: 2006-07-18 23:27+0200
Last-Translator: Jacobo Tarrio <jtarrio@debian.org>
Language-Team: Galician <trasno@ceu.fi.udc.es>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=n!=1;

%s login: 
O sistema está pechado por mantemento rutinario
Escriba control-d para seguir co inicio normal,
(ou escriba o contrasinal de root para o mantemento do sistema):
Aviso: contrasinal feble (introdúzao outra vez para o empregar igualmente).
[Omitida a desconexión -- permítese a entrada coma root.]         %s [-p] -r servidor
         %s [-p] [-h servidor] [-f nome]
 Escolla un novo contrasinal. Póñase en contacto co administrador do sistema. [bloqueado %lds] desde %.*s grupos=%d fallo desde a última entrada.
O último foi o %s en %s.
%d fallos desde a última entrada.
O último foi o %s en %s.
%s login: Contrasinal de %s: %s: %s
%s: %s
(Ignórase)
%s: %s é o mestre NIS
%s: %s non pertence a %s, non se elimina
%s: "%s" contén caracteres non válidos
%s: "%s" é o mestre NIS deste cliente.
%s: -K precisa de CLAVE=VALOR
%s: Non se pode determinar o seu nome de usuario.
%s: Entrada non válida: %s
%s: Non é un tty
%s: Permiso denegado.
%s: Volva tentalo despois
%s: Non pode ver ou modificar a información de contrasinal de %s.
%s: non se pode restaurar %s: %s (os seus cambios están en %s)
%s: non se pode cambiar o usuario "%s" no cliente NIS.
%s: non se pode crear o directorio %s
%s: non se pode crear o novo ficheiro de valores por defecto
%s: non se pode abrir o novo ficheiro de valores por defecto
%s: non se pode cambiar o nome do directorio %s a %s
%s: o directorio %s existe
%s: non inclúa "l" con outros indicadores
%s: erro ao cambiar os campos
%s: detectouse un erro, ignóranse os cambios
%s: erro ao borrar o directorio %s
%s: non se puido deixar os privilexios (%s)
%s: fallo ao lanzar o proceso: %s%s: campos longos de máis
%s: o grupo %s existe - se quere engadir este usuario a este grupo, empregue -g.
%s: o grupo %s é un grupo NIS
%s: o grupo "%s" é un grupo NIS.
%s: directorio base "%s" non válido
%s: comentario "%s" non válido
%s: data "%s" non válida
%s: campo "%s" non válido
%s: directorio inicial "%s" non válido
%s: teléfono da casa non válido: "%s"
%s: nome non válido: "%s"
%s: argumento numérico "%s" non válido
%s: número de cuarto non válido: "%s"
%s: intérprete de ordes "%s" non válido
%s: nome de usuario "%s" non válido
%s: teléfono do traballo non válido: "%s"
%s: liña %d: non se pode actualizar a entrada
%s: liña %d: non se pode actualizar o contrasinal
%s: liña %d: liña non válida
%s: liña %d: liña longa de máis
%s: liña %d: falla o novo contrasinal
%s: débese executar dende un terminal
%s: non hai cambios
%s: non se elimina o directorio %s (había eliminar o directorio inicial do usuario %s)
%s: memoria esgotada
%s: pam_start(): erro %d
%s: non se soporta o repositorio %s
%s: precísase de contrasinais de grupo shadow para -A
%s: precísase de contrasinais shadow para -e
%s: precísase de contrasinais de shadow para -e e -f
%s: precísase de contrasinais shadow para -f
%s: actualizáronse os ficheiros
%s: o ficheiro de contrasinais shadow non está presente
%s: especificáronse grupos de máis (máximo %d).
%s: usuario %s descoñecido
%s: o usuario %s é un usuario NIS
%s: aviso: %s non pertence a %s
%s: aviso: non se puido eliminar completamente o vello directorio inicial %s%s: aviso: o directorio inicial xa existe.
Non se copia nel ningún ficheiro do directorio skel.
(Introduza o seu propio contrasinal)**Nunca entrou**O acceso a su para esa conta está DENEGADO.
Data de caducidade da conta (AAAA-MM-DD)A conta caduca						: A engadir o usuario %s ao grupo %s
Contrasinal non válido: %s. Non se pode cambiar o directorio raíz a "%s"
Non se pode cambiar o ID a root.
Non se pode executar %sA cambiar o contrasinal de %s
A cambiar a información de caducidade de %s
A cambiar o intérprete de ordes de %s
A cambiar o contrasinal do grupo %s
A cambiar a información de usuario de %s
Non se puido reservar espacio para a información de configuración.
Non se puido bloquear o ficheiroNon se puido facer unha copia de seguridadeA crear o ficheiro da caixa do correoIntroduza o novo contrasinal (mínimo de %d, máximo de %d caracteres)
Empregue unha combinación de maiúsculas, minúsculas e números.
Introduza o novo valor ou prema Intro para o valor por defectoA entrar no modo de mantemento do sistemaDesbordamento nas variables de ambiente
Nome completoNon se atopou o grupo "mail". Hase crear a caixa do correo do usuario co modo 0600.
Teléfono da casaContrasinal incorrecto para %s.
Hora de entrada non válidaDirectorio raíz "%s" non válido
Último cambio de contrasinal (AAAA-MM-DD)Última entrada: %.19s en %sÚltima entrada: %s en %sÚltimo cambio de contrasinal				: Usuario     Fallos   Máximo  Último                   O
Intérprete de ordesEntrada incorrectaIdade máxima do contrasinalNúmero máximo de días entre cambios de contrasinal	: %ld
Idade mínima do contrasinalNúmero mínimo de días entre cambios de contrasinal	: %ld
Novo contrasinal: Novo contrasinal: Non hai un directorio, éntrase con HOME=/Non hai correo.Non hai unha entrada de contrasinal para "root"Non é un ficheiro de contrasinaisNon hai unha entrada en utmp. Debe executar "login" dende o "sh" de nivel máis baixoNúmero de días de aviso antes de que caduque o contrasinal: %ld
Contrasinal antigo: OutroAviso de caducidade de contrasinalContrasinal inactivoOmitiuse a autenticación por contrasinal.
O contrasinal caduca					: Contrasinal inactivo					: Contrasinal: Introduza O SEU PROPIO contrasinal para autenticación.
Volva introducir o novo contrasinal: A eliminar o usuario %s do grupo %s
Número de cuartoA estabrecer os permisos do ficheiro da caixa do correoNon se pode cambiar o contrasinal de %s.
Non se cambiou o contrasinal de %s
Non coinciden, volva tentaloNon coinciden; volva tentalo.
Entrou demasiadas veces.
Volva tentalo.Non se puido cambiar a "%s"
Non se pode determinar o nome do seu tty.Emprego: %s [-p] [nome]
Emprego: id
Emprego: id [-a]
Emprego: newgrp [-] [grupo]
Emprego: sg grupo [[-c] orde]
Usuario                 Porto    ÚltimaUsuario          Porto    Desde            ÚltimaAviso: vólvese permitir a entrada despois do bloqueo temporal.Aviso: hai grupos de máis
Aviso: grupo %s descoñecido
Teléfono do traballoNon está autorizado para facer su %s
Ten correo.Ten novo correo.Non pode cambiar $%s
O seu identificador de usuario caducou.O seu contrasinal caducou.O seu contrasinal está inactivo.O seu contrasinal ha caducar en %ld días.
O seu contrasinal ha caducar hoxe.O seu contrasinal ha caducar mañá.un palíndromo¿engadir o usuario "%s" en %s? só cambia maiúsculas/minúsculaserro de configuración - elemento "%s" descoñecido (avise ao administrador)
¿borrar o membro administrativo "%s"? ¿borrar a liña "%s"? ¿borrar o membro "%s"? entrada de grupo duplicadaentrada de contrasinal duplicadaentrada de grupo shadow duplicadaentrada de contrasinal shadow duplicadanon se puido cambiar o propietario da caixa do correonon se puido cambiar o nome da caixa do correogrupo %s: non existe o usuario %s
entrada do ficheiro de grupos non válidanome de grupo "%s" non válido
entrada do ficheiro de contrasinais non válidaentrada do ficheiro de grupos shadow non válidaentrada do ficheiro de contrasinais shadow non válidanome de usuario "%s" non válido
superouse o tempo de entrada

login: login: Fallo en PAM, a abortar: %s
login: cancelación solicitada por PAM
nuncaningún cambionon hai unha entrada do ficheiro de grupos que coincida en %s
non hai unha entrada do ficheiro de contrasinais que coincida en %s
passwd: %s
passwd: a chamada a pam_start() fallou, erro %d
passwd: o contrasinal actualizouse con éxito
debe cambiarse o contrasinalrotadogrupo shadow %s: non existe o usuario administrativo %s
grupo shadow %s: non existe o usuario %s
hai grupos de máis
curto de máissemellantes de máissimple de máisusuario %s: último cambio de contrasinal no futuro
PK�m�\:��**LC_MESSAGES/cpio.monu�[�����~���
�
�
�
�
�
0"6Yo0!�
��d4����,�(
,F
-s
 �
(�
�
4Jj��$����\�56Cl?��")0H
P6^�����/�);@3|/�+�'#4Xx��"��+�-HWh����,�49
LZp	�!�	���5�e
s�
�����	�	*4Mcy
~
��������.,D[���#Cg
n|�2�,�'A@.��7�274`l��$!,0N 5�1�#-,'Z� �!�%�%�"'&@gs|o�B�f7@���  
! / 7 O W ?t (� "� !!
!J!^!x!�!:�!2�!."*H"&s""�"�"�"�"#'#D#8]#.�#)�#�#$1%$#W${$$�$(�$C�$S(%|%�%&�%(�%&,&A&U&Y&5j&��&")'L'g'9y'�'�'�'�'/�'.(
C(N(k(�(�(�(�(�(�(!) &)G)M)T)j)n)>�)E�)*R\BSPD`Zo/ bEp
?#GeQg{}fW3=Y:
$sVOir]t	7"[%MX!lT|I;>'j9@~Lvn)zu*_(^+C.-,ydK4m&5JcwHAxa<2qh8U16kFN0
Report bugs to: %s
  or:  [OPTION...]%lu block
%lu blocks
%s home page: <%s>
%s home page: <http://www.gnu.org/software/%s/>
%s is not a character special file%s is not a directory%s linked to %s%s not created: newer or same age version exists%s not dumped: not a regular file%s: Cannot %s%s: Cannot create symlink to %s%s: Cannot hard link to %s%s: Cannot symlink to %s%s: Read error at byte %s, while reading %lu byte%s: Read error at byte %s, while reading %lu bytes%s: Too many arguments
%s: Warning: Cannot %s%s: file name too long%s: invalid option -- '%c'
%s: option '%c%s' doesn't allow an argument
%s: option '%s' is ambiguous
%s: option '--%s' doesn't allow an argument
%s: option '-W %s' doesn't allow an argument
%s: option '-W %s' is ambiguous
%s: option requires an argument -- '%c'
%s: symbolic link too long%s: truncating %s%s: truncating inode number%s: unknown file type%s: unrecognized option '%c%s'
%s: unrecognized option '--%s'
COMMANDCannot open %sCreating intermediate directory `%s'DEVICEFILEFORMATFile %s shrunk by %s byte, padding with zerosFile %s shrunk by %s bytes, padding with zerosFound end of tape.  Load next tape and press RETURN. Found end of tape.  To continue, type device/file name when ready.
General help using GNU software: <http://www.gnu.org/gethelp/>
Invalid size: %sMain operation mode:NAMENUMBEROFFSETOPTIONOperation not supportedPATTERNPremature eofRead error at byte %lld in file %s, padding with zerosReport %s bugs to: %s
Report bugs to %s.
SECSSIZESTRINGTo continue, type device/file name when ready.
Unknown field `%s'Unknown system errorWritten by %s and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, %s, and others.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
and %s.
Written by %s, %s, %s,
%s, %s, %s, and %s.
Written by %s, %s, %s,
%s, %s, and %s.
Written by %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
and %s.
Written by %s, %s, and %s.
Written by %s.
[USER][:.][GROUP]`%s' exists but is not a directoryblank line ignoredcannot get the login group of a numeric UIDcannot link %s to %scannot make directory `%s'cannot open %scannot open `%s'cannot read checksum for %scannot remove current %scannot seekcannot seek on outputcannot set time on `%s'cannot swap bytes of %s: odd number of bytescannot swap halfwords of %s: odd number of halfwordscannot unlink `%s'device numbererror closing archiveexec/tcp: Service not availablefile modefile name contains null characterfile sizegidinode numberinternal error: tape descriptor changed from %d to %dinvalid archive format `%s'; valid formats are:
crc newc odc bin ustar tar (all-caps also recognized)invalid block sizeinvalid count valueinvalid groupinvalid header: checksum errorinvalid usermemory exhaustedmodification timename sizeno tape device specifiednumber of linksoperationpremature end of archivepremature end of fileprint program versionrdevread errorrename %s -> set debug levelset the program namestandard input is closedstandard output is closedstdinstdouttoo many argumentsuidvirtual memory exhaustedwarning: archive header has reverse byte-orderwarning: skipped %ld byte of junkwarning: skipped %ld bytes of junkwrite errorProject-Id-Version: cpio 2.11
Report-Msgid-Bugs-To: bug-cpio@gnu.org
POT-Creation-Date: 2015-09-12 14:33+0300
PO-Revision-Date: 2012-11-10 19:38+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8-bit
Plural-Forms: nplurals=2; plural=(n != 1);

Envíe os informes de fallo a: %s
  ou:  [OPCIÓN...]%lu bloque
%lu bloques
Páxina web de %s: <%s>
%s páxina web: <http://www.gnu.org/software/%s/>
%s non é un ficheiro especial de caracteres%s non é un directorio%s é unha ligazón a %s%s non se creou: existe unha versión coa data igual ou posterior%s non se envorcou: non é un ficheiro regular%s: Non foi posíbel %s%s: non é posíbel crear unha ligazón simbólica a %s%s: non é posíbel crear unha ligazón forte a %s%s: non é posíbel crear unha ligazón simbólica a %s%s: Erro de lectura no byte %s, ao ler %lu byte%s: Erro de lectura no byte %s, ao ler %lu bytes%s: Demasiados argumentos
%s: Aviso: Non foi posíbel %s%s: nome de ficheiro demasiado longo%s: opción incorrecta -- «%c»
%s: a opción «%c%s» non permite un argumento
%s: a opción «%s» é ambigua
%s: a opción «--%s» non permite ningún argumento
%s: a opción «-W %s» non permite un argumento
%s: a opción «-W %s» é ambigua
%s: a opción require un argumento -- «%c»
%s: ligazón simbólica demasiado longa%s: truncando %s%s: trúncase o número de inodo%s: tipo de ficheiro descoñecido%s: opción «%c%s» non recoñecida
%s: opción «--%s» non recoñecida
ORDENon é posíbel abrir %sCreando o directorio intermedio «%s»DISPOSITIVOFICHEIROFORMATOO ficheiro %s reduciuse en %s bytes, enchendo con cerosO ficheiro %s reduciuse en %s bytes, enchendo con cerosAtopouse o remate da cinta. Cargue a seguinte cinta e prema INTRO.Atopouse o remate da cinta. Para continuar, escriba o nome do dispositivo/ficheiro cando estea listo.
Axuda xeral ao usar software GNU: <http://www.gnu.org/gethelp/>
Tamaño incorrecto: %sModo de operación principal:NOMENÚMERODESPRAZAMENTOOPCIÓNOperación non admitidaPATRÓNremate prematuro do ficheiroErro de lectura no byte %lld do ficheiro %s, enchendo con cerosEnvíe os informes de fallo en %s a %s.
Envíe os informes de fallo a %s.
SECSTAMAÑOCADEAPara continuar, escriba o nome do dispositivo/ficheiro cando estea listo.
Campo «%s» descoñecidoErro de sistema descoñecidoEscrito por %s e %s.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
%s, %s, e outros.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
%s, e %s.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
e %s.
Escrito por %s, %s, %s,
%s, %s, %s, e %s.
Escrito por %s, %s, %s,
%s, %s, e %s.
Escrito por %s, %s, %s,
%s, e %s.
Escrito por %s, %s, %s,
e %s.
Escrito por %s, %s e %s.
Escrito por %s.
[USUARIO][:.][GRUPO]«%s» existe pero non é un directorioliña en branco ignoradanon é posíbel obter o grupo de login dun UID numériconon é posíbel crear unha ligazón de %s a %snon é posíbel crear o directorio «%s»non é posíbel abrir %snon é posíbel abrir «%s»non é posíbel ler a suma de comprobación de %snon é posíbel retirar o actual %snon é posíbel posicionarnon é posíbel posicionar na saídanon é posíbel definir a hora en «%s»non é posíbel intercambiar os bytes de %s: número impar de bytesnon é posíbel intercambiar as medias-verbas de %s: número impar de medias-verbasnon é posíbel desligar «%s»número de dispositivoproduciuse un erro ao pechar o arquivoexec/tcp: servizo non está dispoñíbelmodo de ficheiroo nome de ficheiro contén un carácter nulotamaño de ficheirogidnúmero de inodoerro interno: o descritor da cinta cambiou de %d a %dformato de arquivo «%s» non válido, os formatos válidos son:
crc, newc, odc, bin, ustar, tar (indiferente a maiúsculas/minúsculas)o tamaño do bloque non é válidovalor de conta non válidogrupo non válidoa cabeceira non é válida: erro na suma de comprobaciónusuario non válidomemoria esgotadahora de modificacióntamaño do nomenon se especificou ningún dispositivo de cintanúmero de ligazónsoperaciónremate prematuro do ficheiroremate prematuro do ficheiromostra a versión do programardeverro de lecturarenomear %s -> Definir o nivel de depuracióndefine o nome do programaa entrada estándar está pechadaa saída estándar está pechadastdinstdoutdemasiados argumentosuidmemoria virtual esgotadaatención: a cabeceira do arquivo ten os bytes en orde inversaaviso: saltouse %ld byte de lixoaviso: saltáronse %ld bytes de lixoerro de escrituraPK�m�\�q�\\LC_MESSAGES/iso_3166-1.monu�[������
-�"�"�"�"�"�"�"�"
####	:#D#W#_#	e#o#
w#�#�#
�#�#�#�#�#�#�#�# �#�#�# $<$S$
\$j$q$�$�$�$�$�$�$�$�$�$�$%%#%)%:%R%[%t%,�%�%�%%�%�%
�%	&&&&&&5&%D&,j&"�&*�&�&�&�&�&'.'6'<'H'Z'b'j's'
�''�'$�'�'("(>(]({(�(�(
�(�(�(�(�(�(�(�()	)	))3)	:)D)
L)W)	\)f)o)
v)�)�)�)!�)�)�)�)	*0*C*K*%S*y*�*	�*�*�*�*�*�*+#+@+L+S+d+j+r+x++
�+�+�+�+�+�+�+�+	,,.,F,W,l,~,�,�,�,&�,�,--
- #-D-K-]-e-m-u-
{-	�-
�-�-,�-�-
�-�-�-....
(.
3.	>.H.P.W.w..�.�.
�.
�.�.
�.�.�.�.�.�.
�./	///'/,/;/T/[/`/i/o/�/�/�/'�/�/�/000!0@0G0P0d0|0�0�0�0�0�0�0�01)1=1"O1r1�1�1�1�1�1�1�12(292L2g2|2�2�2�2�2�2�23'3:3T3g3y3�3�3�3�3�3�344,4@4V4m4�4�4�4�4�4�4�4
5!535I5[5n5�5�5�5�5�5�5�56+6@6Y6q6�6�6�6�6�6�67"747G7\7 r7�7�7�7�7�7�7�788,*8W8m8y8�8 �8�8
�8�8�899
99	*949N9^9g9p9�9�9�9,�9�9�9	�9�9
::,:2:D:M:	d:n:u:�:�:�:�:
�:�:�:)�:&;2;7;I;Q;W;k;s;z;�;�;�;�;�;�;�;4�;$<:<
V<$d<�<�<
�<�<	�<!�<�<#�<=.=C=U=d=j=q=z=�=�=��=�?�?�?�?�?�?�?
�?@@	/@9@N@V@	\@f@n@z@�@
�@�@�@�@�@�@�@�@#�@�@ A#AAAVA_AkA(rA�A�A�A
�A�A�A�A�A
�AB&B+B1B7BFB\BeB|B&�B�B�B!�B
�B
�BCC
CCC.C(?C0hC&�C/�C	�C�CDD!D@DHD
ODZDlDtD|D�D�D+�D(�DEE=E[E{E�E	�E�E�E�E�E�EFF#F*F2F;F	AFKFeF
lFwF	F�F	�F�F�F
�F�F�F�F�F�F%G8G	AG2KG~G�G)�G�G�G	�G�GH
H#H9H"WH"zH�H�H�H�H�H�H�H�H�H�H�HI I0IAITIdIvI�I�I�I�I�I�I�I	J)JBJWJ^J
sJ&�J�J�J�J�J�J�J
�J�J
�JK.	K8K
QK\KcKkKtKyKK	�K
�K�K�K�K �K�K�K�KL
L
L$L
-L8LALILOLULdL
sL	�L�L�L�L�L�L�L�L
�L�L�L�LMM*M GMhM�M	�M�M�M�M�M�M�M�MN
)N4N:NPNeN{N�N�N�N"�N�NO*O@OWOjO~O�O�O�O�O�OP!P7PNPnP�P�P�P�P�P�P
Q#Q8QOQfQzQ�Q�Q�Q�Q�QRR/RHR]R{R�R�R�R�R�RSS*SBSVSlS�S�S�S�S�S�ST$T;TSTjT�T�T�T�T�TUU4UJU^UsU�U�U�U�U�U�UVV V5V>V,MVzV�V�V�V�V�V
�V�V
W W(W
/W
:WEWNWmW
�W	�W �W�W�W�W)�W
XX	X'X8XIXYX`XsX{X�X�X�X�X�X�X�X�XY	*Y(4Y]YiYnY�Y�Y�Y�Y�Y
�Y�Y�Y�Y�Y�YZZ1%ZWZqZ�Z7�Z�Z�Z[[	[$#[H[+P[|[�[�[�[�[�[�[�[�[
\B��*`
a'����T9��l�RM�
qpe\�y����1�e����/<�tk:|K.�n/i	����VU^J���!Zf�����~k�7C�Q�uw��]�WC�F(�K
��Lzc�+�O�m�A�#��;�3[X��x�"+)��)���5	g} YMZgS������@�,�"|[�a&{}u��bR�?0s1�i$2jX�T�d����$d��2��v�v=��c�zL�0�%��(j��x8V5����;����%A����� D�6�H�W\G>f<,r�?6�YN�7q�Bt����n@��S*h�JP�D{
�#-!lHOr�Um`��I^�8&�E�:E���G��p����-�4�oyP����I'�bw�_N~F3�>4�s�o_�9�.�=�����Q����h]AfghanistanAlbaniaAlgeriaAmerican SamoaAndorraAngolaAnguillaAntarcticaAntigua and BarbudaArab Republic of EgyptArgentinaArgentine RepublicArmeniaArubaAustraliaAustriaAzerbaijanBahamasBahrainBangladeshBarbadosBelarusBelgiumBelizeBeninBermudaBhutanBolivarian Republic of VenezuelaBoliviaBolivia, Plurinational State ofBonaire, Sint Eustatius and SabaBosnia and HerzegovinaBotswanaBouvet IslandBrazilBritish Indian Ocean TerritoryBritish Virgin IslandsBrunei DarussalamBulgariaBurkina FasoBurundiCambodiaCameroonCanadaCayman IslandsCentral African RepublicChadChileChinaChristmas IslandCocos (Keeling) IslandsColombiaCommonwealth of DominicaCommonwealth of the BahamasCommonwealth of the Northern Mariana IslandsComorosCongoCongo, The Democratic Republic of theCook IslandsCosta RicaCroatiaCubaCuraçaoCyprusCzech RepublicCôte d'IvoireDemocratic People's Republic of KoreaDemocratic Republic of Sao Tome and PrincipeDemocratic Republic of Timor-LesteDemocratic Socialist Republic of Sri LankaDenmarkDjiboutiDominicaDominican RepublicEastern Republic of UruguayEcuadorEgyptEl SalvadorEquatorial GuineaEritreaEstoniaEthiopiaFalkland Islands (Malvinas)Faroe IslandsFederal Democratic Republic of EthiopiaFederal Democratic Republic of NepalFederal Republic of GermanyFederal Republic of NigeriaFederal Republic of SomaliaFederated States of MicronesiaFederative Republic of BrazilFijiFinlandFranceFrench GuianaFrench PolynesiaFrench RepublicFrench Southern TerritoriesGabonGabonese RepublicGambiaGeorgiaGermanyGhanaGibraltarGrand Duchy of LuxembourgGreeceGreenlandGrenadaGuadeloupeGuamGuatemalaGuernseyGuineaGuinea-BissauGuyanaHaitiHashemite Kingdom of JordanHeard Island and McDonald IslandsHellenic RepublicHoly See (Vatican City State)HondurasHong KongHong Kong Special Administrative Region of ChinaHungaryIcelandIndependent State of Papua New GuineaIndependent State of SamoaIndiaIndonesiaIran, Islamic Republic ofIraqIrelandIslamic Republic of AfghanistanIslamic Republic of IranIslamic Republic of MauritaniaIslamic Republic of PakistanIsle of ManIsraelItalian RepublicItalyJamaicaJapanJerseyJordanKazakhstanKenyaKingdom of BahrainKingdom of BelgiumKingdom of BhutanKingdom of CambodiaKingdom of DenmarkKingdom of LesothoKingdom of MoroccoKingdom of NorwayKingdom of Saudi ArabiaKingdom of SpainKingdom of SwazilandKingdom of SwedenKingdom of ThailandKingdom of TongaKingdom of the NetherlandsKiribatiKorea, Democratic People's Republic ofKorea, Republic ofKuwaitKyrgyz RepublicKyrgyzstanLao People's Democratic RepublicLatviaLebanese RepublicLebanonLesothoLiberiaLibyaLiechtensteinLithuaniaLuxembourgMacaoMacao Special Administrative Region of ChinaMacedonia, Republic ofMadagascarMalawiMalaysiaMaldivesMaliMaltaMarshall IslandsMartiniqueMauritaniaMauritiusMayotteMexicoMicronesia, Federated States ofMoldovaMoldova, Republic ofMonacoMongoliaMontenegroMontserratMoroccoMozambiqueMyanmarNamibiaNauruNepalNetherlandsNew CaledoniaNew ZealandNicaraguaNigerNigeriaNiueNorfolk IslandNorthern Mariana IslandsNorwayOmanPakistanPalauPalestine, State ofPanamaPapua New GuineaParaguayPeople's Democratic Republic of AlgeriaPeople's Republic of BangladeshPeople's Republic of ChinaPeruPhilippinesPitcairnPlurinational State of BoliviaPolandPortugalPortuguese RepublicPrincipality of AndorraPrincipality of LiechtensteinPrincipality of MonacoPuerto RicoQatarRepublic of AlbaniaRepublic of AngolaRepublic of ArmeniaRepublic of AustriaRepublic of AzerbaijanRepublic of BelarusRepublic of BeninRepublic of Bosnia and HerzegovinaRepublic of BotswanaRepublic of BulgariaRepublic of BurundiRepublic of CameroonRepublic of ChadRepublic of ChileRepublic of ColombiaRepublic of Costa RicaRepublic of CroatiaRepublic of CubaRepublic of CyprusRepublic of Côte d'IvoireRepublic of DjiboutiRepublic of EcuadorRepublic of El SalvadorRepublic of Equatorial GuineaRepublic of EstoniaRepublic of FijiRepublic of FinlandRepublic of GhanaRepublic of GuatemalaRepublic of GuineaRepublic of Guinea-BissauRepublic of GuyanaRepublic of HaitiRepublic of HondurasRepublic of IcelandRepublic of IndiaRepublic of IndonesiaRepublic of IraqRepublic of KazakhstanRepublic of KenyaRepublic of KiribatiRepublic of LatviaRepublic of LiberiaRepublic of LithuaniaRepublic of MadagascarRepublic of MalawiRepublic of MaldivesRepublic of MaliRepublic of MaltaRepublic of MauritiusRepublic of MoldovaRepublic of MozambiqueRepublic of MyanmarRepublic of NamibiaRepublic of NauruRepublic of NicaraguaRepublic of PalauRepublic of PanamaRepublic of ParaguayRepublic of PeruRepublic of PolandRepublic of San MarinoRepublic of SenegalRepublic of SerbiaRepublic of SeychellesRepublic of Sierra LeoneRepublic of SingaporeRepublic of SloveniaRepublic of South AfricaRepublic of South SudanRepublic of SurinameRepublic of TajikistanRepublic of Trinidad and TobagoRepublic of TunisiaRepublic of TurkeyRepublic of UgandaRepublic of UzbekistanRepublic of VanuatuRepublic of YemenRepublic of ZambiaRepublic of ZimbabweRepublic of the CongoRepublic of the Marshall IslandsRepublic of the NigerRepublic of the PhilippinesRepublic of the SudanRomaniaRussian FederationRwandaRwandese RepublicRéunionSaint BarthélemySaint Helena, Ascension and Tristan da CunhaSaint Kitts and NevisSaint LuciaSaint Martin (French part)Saint Pierre and MiquelonSaint Vincent and the GrenadinesSamoaSan MarinoSao Tome and PrincipeSaudi ArabiaSenegalSerbiaSeychellesSierra LeoneSingaporeSint Maarten (Dutch part)Slovak RepublicSlovakiaSloveniaSocialist Republic of Viet NamSolomon IslandsSomaliaSouth AfricaSouth Georgia and the South Sandwich IslandsSouth SudanSpainSri LankaState of IsraelState of KuwaitState of QatarSudanSultanate of OmanSurinameSvalbard and Jan MayenSwazilandSwedenSwiss ConfederationSwitzerlandSyrian Arab RepublicTaiwanTaiwan, Province of ChinaTajikistanTanzania, United Republic ofThailandThe Former Yugoslav Republic of MacedoniaTimor-LesteTogoTogolese RepublicTokelauTongaTrinidad and TobagoTunisiaTurkeyTurkmenistanTurks and Caicos IslandsTuvaluUgandaUkraineUnion of the ComorosUnited Arab EmiratesUnited KingdomUnited Kingdom of Great Britain and Northern IrelandUnited Mexican StatesUnited Republic of TanzaniaUnited StatesUnited States Minor Outlying IslandsUnited States of AmericaUruguayUzbekistanVanuatuVenezuelaVenezuela, Bolivarian Republic ofViet NamVirgin Islands of the United StatesVirgin Islands, BritishVirgin Islands, U.S.Wallis and FutunaWestern SaharaYemenZambiaZimbabwethe State of Eritreathe State of PalestineÅland IslandsProject-Id-Version: iso_3166-1
Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues
POT-Creation-Date: 2018-01-17 22:10+0100
PO-Revision-Date: 2018-01-01 15:06+0000
Last-Translator: Chris Leonard <cjlhomeaddress@gmail.com>
Language-Team: Galician <https://hosted.weblate.org/projects/iso-codes/iso-3166-1/gl/>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=n != 1;
X-Generator: Weblate 2.19-dev
AfganistánAlbaniaAlxeriaSamoa AmericanaAndorraAngolaAnguilaAntártidaAntiga e BarbudaRepública Árabe de ExiptoArxentinaRepública ArxentinaArmeniaArubaAustraliaAustriaAcerbaixánBahamasBahreinBangladeshBarbadosBielorrusiaBélxicaBeliceBeninIllas BermudasButánRepública Bolivariana de VenezuelaBoliviaBolivia, Estado Plurinacional daBonaire, San Eustaquio e SabaBosnia e HercegovinaBotsuanaIlla BouvetBrasilTerritorio Británico do Océano ÍndicoIllas Virxes BritánicasBrunei DarussalamBulgariaBurquina FasoBurundiCamboxaCamerúnCanadáIllas CaimánRepública CentroafricanaChadChileChinaIlla ChristmasIllas Cocos (Keeling)ColombiaComunidade de DominicaComunidade das BahamasComunidade das Illas Marianas do NorteComoresCongoCongo, República Democrática doIllas CookCosta RicaCroaciaCubaCuraçaoChipreRepública ChecaCosta de MarfínRepública Democrática Popular de CoreaRepública Democrática de San Tomé e PríncipeRepública Democrática de Timor LesteRepública Socialista Democrática de Sri LankaDinamarcaXibutíDominicaRepública DominicanaRepública Oriental do UruguaiEcuadorExiptoO SalvadorGuinea EcuatorialEritreaEstoniaEtiopíaIllas Falkland (Malvinas)Illas FeroeRepública Democrática Federal de EtiopíaRepública Democrática Federal de NepalRepública Federal de AlemañaRepública Federal de NixeriaRepública Federal de SomaliaEstados Federados de MicronesiaRepública Federativa do BrasilFixiFinlandiaFranciaGüiana FrancesaPolinesia FrancesaRepública FrancesaTerritorios Franceses do SulGabónRepública do GabónGambiaXeorxiaAlemañaGhanaXibraltarGran Ducado de LuxemburgoGreciaGrenlandiaGranadaGuadalupeGuamGuatemalaGuernseyGuineaGuinea-BissauGüianaHaitíReino Hashemita de XordaniaIlla Heard e Illas McDonaldRepública HelénicaSanta Sé (Cidade Estado do Vaticano)HondurasHong KongHong Kong Rexión Administrativa Especial de ChinaHungríaIslandiaEstado Independente de Papúa Nova GuineaEstado Independente de SamoaA IndiaIndonesiaIrán, República Islámica deIraqIrlandaRepública Islámica de AfganistánRepública Islámica de IránRepública Islámica de MauritaniaRepública Islámica de PaquistánIlla de ManIsraelRepública ItalianaItaliaXamaicaXapónJerseyXordaniaKazakhstánQueniaReino de BahreinReino de BélxicaReino de ButánReino de CamboxaReino de DinamarcaReino de LesotoReino de MarrocosReino de NoruegaReino de Arabia SaudíReino de EspañaReino de SuacilandiaReino de SueciaReino de TanzaniaReino de TongaReino dos Países BaixosQuiribatiCorea, República Democrática Popular deCorea, República deKuvaitRepública QuirguízQuirgizistánRepública Democrática Popular de LaoLetoniaRepública LibanesaLíbanoLesotoLiberiaLibiaLiechtensteinLituaniaLuxemburgoMacauMacau Rexión Administrativa Especial de ChinaMacedonia, República deMadagascarMalauiMalasiaMaldivasMaliMaltaIllas MarshallMartinicaMauritaniaMauricioMaioteMéxicoMicronesia, Estados Federados deMoldaviaMoldavia, República deMónacoMongoliaMontenegroMontserratMarrocosMozambiqueBirmaniaNamibiaNauruNepalPaíses BaixosNova CaledoniaNova CelandiaNicaraguaNíxerNixeriaNiueIlla NorfolkIllas Marianas do NorteNoruegaOmánPaquistánPalauPalestina, Estado dePanamáPapúa Nova GuineaParaguaiRepública Democrática Popular de AlxeriaRepública Popular de BangladeshRepública Popular ChinaPerúFilipinasPitcairnEstado Plurinacional da BoliviaPoloniaPortugalRepública PortuguesaPrincipado de AndorraPrincipado de LiechtensteinPrincipado de MónacoPorto RicoQatarRepública de AlbaniaRepública de AngolaRepública de ArmeniaRepública de AustriaRepública de AcerbaixánRepública de BielorrusiaRepública de BeninRepública de Bosnia e HercegovinaRepública de BotsuanaRepública de BulgariaRepública de BurundiRepública de CamerúnRepública do ChadRepública de ChileRepública de ColombiaRepública de Costa RicaRepública de CroaciaRepública de CubaRepública de ChipreRepública da Costa de MarfínRepública de XibutíRepública de EcuadorRepública do SalvadorRepública de Guinea EcuatorialRepública de EstoniaRepública de FidxiRepública de FinlandiaRepública de GhanaRepública de GuatemalaRepública de GuineaRepública de Guinea-BissauRepública da GüianaRepública de HaitíRepública de HondurasRepública de IslandiaRepública da IndiaRepública de IndonesiaRepública de IraqRepública de KazakhstánRepública de QueniaRepública de QuiribatiRepública de LetoniaRepública de LiberiaRepública de LituaniaRepública de MadagascarRepública de MalauiRepública das Illas MaldivasRepública de MaliRepública de MaltaRepública de MauricioRepública de MoldaviaRepública de MozambiqueRepública de BirmaniaRepública de NamibiaRepública de NauruRepública de NicaraguaRepública de PalauRepública de PanamáRepública do ParaguaiRepública de PerúRepública de PoloniaRepública de San MarinoRepública de SenegalRepública de SerbiaRepública das SeichellesRepública de Serra LeoaRepública de SingapurRepública de EsloveniaRepública SurafricanaRepública de Sudán do SurRepública de SurinamRepública de TaxiquistánRepública de Trindade e TobagoRepública de TuniciaRepública de TurquíaRepública de UgandaRepública de UzbequistánRepública de VanuatuRepública do IemenRepública de ZambiaRepública de ZimbabueRepública do CongoRepública das Illas MarshallRepública do NíxerRepública das FilipinasRepública de SudánRomaníaFederación RusaRuandaRepública de RuandaReuniónSan BartoloméSanta Helena, Ascensión e Tristán da CuñaSan Cristobo e NevisSanta LucíaSan Martiño (parte francesa)San Pedro e MiquelonSan Vicente e as GranadinasSamoaSan MarinoSan Tomé e PríncipeArabia SaudíSenegalSerbiaSeichellesSerra LeoaSingapurSan Martiño (parte holandesa)República EslovacaEslovaquiaEsloveniaRepública Socialista de VietnamIllas SalomónSomaliaÁfrica do SurXeorxia do Sul e as Illas Sandwich do SulSudán do SurEspañaSri LankaEstado de IsraelEstado de KuvaitEstado de QatarSudánSultanado de OmánSurinamSvalbard e Jan MayenSuacilandiaSueciaConfederación SuízaSuízaRepública Árabe de SiriaTaiwánTaiwán, Provincia de ChinaTaxiquistánTanzania, República Unida deTailandiaAntiga República Iugoslava de MacedoniaTimor LesteTogoRepública de TogoToquelauTongaTrindade e TobagoTuniciaTurquíaTurkmenistánIllas Turcos e CaicosTuvaluUgandaUcraínaUnión das ComoresEmiratos Árabes UnidosReino UnidoReino Unido da Grande Bretaña e Irlanda do NorteEstados Unidos de MéxicoRepública Unida de TanzaniaEstados Unidos de AméricaIllas Exteriores Menores dos Estados Unidos de AméricaEstados Unidos de AméricaUruguaiUzbequistánVanuatuVenezuelaVenezuela, República Bolivariana deVietnamIllas Virxes dos Estados Unidos de AméricaIllas Virxes BritánicasIllas Virxes, EE.UU.Wallis e FutunaSahara OccidentalIemenZambiaZimbabueEstado de Eritreao Estado de PalestinaIllas ÅlandPK�m�\��@����LC_MESSAGES/grub.monu�[�����r�#�<G_#	_ -_N_i_�_$�_�_6�_``	`%`2`R`e`}`�`.�`.�`%�`$a(a7a<bAcId7cdF�dv�d+Ye�e �e�e!�e�e,f5fMf$bf�f*�f�f�f�f�f
g"g
Bg	MgWg,sg,�g,�g'�g-"h Ph(qh(�h)�h�h
i-i:iCi"Li4oi�i�i7�i�i1�i,jKj%Nj'tj%�j'�j�j�j�jk$k9k>kPk\k|k
�k�k�k�k3�k�k$l%l=lVlelvl�l�l-�l�l!m'm<mXm#mm��m`nZzn�n�nooo)o/o8oOomo�o�o�o�o�o�op
&p4pKpZp_pep%tp�p�p�p�p�pq$q7qHq*`q3�q�q"�q8�q6rHr	er#or�r�r�r�rss)*sTsss�sP�sttH*t&st�t�t!�t,�tuuu	5u!?u*au�u�u�u�u�u$�u"v4vFvav}v�v
�v
�v�v1�v
ww,wEw3aw>�w$�w�wx-xEx`x�x+�x�x�x#�xy5y$Tyyy�y'�y9�yz*zzHz�z�z8�z{
.{9{F{`{��{|+9|e|z|�|"�|�|�|(�|})}5}E}U}l}"~}0�}�}�}�}7�}-~5~A~R~h~t~0{~�~�~�~�~2�~%2Xm*|6�+�
�(��;�!�d.�e��d��i^�oȂH8���������΃����#.�R�p���1��)̄�������/#�S�b�y�5��̅�K�S�o�����������'��P݆.�M�	Y�c�f���'��+�����)�D�[�x�������׈$��#�">�a�c�o�(|�����"��+҉-��,�E�T�e�w�O��׊��
�*�%>�d�)��!��"ϋ��+%�Q�h�x�!����Ȍ�� �%�@�S�q�����4�����/�J�e�~��� ��!Վ��4�MF�2��Ǐ�*��8*�c�p�������3ΐ$�+'�S�
h�v������� ϑ��#�%�D=���7��;�����!<�^�t�s��� �=�N�a�w����������Ô�l�%�8�L�S�_�}���'��
֖����#�'�9�HV�����Ηޗ%��-�#F�j������� Ę� �%�"2�(U�~�%����2ڙ
��#/�*S�~�����#������	Ӛ	ݚ"�;
�#F�<j�
����
ӛ.�	��`,���!��)Ĝ�����q
��������Н����-�"L�o�������О����#(�L�i�g����r���-��נ!�
�"�'A�Qi���ס�
��)�F�c�������բ
� ���1� D�e�������-ţ�
�"!�bD�)��Ѥ���,�G�`�	e�"o�%������ҥ٥&�)	�3�^F���$��%��
�^��_�}|����)��'۩>�DB�!��'��-Ѫ#��#�)C�m�)��)��,ޫ�+�D�_�z�E��$ѬA��)8�b������ խ��q�}�:��ծ��"�?�V�l���0��ί��)�&A�h�������)ϰ��%	�%/�,U�'��:���-�2�.B�q���'��$��"���
1�*?�j�r�)y�o����,�6���0&� W�!x�"��#�����'�!F�h�
~���<��%�>�E�N�R�X�x���d��*	�04�6e���
����Ǹ۸�0��,�!?�a��$����ι���"1�$T�y��� ��úغ�����6�N�'k�����+̻"���)"�L�^�|�����'ż��)�<=� z�������mѽ?�Z�t�����+��3�1!�
S�'a�-����'��'�.�	?�I�e�~�������	�$�>�Y�*^�?��B�p��}�/�8�M�.c�O��)���"�	1�;�5Y�����������:�?�R�i�o�����������������	����+�@�V�p�w�
~�
��
��	����!��)�����$�D�Fa�N��
��"�(�-�-?�-m�$��#��0��6�
L�Z�
m�({�1��)����!&�H� \�}�%����&����� .�7O�.��4������8�M�%m�������������$�,A�n�}���������#���"�B<�����������&�C�
`�n�w���&������	��;-�Vi�"��&��!
�,�C�H�/f�H��F��w&�N��(���2�I>�$��'����%����.�B�$T�'y�*��������J
�X�t���-��+����$�(�"1�+T�J��%���� 	�"*�M� `�������������
�%%�K�j���%��������	��[%���!������������&�>�T�h�~������������(�E�U�k�1����������
��#�
��1��%�0C�t���!��������
� �1�C�X�d�s�����������&��� �8�R�p�'��&����L��.�L�!`���������������-�
<�#J�#n�$������&�����"�7�<�K�	a�7k���%��[��w?�7��K��#;�/_�������&��U
�@c�Q�����%�+:�f�R��L��.#�R�i�Fn��������� �,�A�[�2v�!��#������,�J�d�������(��#�&�?�S�r�)������'��'
�'2�Z�0y�����-��8�J�b�!y� ������.���!4�BV�E��B��"�%A�/g���.����1��*-�7X�����	����#�����+�
I�2W�1��.������N��KM�L���<�HB�{��1�9�#H�l�%}���.��:�'�(;�d�3��������"�	A�	K�!U�0w�/��0�,	�16�#h�-��-��.�#�%;�
a�l�u�.~�4����>��;�>R�����.��2�.�1D�v�{�)}���������-�9�K�
^�i�y�4����,���$7Ro�,�!�6�++,W%�$���kqW�#5"Y|~����!���#%Bh����)�"'+*=&h�#�%��
!<$V@{J�+.3Ub�!��*�'!Ib6���6�(	$D	.i	c�	�	
E:
/�
�
�
'�
?�
?S\	xE�7�"#AUs8���*�.!
*P
){
�

�
�
5�
%%5[>{E�34"Ps&�(��,�*$Hm�+�%�&�*6HK��|��H�#�

"&B�i'+:S���0�&?F������'�5!W`s=�����+33g��\�.L[8tA�6�+&Rr"����*���7��[P���$�9Yp,�#���89N����.�� � 89 $r +� V� 0!+K!+w!�!�!�!
�!+�!I�!&3"	Z"
d"o"$r"�"8�"<�"!# 4#:U#!�#%�##�#�#$6$V$-r$�$�$3�$%%&%1,%^%b%7h%-�%7�%&&7&S&n&v�&&�&&'#F'j''0�'&�'D�'+6(*b(�(!�(A�()+)G)*a)$�)�)
�)�))�)#*A*$\*!�*�*�*A�*2+A+X+!s+"�+ �+ �+&�+&!,$H,"m,I�,i�,@D-(�-/�-)�-J.S.#b.�.�.�.?�../>K/�/�/�/�/�/0$!0!F0h0|0+~0_�0
1P1Qc1-�1%�1(	2220L2�}23"23U3i3�3"�3*�3�344�4��4�5�56
6(696Y6Jw6
�6�6 �677$7,7@7l`7�7!�78!8B58x8(�8<�8 �869P9f9)�9#�9=�9*:(9:,b:�:,�:)�:6;	;;"E;-h;2�;�;�;�;*�;<<+<
=<0H<Vy<1�<W=Z=%k=�=9�=
�=�=�>�>%�>*�>????�?�?�?�?�?@+@F@+a@&�@2�@!�@ 	A*AGA_A~A�A�A&�A&�A&B�FB��B �C*�C1�CD(;DdD7�D5�Di�D.ZE �E�E�E�E!�EF!2FTF sF�F�F�F1�FG$G ?G(`G�G�G"�GF�G""HEH'^Hz�H?I(AIjI�I8�I$�IJ	J&J'8J`JhJ|J�J)�J5�J�Js�J$rK5�K9�K�LwMw}M��M�yN4LO1�OP�O\P'aP-�P6�P6�P1%Q>WQ!�Q,�Q3�Q8R2RR'�R,�R$�R �Ra S/�S`�SBT&VT&}T(�T+�T2�T,U�IU/�UPV.cV�V-�V"�V�VW"8W[W8xW&�W�W�W1X7BXzX�X�X(�X.�X&Y'7Y'_Y.�Y)�YE�Y%&Z=LZ�Z9�Z�Z�Z@[2V[.�[�[$�[�[/\2\;\0C\�t\]�0]K^T^V^;^^$�^)�^,�^,_$C_h_+�_$�_1�_!`
-`8`6V`0�`H�`a
aa*aBaaau�a7�a4/b;db�b�b�b�b�b)�b?c[c'yc(�c�c7�c&d>d&Yd�d)�d'�d)�d*eBe-_e�e �e �e �ef#&f$Jf)of1�f/�f�f5g*Pg
{g1�g�g6�g-h>h,wh-�h'�h�h;i!Linivi�in�i&jBj(^j%�j�j3�jQkLSk�k+�kB�kl,&l5Sl1�l	�l�l�l&�l#%m&Im#pm%�m"�m�m�mn+nEEnT�n��n�bo/p4pMp2lp]�p6�p4q
Sq
aq"oqA�q�q!�qr&rErFer�r"�r�r�r	ss s2sPsgs~s
�s
�s�s"�s�s�st%t,t3t@t
Pt[tpt!}t(�t�t�t �tud:uI�u�u*�u$v-v+Fv)rv'�v �v2�v:wSwdw
|w*�w3�w5�wx&<x1cx�x3�x$�x+y3y4Qy.�y2�y,�yLzDbz@�z1�z{(7{`{.�{)�{�{�{|&3|Z|z|�|=�|@�|}1}$I}n}�}�}3�}#�}"~`)~*�~0�~�~%!*&L=s*�����+2�^�'{�����C׀l�.��8��3�$�@�0F�Hw�T��j����\�2l�#��
ÄO΄7�&V�}�+��ąʅ��-!�2O�:��'�����T�o�"����<Ƈ2�6�3<�p�)}�:��O�.2�a�1�3���(�#+�'O�%w�����&݊*�0/� `�����4�����&�;�C��b��"�"(�K�g�)l���"��"ʍ �%�'4�"\�)���1���#�5�(O�x�#��%��>ُ�+�K�f������`�=l�'��Fґ�2�.P�!�����ے��+�
C�Q�e�z�������ړ+��$�B�#^�)����%Ŕ0�
�U*�����(��'� 
�".�Q�n�(��)��ޖ(��%�BB�B��Dȗ
�*�DE�������ݘ'�
�-�66�m�%��\����D��Xښ)3�?]���'��(�*�t7�R��r��r�!��&��:؝=�]Q�d��9�N�k�ap�#ҟ��"�!7�3Y�'��#��$٠D��*C�*n���"��ԡ%�"�%4�!Z�%|�'��6ʢ/�1�G�#b���;��+ڣ,�<3�:p�>��)�=�#R�'v�F��B�%(�N�'i�,��"���E��<�!\�_~�SާU2����x�h�Y��TV_}����1aJI]�2�-5�A����!���P�EsP��^(_R@��H�	-������o�����zMJ'.>�mm6:{;,���Zr�K���DR
K5�Kx9pM�
n������34��5h�(W&.�9��d��[fq R�B-���7L3�oY��*�z��_��e�eir
AL9�%�>�4mp��0w�Nl)\><.t�wt�R-b��Y1�?�U�z�j���jFNV�#O)1�p�����3�:"`@J|" �(/�8Z,��OQ!ig�N�l���\+�������J�V�8sZ�~*��viO=�[���t�C^��6��������kg}+HjHO^	��iZ�\��'!����������
*��A����l�P�{�7^��5�+a��0�'�
���&����u��*W��FM��!�I'����]<	�&�/��G]���r@���o����%�)[�B(�������8|d��6X��h<���Z)[���=�c8eL)��1�:u��C=�B4��Tv�A2�4�~Aa~��0���G��8{>���M02���]���.W�����|��6J':��?VLN�f���an�`a��f��`}�;�H��=����&���e�U��ckq�o�
��f��^3?rQF�f���L+$�Y���~��n`O.�#�yI��2��2y�R�p�";����X���d���]���@�e��T�������4-g �;Ft���	����I��T��c��GE����|k�!	E���bI_%�h�k��o��}U��KHd������,��l��X�m��D���m��*7�=���U r���M�:"�3g6���q��7x�
����9Cq�C��,9����$k�Gx�U��yvS�XS��1�Q�D�W?���hl�����/�c�����Q���n�n��<0#bzBF�����Q���C�b�[\DS��$�N���WX��?�/���q�w�G�j�,�;`7wKu#��E��V�
�����B�si��@E/����<�y��&T�PD
�������p\5�b>�����#�s�%S _��$SP������${�%c(�jv+d��u����g"Y�
��              total memory: %d KiB
    No preferred mode available
    Preferred mode: %ux%u
  EDID checksum invalid  EDID version: %u.%u
  Failed to initialize video adapter  No info available  VBE info:   version: %d.%d  OEM software rev: %d.%d
  or:  (leftmost) (medial) (rightmost) - Partition start at %llu%sKiB - Sector size %uB - Total size %llu%sKiB - Total size unknown [OPTION...]%.*s: ARGP_HELP_FMT parameter must be positive%.*s: ARGP_HELP_FMT parameter requires a value%.*s: Unknown ARGP_HELP_FMT parameter%ds%ds remaining.%s appears to contain a %s filesystem which isn't known to reserve space for DOS-style boot.  Installing GRUB there could result in FILESYSTEM DESTRUCTION if valuable data is overwritten by grub-setup (--skip-fs-probe disables this check, use at your own risk)%s appears to contain a %s partition map and LDM which isn't known to be a safe combination.  Installing GRUB there could result in FILESYSTEM DESTRUCTION if valuable data is overwritten by grub-setup (--skip-fs-probe disables this check, use at your own risk)%s appears to contain a %s partition map which isn't known to reserve space for DOS-style boot.  Installing GRUB there could result in FILESYSTEM DESTRUCTION if valuable data is overwritten by grub-setup (--skip-fs-probe disables this check, use at your own risk)%s does not support UUIDs%s generates a keyboard layout for GRUB using ckbcomp\n%s is deprecated. Use set gfxpayload=%s before linux command instead.
%s is deprecated. VGA mode %d isn't recognized. Use set gfxpayload=WIDTHxHEIGHT[xDEPTH] before linux command instead.
%s is not yet supported by grub-mkconfig.\n%s, with Hurd %s%s, with Hurd %s (recovery mode)%s, with Linux %s%s, with Linux %s (recovery mode)%s, with Xen %s and Linux %s%s, with Xen %s and Linux %s (recovery mode)%s, with Xen hypervisor%s, with kFreeBSD %s%s, with kFreeBSD %s (recovery mode)%s, with kernel %s (via %s)%s, with kernel %s (via %s, recovery mode)%s: HASH MISMATCH
%s: Not found.\n%s: OK
%s: READ ERROR
%s: Too many arguments
%s: You must run this as root\n%s: error:%s: info:%s: invalid option -- '%c'
%s: option '%c%s' doesn't allow an argument
%s: option '%s' is ambiguous; possibilities:%s: option '--%s' doesn't allow an argument
%s: option '--%s' requires an argument
%s: option '-W %s' doesn't allow an argument
%s: option '-W %s' is ambiguous
%s: option '-W %s' requires an argument
%s: option requires an argument -- '%c'
%s: option requires an argument -- `%s'\n%s: unrecognized option '%c%s'
%s: unrecognized option '--%s'
%s: warning:(32-bit)(64-bit)(PROGRAM ERROR) No version known!?(PROGRAM ERROR) Option should have been recognized!?(on %s)- Label `%s'- Last modification time %d-%02d-%02d %02d:%02d:%02d %s--MORE---h HASH [-c FILE [-p PREFIX]] [FILE1 [FILE2 ...]]-l | -r | [-s] grubdev osdisk..516-bit protected interface supported
16-bit protected interface unsupported
32-bit protected interface supported
32-bit protected interface unsupported
=VAL>ACPI non-volatile storage RAMACPI reclaimable RAMACPI shutdown failedADDRADDR VALUE [MASK]ADDR [SIZE]ADDR1,MASK1[,ADDR2,MASK2[,...]]ADDRESS DNSSERVERAPM disabled
APM disengaged
APM enabled
APM engaged
ARGP_HELP_FMT: %s value is less than or equal to %sASCIIAccept DOS-style CR/NL line endings.Active input terminals:Active output terminals:Adapter `%s':
Add a DNS serverAdd a network address.Add a network route.Advanced options for %sAdvanced options for %s (with Xen hypervisor)Allow to interrupt with ESC.Ask for file name to reboot from.Assume input is hex.Assume input is passphrase.Assume input is raw.Attempting to decrypt master key...Attempting to install GRUB to a disk with multiple partition labels or both partition label and filesystem.  This is not supported yet.Attempting to install GRUB to a disk with multiple partition labels.  This is not supported yet.Attempting to install GRUB to a partitionless disk or to a partition.  This is a BAD idea.Available input terminals:Available output terminals:BB/sBIOS_DUMP [INT10_DUMP]BLOCKBYTE:BITBackground image mode.Base directory for hash list.Boot BIOS-based system.Boot an operating system.Boot into single mode.Boot with debug messages.Boot with verbose messages.Booting `%s'Booting a command listBooting in blind modeBootpath: %s
Bootpath: unavailable
Break into GDBCGA COLORCOMMAND [ARGS]CPU Idle doesn't slow down processor
CPU Idle slows down processor
CS5536 at %d:%d.%d
Can't enable ROM area.Change configured devices.Change partition typeCheck Alt key.Check Control key.Check Shift key.Check for CPU features.Check hashes of files with hash list FILE.Check if CPU supports 64-bit (long) mode (default).Check key modifier status.Check whether user is in USERLIST.Checks GRUB script configuration file for syntax errors.Clear the screen.Cleared active flag on %d. 
Commands:Compare FILE with local file LOCAL.Compare file `%s' with `%s':
Compare two files.Compute XNU UUID of the device.Compute or check hash checksum.Configure serial port.Continue loopsConvert common font file formats into PF2Copy FILE to local file LOCAL.Copy FILE to standard output.Could not locate FPSWA driverCouldn't find physical volume `%s'. Some modules may be missing from core image.Couldn't load sha256Couldn't load sha512Create BIOS-like structures for backward compatibility with existing OS.Create a blank environment block file.Current terminfo types:DEVICEDEVICE [PARTITION[+/-[TYPE]]] ...DEVICE must be an OS device (e.g. /dev/sda).DEVICE_NAMEDIRDIRECTORY [OSBundleRequired]DNSSERVERDebug tool for filesystem driver.Declare memory regions as faulty (badram).Decompressor is too bigDefine a menu entry.Define a submenu.Delete a network address.Delete a network route.Delete the specified loopback drive.Delete variables.Determine driver.Determine filesystem UUID.Determine filesystem label.Determine filesystem type.Determine partition map type.Device %s:Devid: %s
Devid: unavailableDirect color, mask: %d/%d/%d/%d  pos: %d/%d/%d/%dDisable ACPI.Disable SMP.Disable all boot output.Disable/enable SMART (0/1).Discarding improperly nested partition (%s,%s,%s%d)Disk cache statistics: hits = %lu (%lu.%02lu%%), misses = %lu
Disk count must precede disks list.
Display FPSWA version.Display SMART health status.Display a line of text.Display blocklist of FILE.Display output on all consoles.Display power mode.Display the usage of this command and exit.Display this help and exit.Display/set current datetime.Do not output the trailing newline.Do not print messages.Do not probe any floppy drive.Do not use APM to halt the computer.Do nothing, successfully.Do nothing, unsuccessfully.Don't display boot diagnostic messages.Don't load host tables specified by comma-separated list.Don't reboot, just halt.Don't stop after first error.Don't update EBDA. May fix failures or hangs on some BIOSes but makes it ineffective with OS not receiving RSDP from GRUB.ENVVARENVVAR [ENVVAR] ...ERROR: no valid keyboard layout found. Check the input.
ESC at any time exits.EXPRESSIONEXPRESSION ]Elapsed time: %d.%03d s 
Elapsed time: %d.%03d seconds 
Embedding is not possible.  GRUB can only be installed in this setup by using blocklists.  However, blocklists are UNRELIABLE and their use is discouraged.Emulate a keystroke sequenceEnable interpretation of backslash escapes.Enter ZFS password: Enter in KDB on boot.Enter normal mode.Enter passphrase for %s%s%s (%s): Enter password: Enter username: Error in parsing command line arguments
Evaluate an expression.Exit failedExit from GRUB.Exit from loopsExit from normal mode.Export variables.Export version 1 tables to the OS.Export version 2 and version 3 tables to the OS.FILEFILE [ARG ...]FILE [ARGS...]FILE | TEMPO [PITCH1 DURATION1] [PITCH2 DURATION2] ... FILE...FILE1 FILE2FILENAME COMMANDFILESYSTEM [VARIABLE]FILE|promptFORMATFPSWA protocol wasn't able to find the interfaceFPSWA revision: %x
FROM-TO[,FROM-TO]FROM[K|M|G] TO[K|M|G]FT_Init_FreeType failsFailed to boot both default and fallback entries.
Failed to create `device-mapper' treeFalling back to `%s'File size: %s
File system `%s' doesn't support embeddingFiles differ at the offset %llu: 0x%x [%s], 0x%x [%s]
Files differ in size: %llu [%s], %llu [%s]
Filesystem cannot be accessedFilesystem type %sFill hybrid MBR of GPT drive DEVICE. Specified partitions will be a part of hybrid MBR. Up to 3 partitions are allowed. TYPE is an MBR type. + means that partition is active. Only one partition can be active.Finalize loading of EFI emulator.First try the device HINT if currently running on ARC. If HINT ends in comma, also try subpartitionsFirst try the device HINT if currently running on BIOS. If HINT ends in comma, also try subpartitionsFirst try the device HINT if currently running on EFI. If HINT ends in comma, also try subpartitionsFirst try the device HINT if currently running on IEEE1275. If HINT ends in comma, also try subpartitionsFirst try the device HINT if direct hardware access is supported. If HINT ends in comma, also try subpartitionsFirst try the device HINT. If HINT ends in comma, also try subpartitionsFix video problem.Found %s on %s (%s)\nFound %s on %s\nFound GNU Mach: %sFound Hurd module: %sFound NetBSD kernel: %s\nFound background: %s\nFound initrd image: %s\nFound kernel module directory: %s\nFound kernel of FreeBSD: %s\nFound linux image: %s\nFound theme: %s\nFreetype Error %d loading glyph 0x%x for U+0x%x%sFreeze ATA security settings until reset.FridayGGNU GRUB  version %sGRUB Boot MenuGRUB doesn't know how to halt this machine yet!GRUB emulator.GRUBDEVICE=PLAN9DEVICEGarbage in ARGP_HELP_FMT: %sGenerate GRUB keyboard layout from Linux console one.Generate PBKDF2 password hash.Generate a grub config fileGenerate a standalone image (containing all modules) in the selected formatGet crc32 checksum of FILE.Get disk cache info.Get/set ATA disk parameters.GiBGiB/sHASHHINTHalt the system, if possible using APM.Halts the computer.  This command does not work on all firmware implementations.Handle N bytes in output file.Hello WorldHercules IDIMAGE1 [IMAGE2 ...] MOUNTPOINTIMAGE_PATH COMMANDSImport ZFS wrapping key stored in FILE.Incorrect virtual device: no type availableInsert a module.Install GRUB on your drive.Installation finished. No error reported.Invalid back referenceInvalid character class nameInvalid collation characterInvalid command %s.
Invalid content of \{\}Invalid device `%s'.
Invalid disk count.
Invalid preceding regular expressionInvalid range endInvalid regular expressionInvoke user configuration routing.KKERNEL ARGSKEYBOARD_KEYKeyboard key to quickly boot this entry.KiBKiB/sLeaf virtual device (file or disk)Legacy `ask' parameter no longer supported.Legend: mask/position=red/green/blue/reservedLength of generated hashLength of saltList DNS serversList PCI devices.List all files.List available video modes. If resolution is given show only modes matching it.List coreboot tables.List devices and files.List devices or files.List devices.List files in PATH.List memory map provided by firmware.List of supported video modes:List of users allowed to boot this entry.List or select an input terminal.List or select an output terminal.List the current variables.List the loaded fonts.List variables from environment block file.Load 64-bit XNU image.Load BIOS dump.Load FreeBSD env.Load FreeBSD kernel module (ELF).Load FreeBSD kernel module.Load FreeDOS kernel.sys.Load Linux.Load NTLDR or BootMGR.Load NetBSD kernel module (ELF).Load NetBSD kernel module.Load Plan9 kernel.Load XNU extension directory.Load XNU extension package.Load XNU extension.Load XNU image.Load XNU ramdisk. It will be available in OS as md0.Load `device-properties' dump.Load a PXE image.Load a keyboard layout.Load a multiboot 2 kernel.Load a multiboot 2 module.Load a multiboot kernel.Load a multiboot module.Load a splash image for XNU.Load an image of hibernated XNU.Load and initialize EFI emulator.Load another boot loader.Load another config file but take only menu entries.Load another config file without changing context but take only menu entries.Load another config file without changing context.Load another config file.Load another coreboot payloadLoad background image for active terminal.Load host ACPI tables and tables specified by arguments.Load initrd.Load kOpenBSD ramdisk.Load kernel of FreeBSD.Load kernel of NetBSD.Load kernel of OpenBSD.Load only tables specified by comma-separated list.Load the same file in multiple ways.Load variables from environment block file.Load zfs crypto key.Loaded fonts:Loading GNU Mach ...Loading Linux %s ...Loading Xen %s ...Loading initial ramdisk ...Loading kernel of FreeBSD %s ...Loading kernel of Illumos ...Loading the Hurd ...MMAC verification failedMENU_ENTRY is a number, a menu item title or a menu item identifier.MODULEMail xorriso support requests to <bug-xorriso@gnu.org>.Make GRUB CD-ROM, disk, pendrive and floppy bootable image.Make GRUB keyboard layout file.Make a bootable image of GRUB.Make a virtual drive from a file.Make partition activeManage the BIOS drive mappings.Mandatory or optional arguments to long options are also mandatory or optional for any corresponding short options.Manipulate PCI devices.Measure time used by COMMANDMemory exhaustedMemory type: DDR2.Memory type: Unknown.Menu entry identifier.Menu entry not specified.Menu entry type.MiBMiB/sMinimal BASH-like line editing is supported. For the first word, TAB lists possible command completions. Anywhere else TAB lists possible device or file completions. %sMinimum Emacs-like screen editing is supported. TAB lists completions. Press Ctrl-x or F10 to boot, Ctrl-c or F2 for a command-line or ESC to discard edits and return to the GRUB menu.Missing arguments
Missing input file
MondayMonochrome More than one install device?More than one menu entry?Mount a crypto device.Mount all volumes with `boot' flag set.Mount all.Mount by UUID.Mount crypto devices.NAMENAME [VARIABLE] [HINTS]NUMNUMBER_OF_SECONDSName	Ref Count	Dependencies
Native disk drivers are in use. Refusing to use firmware disk interface.Network protocols:New MBR is written to `%s'
No CS5536 foundNo FPSWA foundNo boot time statistics is available
No command is specified.
No device is specified.
No disk cache statistics available
No drives have been remappedNo known filesystem detectedNo matchNo path is specified.
No path or device is specified.
No previous regular expressionNo virtual device tree availableNon-chain 4 Not enough parameters to command.
Now connect the remote debugger, please.Number of PBKDF2 iterationsOS disk #num ------> GRUB/BIOS deviceOS file %s open error: %sOption -- switches to native xorriso command mode.Options:Out of range lookup: %d
Out of range substitution (%d, %d)
Override guessed mapping of Plan9 devices.PPARTITION COMMANDSPATHPBKDF2 hash of your password is %s
PORTPORT VALUE [MASK]PUBKEY_IDPaletted Parse legacy config in new contextParse legacy config in new context taking only menu entriesParse legacy config in same contextParse legacy config in same context taking only menu entriesPart no: %s.
Partition %d is active now. 
Partition %s:Partition style `%s' doesn't support embeddingPath: %s
Path: unavailablePerform COMMANDS on partition.
Use `parttool PARTITION help' for the list of available commands.Perform a DNS lookupPerform an IPV6 autoconfigurationPerform both direct and reverse mappings.PiBPiB/sPlanar Play a tune.Please don't use old title `%s' for GRUB_DEFAULT, use `%s' (for versions before 2.00) or `%s' (for 2.00 or later)Pool GUID: %016llx
Pool GUID: unavailablePool name: %s
Pool name: unavailablePool state: activePool state: destroyedPool state: exportedPool state: level 2 ARC devicePool state: potentially activePool state: reserved for hot sparePool state: unavailablePool state: uninitializedPossible arguments are:Possible commands are:Possible devices are:Possible files are:Possible partitions are:Possible things are:Premature end of regular expressionPress any key to continue...Press any key to launch xnuPress enter to boot the selected OS, `e' to edit the commands before booting or `c' for a command-line.Press enter to boot the selected OS, `e' to edit the commands before booting or `c' for a command-line. ESC to return previous menu.Print Memory information.Print ZFS info about DEVICE.Print ZFS-BOOTFSOBJ or store it into VARIABLEPrint a block list.Print and execute block argument.Print backtrace.Print drive identity and settings.Print sizes in a human readable format.Probe device information for a given path (or device, if the -d option is given).RAM holding coreboot tablesRAM holding firmware codeRAM slot number %d
REGEXP STRINGROM image is present.Read 16-bit value from ADDR.Read 16-bit value from PORT.Read 32-bit value from ADDR.Read 32-bit value from PORT.Read 8-bit value from ADDR.Read 8-bit value from PORT.Read only LENGTH bytes.Reboot failedReboot into firmware setup menu.Reboot the computer.Reenter password: Register %x of %x:%02x.%x is %x
Regular expression too bigRemove a DNS serverRemove a module.Remove an environment variable.Remove any memory regions in specified range.Render Apple .disk_label.Report bugs to %s.
Report bugs to <bug-grub@gnu.org>.Requested serial terminal but GRUB_SERIAL_COMMAND is unspecified. Default parameters will be used.Reset all mappings to the default values.Retrieve device info.Return from a function.Return to IEEE1275 prompt.Run `gdb %s %d', and set ARGS.HOLD to zero.
Run `go' to resume GRUB.SECSSHORTNAMESHORTNAME CARD ADDRESS [HWADDRESS]SHORTNAME NET [INTERFACE| gw GATEWAY]SIZESOURCE|-u UUID|-a|-bSTRINGSaturdaySave read value into variable VARNAME.Save variables to environment block file.Say `Hello World'.Search devices by UUID. If VARIABLE is specified, the first device found is set to a variable.Search devices by a file.Search devices by a filesystem UUID.Search devices by a filesystem label.Search devices by file, filesystem label or filesystem UUID. If --set is specified, the first device found is set to a variable. If no variable name is specified, `root' is used.Search devices by file. If VARIABLE is specified, the first device found is set to a variable.Search devices by label. If VARIABLE is specified, the first device found is set to a variable.Sector %llu is already in use by raid controller `%s'; avoiding it.  Please ask the manufacturer not to store data in MBR gapSector %llu is already in use by the program `%s'; avoiding it.  This software may cause boot or other problems in future.  Please ask its authors not to store data in the boot trackSelect device by its position on the bus.Select device by vendor and device IDs.Set Advanced Power Management
(1=low, ..., 254=high, 255=off).Set Automatic Acoustic Management
(0=off, 128=quiet, ..., 254=fast).Set OEMID of RSDP, XSDT and RSDT.Set OEMTABLE ID of RSDP, XSDT and RSDT.Set OEMTABLE revision of RSDP, XSDT and RSDT.Set `hidden' flag in partition typeSet a variable to return value.Set a variable to the first device found.Set an environment variable.Set background color for active terminal.Set creator field of RSDP, XSDT and RSDT.Set creator revision of RSDP, XSDT and RSDT.Set debug environment variable.Set drive to sleep mode.Set drive to standby mode.Set positional parameters.Set root device.Set standby timeout
(0=off, 1=5s, 2=10s, ..., 240=20m, 241=30m, ...).Set terminfo type of TERM  to TYPE.
Set the default boot menu entry for GRUB, for the next boot only.Set the default boot menu entry for GRUB.Set the serial port address.Set the serial port parity.Set the serial port speed.Set the serial port stop bits.Set the serial port word length.Set the serial unit.Set up images to boot from DEVICE.

You should not normally run this program directly.  Use grub-install instead.Set user password (PBKDF2). Set user password (plaintext). Unrecommended and insecure.Set variable with user input.Set variables.Setting partition type to 0x%x
Shift positional parameters.Show ACPI information.Show APM information.Show CBMEM console content.Show a help message.Show a long list with more detailed information.Show contents of FILE in hex.Show loaded modules.Show memory contents.Show raw contents of ATA IDENTIFY sector.Show raw contents of a file or memory.Show the contents of a file.Show the current mappings.Show this message.Show version 1 tables only.Show version 2 and version 3 tables only.Shutdown failedSimulate grub-legacy `initrd' commandSimulate grub-legacy `kernel' commandSimulate grub-legacy `modulenounzip' commandSimulate grub-legacy `password' commandSimulate grub-legacy `password' command in menu entry modeSkip N bytes from output file.Skip offset bytes from the beginning of file.Slot %d opened
Some Hurd stuff found, but not enough to boot.Specify filename.Specify hash to use.Specify one or more font files to load.Specify size for each read operationSpecify the number of input files.Speed: %s 
Start GDB stub on given portStop GDB stubStore matched component NUMBER in VARNAME.SuccessSundaySuppress normal output (warnings remain).Switch to native disk drivers. If no modules are specified default set (pata,ahci,usbms,ohci,uhci,ehci) is usedSyntax error at line %u
Syntax errors are detected in generated GRUB config file.
Ensure that there are no errors in /etc/default/grub
and /etc/grub.d/* files or please file a bug report with
%s file attached.System management bus controller I/O space is at 0x%x
TTARGETTarget format not specified (use the -O option).Terminal has specified geometry.Terminal is ASCII-only [default].Terminal is logical-ordered UTF-8.Terminal is visually-ordered UTF-8.Test USB support.Test bit at BYTE:BIT in CMOS.Test file read speed.Test if REGEXP matches STRING.Test video subsystem in mode WxH.Test video subsystem.Text-only The files are identical.
The highlighted entry will be executed automatically in %ds.This entry can be booted by any user.This requires setting GRUB_DEFAULT=saved in %s/default/grub.\nThursdayTiBTiB/sTool to edit environment block.Total flash size: %d B.
Trailing backslashTransform 64-bit UUID to format suitable for XNU. If -l is given keep it lowercase as done by blkid.Transform a system filename into GRUB one.Translates the string with the current settings.Try '%s --help' or '%s --usage' for more information.
TuesdayUSER PASSWORDUSER PBKDF2_PASSWORDUSERNAME[,USERNAME]UTF-8Unable to create pipe: %sUnable to determine your platform. Use --target.Unable to fork: %sUnable to open stream from %s: %sUnable to retrieve pool stateUncompress data.Uncompress file before checksumming.Unknown address type %d
Unknown command `%s'.
Unknown compression format %sUnknown encodingUnknown extra argument `%s'.Unknown keyboard scan code 0x%02x
Unknown keyboard scan identifier %s
Unknown system errorUnknown video mode Unknown virtual device type: %s
Unload EFI emulator.Unmatched ( or \(Unmatched ) or \)Unmatched [ or [^Unmatched \{Unrecognized option `%s'\nUnrecognized pool stateUnsupported address type %d
Unsupported coverage specification: %d
Unsupported hw address type %d
Unsupported image formatUnsupported substitution specification: %d
Unsupported substitution type: %d
Usage:Usage: %s -o OUTPUT CKBMAP_ARGUMENTS...\nUsage: %s DEVICE
Usage: %s [INFILE [OUTFILE]]
Usage: %s [OPTION] MENU_ENTRY\nUsage: %s [OPTION]\nUse CD-ROM as root.Use GDB remote debugger instead of DDB.Use STRING as menu entry body.Use compiled-in root device.Use serial console.Use the %C and %C keys to select which entry is highlighted.VAR INTERFACE NUMBER DESCRIPTIONVARNAMEVerbose countdown.Verify detached signature.Version %u.%u
32-bit CS = 0x%x, len = 0x%x, offset = 0x%x
16-bit CS = 0x%x, len = 0x%x
DS = 0x%x, len = 0x%x
Virtual device is degradedVirtual device is faultedVirtual device is offlineVirtual device is onlineVirtual device is removedWARNING: no console will be available to OSWARNING: no platform-specific install was performedWARNING: unsupported font feature parameters: %x
WIDTHxHEIGHT.Wait for a specified number of seconds.Wait for keypress after every line of output.Warning:Warning: invalid background color `%s'
Warning: invalid foreground color `%s'
Warning: syntax error (missing slash) in `%s'
WednesdayWindows NT/2000/XP (loader)Windows Vista/7 (loader)Write 16-bit VALUE to ADDR.Write 16-bit VALUE to PORT.Write 32-bit VALUE to ADDR.Write 32-bit VALUE to PORT.Write 8-bit VALUE to ADDR.Write 8-bit VALUE to PORT.Written SPD bytes: %d B.
Xen hypervisor, version %sYUV You need to specify at least one command.
You will have to set `SystemPartition' and `OSLoader' manually.Your embedding area is unusually small.  core.img won't fit in it.Your xorriso doesn't support `--grub2-boot-info'. Some features are disabled. Please use xorriso 1.2.9 or later.Your xorriso doesn't support `--grub2-boot-info'. Your core image is too big. Boot as disk is disabled. Please use xorriso 1.2.9 or later.[--append|--remove] [TERMINAL1] [TERMINAL2] ...[--force|--bpb] FILE[--md5] PASSWD [FILE][--no-mem-option] [--type=TYPE] FILE [ARG ...][-1|-2] [--exclude=TABLE1,TABLE2|--load-only=TABLE1,TABLE2] FILE1 [FILE2] [...][-c FILE [-p PREFIX]] [FILE1 [FILE2 ...]][-d] DEVICENAME FILE.[-e|-n] STRING[-f FILE][-f FILE] variable_name [...][-f|-l|-u|-s|-n] [--hint HINT [--hint HINT] ...] NAME[-h|-p|-r] [FILE][-l] GRUBUUID [VARNAME][-l|-h|-a] [FILE ...][-m (stretch|normal)] FILE[-s POSITION] [-d DEVICE][-s POSITION] [-d DEVICE] [-v VAR] REGISTER[=VALUE[:MASK]][-s SIZE] FILENAME[ADDR|comUNIT][,SPEED][ARG][CARD [HWADDRESS]][CARD][ENVVAR=VALUE][ENVVAR][KEYSTROKE1] [KEYSTROKE2] ...[MODULE1 MODULE2 ...][NUMBER:]VARNAME[NUM][OPTIONS...][OPTIONS][OPTIONS] DISK[OPTIONS] FILE_OR_DEVICE[OPTIONS] FONT_FILES[OPTION]... [MODULES][OPTION]... [PATH|DEVICE][OPTS][PATH][PATTERN ...][USERLIST][VALUE]...[WxH[xD]][WxH][[-a|-u|-v] [-g WxH] TERM [TYPE]][[year-]month-day] [hour:minute[:second]][bus]:[slot][.func][vendor]:[device]`cryptomount' command fails: %s`loopback' command fails: %s`obppath' not found in parent dirs of `%s', no IEEE1275 name discoverya value was assigned to the argument `%s' while it doesn't require an argumentaccess deniedadd NOTE segment for CHRP IEEE1275addraddress not foundattempt to read or write outside of disk `%s'attempt to read or write outside of partitionattempt to read past the end of fileattempt to seek outside of the fileattempting to read the core image `%s' from GRUBattempting to read the core image `%s' from GRUB againavailable RAMavailable formats:bad signaturebase_addr = 0x%llx, length = 0x%llx, %s
base_addr = 0x%llx, length = 0x%llx, type = 0x%x
bitmap file `%s' is of unsupported formatblocklist FILEblocklists are invalidblocksize is not divisible by 512can't break 0 loopscan't determine filesystem on %scan't find command `%s'can't mount encrypted volume `%s': %scan't open `%s': %scan't open file %s, index %d: error %dcan't retrieve blocklistscan't retrieve blocklists: %scannot compress the kernel imagecannot find a GRUB drive for %s.  Check your device.mapcannot find a device for %s (is /dev mounted?)cannot get translator command line for path `%s': %scannot open OS file `%s': %scannot open `%s': %scannot read `%s' correctlycannot read `%s': %scannot rename the file %s to %scannot restore the original directorycannot seek `%s': %scannot stat `%s': %scannot write to CD-ROMcannot write to `%s': %scannot write to the stdout: %scard not foundcat FILEchecksum verification failedchoose the compression to use for core imagecmp FILE LOCALcomUNIT[,SPEED]compare fail at offset %lluconnection refusedconnection timeoutconvert to bold fontcore image is too big (0x%x > 0x%x)core.img version mismatchcouldn't autoconfigure %scouldn't find a necessary member device of multi-device filesystemcouldn't find geli consumercouldn't find geom `part' classcouldn't open geomcouldn't read ELI metadatacouldn't retrieve UUIDcouldn't retrieve geli UUIDcouldn't retrieve random data for saltcouldn't send network packetcp FILE LOCALcrc FILEcryptographic error number %dcygwin_conv_path() faileddelete device map if it already existsdestination unreachabledevice count exceeds limitdisable hintingdisk `%s' not founddisk does not exist, so falling back to partition device %sdisk module to use (biosdisk or native). This option is only available on BIOS target.diskboot.img size must be %u bytesdo not probe for filesystems in DEVICEdomain name component is too longdon't update LED statedoneembed FILE as an early configembed FILE as public key for signature checkingembedding is not possible, but this is required for RAID and LVM installembedding is not possible, but this is required for cross-disk installenable ARCS (big-endian mips machines, mostly SGI) boot. Disables HFS+, APM, sparc64 and boot as disk image for i386-pcenable sparc boot. Disables HFS+, APM, ARCS and boot as disk image for i386-pcenter: boot, `e': options, `c': cmd-lineenvironment block too smallerror: %s.
expect GRUB images under the directory DIR/%s instead of the %s directoryfailed to get canonical path of `%s'failure reading sector 0x%llx from `%s'failure to read passwordfailure writing sector 0x%llx to `%s'falsefaulty RAM (BadRAM)file `%s' not foundfilename expectedfilename or tempo and notes expectedfilesystem `%s' does not support labelsfilesystem `%s' doesn't support blocklistsfirmware image is too bigforce autohintfour arguments expectedfwstart.img doesn't match the known good version. proceed at your own riskgenerate an image in FORMATgive a short usage messagegive this help listgiven argument is a system device, not a pathgrub-mkimage is compiled without XZ supportgrub>hang for SECS seconds (default 3600)hex FILEignore bitmap strikes when loadingincorrect terminal dimensions specificationinstall GRUB images under the directory DIR/%s instead of the %s directoryinstall even if problems are detectedinvalid PBKDF2 passwordinvalid arch-dependent ELF magicinvalid arch-independent ELF magicinvalid block sizeinvalid color specification `%s'invalid environment blockinvalid file name `%s'invalid font rangeinvalid line format: %sinvalid parameter %sinvalid skip value %lldinvalid variable name `%s'invalid video mode specification `%s'ioctl GET_ARRAY_INFO error: %sioctl GET_DISK_INFO error: %sioctl RAID_VERSION error: %skernel image is too big (0x%x > 0x%x)list network addresseslist network cardslist network routesls PATHlzop file corruptedmake the drive also bootable as floppy (default for fdX devices). May break on some BIOSes.missing `%c' symbolmissing mandatory option for `%s'module `%s' isn't loadedmodule isn't loadednameneed an image and mountpointno APM foundno DHCP info foundno DHCP option %d foundno DHCP options foundno DNS record foundno DNS reply receivedno DNS servers configuredno `/' in canonical filenameno command is specifiedno decryption key availableno network card foundno server is specifiedno such partitionno suitable video mode foundno symbol tableno terminal specifiedno terminator in the core imagenon-sector-aligned data is found in the core filenot a directorynot a primary partitionnot a regular filenot in function bodyone argument expectedother software is using the embedding area, and there is not enough room for core.img.  Such software is often trying to store data in a way that avoids detection.  We recommend you investigateout of memoryoutput a generated image to FILE [default=stdout]output file must be specifiedoutput generated config to FILE [default=stdout]overflow is detectedpasswords don't matchperform a bootp autoconfigurationphysical volume %s not foundpremature end of filepremature end of file %spress CapsLock keypress Insert keypress NumLock keypress ScrollLock keypress SysRqpress left altpress left ctrlpress left shiftpress right altpress right ctrlpress right shiftprint program versionprint the version information and exitprint this message and exitprint verbose messages.public key %08x not foundread error at offset %llu: %sread text from FILE.relative subdirectory on network serverrelocation 0x%x is not implemented yetreserved RAMretrieve DHCP option and save it into VAR. If VAR is - then print the value.root directory of TFTP serverroute loop detectedsave ROM images in DIR [optional]save output in FILE [required]select face indexserial port `%s' isn't foundset [NAME=VALUE ...]set capslock modeset font ascentset font descentset font family nameset font rangeset font sizeset input filename for 32-bit part.set input filename for 64-bit part.set input filename. Default is STDINset insert modeset numlock modeset output filename. Default is STDOUTset pause modeset scrolllock modeset the program namesizestretch|normalsymbol `%s' not foundtemporaryterminal %s isn't found or it's not handled by terminfoterminal `%s' isn't foundthe argument `%s' requires an integerthe device.map entry `%s' is invalid. Ignoring it. Please correct or delete your device.mapthe drive name `%s' in device.map is incorrect. Using %s instead. Please use the form [hfc]d[0-9]* (E.g. `hd0' or `cd')the first sector of the core file is not sector-alignedthe installation device is removable. This option is only available on EFI.the partition type 0x%x isn't validthe sectors of the core file are too fragmentedthe size of `%s' is not %uthe size of `%s' is too largethe size of `%s' is too smallthis ELF file is not of the right typethis GPT partition label contains no BIOS Boot Partition; embedding won't be possiblethis LDM has no Embedding Partition; embedding won't be possiblethis msdos-style partition label has no post-MBR gap; embedding won't be possiblethree arguments expectedtime out opening `%s'timeout reading `%s'timeout: could not resolve hardware addresstoo deep nesting of symlinkstranslator `%s' for path `%s' has several non-option words, at least `%s' and `%s'translator `%s' for path `%s' is given only options, cannot find device parttranslator command line is empty for path `%s'two arguments expectedtypeunable to identify a filesystem in %s; safety check can't be performedunaligned device sizeunexpected end of fileunknown argument `%s'unknown filesystemunknown kind of RAID device `%s'unknown regexp errorunknown target format %s
unknown terminfo type `%s'unrecognised DHCP option format specification `%s'unrecognised network address `%s'unrecognised network interface `%s'unrecognized numberunresolvable address %sunset [NAME ...]unsupported HTTP error %d: %sunsupported HTTP responseunsupported RAID version: %d.%dunsupported gzip formatunsupported serial port parityunsupported serial port speedunsupported serial port stop bits numberunsupported serial port word lengthuse COLOR for backgrounduse COLOR for labeluse COLOR for label backgrounduse COLOR for textuse DIR as the EFI System Partition root.use FILE as font (PF2).use FILE as font for labeluse FILE as the boot image [default=%s]use FILE as the core image [default=%s]use FILE as the device map [default=%s]use FILE as xorriso [optional]use GRUB files in the directory DIR [default=%s]use STRING as product nameuse STRING as product versionuse identifier file even if UUID is availableuse images and modules under DIR [default=%s/<platform>]variable `%s' isn't setvisually-ordered UTF-8wait until a debugger will attachwill not proceed with blocklistswrong ELI magic or versionxnu_uuid DEVICExz file corrupted or unsupported block optionsyou can't delete this addressyou need to load the kernel firstyour BIOS Boot Partition is too small; embedding won't be possibleyour core.img is unusually large.  It won't fit in the embedding areayour embedding area is unusually small.  core.img won't fit in it.Project-Id-Version: grub-2.00+20130519
Report-Msgid-Bugs-To: bug-grub@gnu.org
POT-Creation-Date: 2017-04-25 16:28+0200
PO-Revision-Date: 2013-09-26 11:40+0200
Last-Translator: Anton Meixome <meixome@certima.net>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.0
X-Launchpad-Export-Date: 2013-07-03 10:56+0000
              memorial total: %d KiB
    Non hai dispoñíbel ningún modo favorito
    Modo favorito: %ux%u
  a suma de comprobación EDID non é correcta  Versión de EDID: %u.%u
  Fallou a inicialización do adaptador de vídeo  Non hai ningunha suxestión dispoñíbel  VBE info:   versión: %d.%d  OEM software rev: %d.%d
  ou:  (de esquerda a dereita) (medial) (de dereita a esquerda) - A partición comeza en %llu%sKiB - Tamaño do sector %uB - Tamaño total %llu%sKiB - Tamaño total descoñecido [OPCIÓN...]%.*s: ARGP_HELP_FMT o parámetro debe ser positivo%.*s: ARGP_HELP_FMT o parámetro require un valor%.*s: Descoñécese o parámetro ARGP_HELP_FMT%ds%ds restantes.parece que %s contén un sistema de ficheiros %s que non se sabe se reserva ningún espazo para un arranque de tipo DOS. Instalar GRUB pode conducir á DESTRUCIÓN do SISTEMA_DE_FICHEIROS se datos valiosos se sobrescriben coa instalación de grub (--skip-fs-probe desactiva esta comprobación, utilícea segundo o seu propio criterio)%s parece conter un mapa de partición %s e LDM que non se sabe se ten unha combinación segura. Instalar o GRUB alí pode conducir á DESTRUCIÓN do SISTEMA_ DE_FICHEIROS se determinados datos valiosos se sobrescriben coa instalación do grub (--skip-fs-probe desactiva esta comprobación; utilícea segundo o seu propio criterio)%s parece conter un mapa de partición %s que non se sabe se reserva espazo para o arranque de estilo DOS. Instalar o GRUB alí pode conducir á DESTRUCIÓN do SISTEMA_ DE_FICHEIROS se datos valiosos se sobrescriben coa instalación do grub (--ignore-fs-examine desactiva esta comprobación; utilícea segundo o seu propio criterio)%s non é compatíbel con UUID%s xera un deseño de teclado para GRUB utilizando ckbcomp\n%s é obsoleto. Utilice gfxpayload=%s antes da orde linux no seu lugar.
%s é obsoleto. O modo VGA %d xa non se recoñece. Utilice gfxpayload=LARGOxALTO[xFONDO] antes da orde linux no seu lugar.
%s aínda non é compatíbel con grub-mkconfig.\n%s, co Hurd %s%s, co Hurd %s (modo restauración)%s, con Linux %s%s, con Linux %s (modo restauración)%s, con Xen %s e Linux %s%s, con Xen %s e Linux %s (modo restauración)%s, co hipervisor (VMM ou monitor de máquina virtual) Xen%s, con kFreeBSD %s%s, con kFreeBSD %s (modo restauración)%s, con núcleo %s (vía %s)%s, con núcleo %s (vía %s, modo de restauración)%s: NON COINCIDE O HASH
%s: Non atopado.\n%s: Aceptar
%s: ERRO DE LECTURA
%s: Demasiados argumentos
%s: Debe executar isto como root\n%s: erro:%s: info:%s: opción incorrecta -- «%c»
%s: a opción «%c%s» non permite un argumento
%s: a opción «%s» é ambigua; posibilidades:%s: a opción «--%s» non permite un argumento
%s: a opción «--%s» require un argumento
%s: a opción «-W %s» non permite un argumento
%s: a opción «-W %s» é ambigua
%s: a opción «-W %s» require un argumento
%s: a opción require un argumento -- «%c»
%s: a opción require un argumento -- «%s»\n%s: opción non recoñecida '%c%s'
%s: opción non recoñecida «--%s»
%s: aviso:(32-bit)(64-bit)(ERRO DE PROGRAMA) Non se coñece a versión!?(ERRO DE PROGRAMA) Deberíase ter sido recoñecida!?(en %s)- Etiqueta «%s»- Hora da última modificación %d-%02d-%02d %02d:%02d:%02d %s--MÁIS INFORMACIÓN---h HASH [-c FICHEIRO [-p PREFIXO]] [FICHEIRO1 [FICHEIRO2 ...]]-l | -r | [-s] grubdev osdisk.,5compatíbel coa interface protexida de 16 bit
non compatíbel coa interface protexida de 16 bit
compatíbel coa interface protexida de 32 bit
non compatíbel coa inteface protexida de 32 bit
=VAL>RAM non volátil de almacenamento da ACPIRAM reclamábel da ACPIFallou o apagado ACPIENDEREZOENDEREZO VALOR [MÁSCARA]ENDEREZO [TAMAÑO]ENDEREZO1,MASCARA1[,ENDEREZO2,MASCARA2[,...]]ADDRESS DNSSERVERDesactivado o APM
Sen o APM
Activado o APM
Co APM
ARGP_HELP_FMT: %s o valor é menor que ou igual a %sASCIIAceptar os finais de liña estilo-DOS CR/NL.Terminais de entrada activos:Terminais de saída activos:Adaptador «%s»:
Engadir un servidor de DNSEngadir un enderezo de rede.Engadir unha ruta de rede.Opcións avanzadas para %sOpcións avanzadas de %s (co hipervisor Xen)Permitir a interrupción con ESC.Preguntar polo nome do ficheiro desde o que reiniciar.Suponse que a entrada está en hexadecimal.Suponse que a entrada é unha frase de paso.Suponse que a entrada está en bruto.Tentando descifrar a chave mestra...Tentando instalar o GRUB nun disco con múltiplas etiquetas de partición ou tanto con etiquetas de partición e sistema de ficheiros. Aínda non se permite iso.Tentar instalar o GRUB nun disco con múltiplas etiquetas de partición. Isto aínda non é quen de facelo.Tentar instalar o GRUB nun disco sen particionar ou nunha partición. É moi MALA idea.Terminais de entrada dispoñíbeis:Terminais de saída dispoñíbeis:BB/sBIOS_DUMP [INT10_DUMP]BLOQUEBYTE:BITModo de imaxe de fondo.Cartafol base da lista de hashes.Sistema de inicio por BIOS.Arrancar un sistema operativo.Arrancar no modo de usuario único.Arrancar con mensaxes de depuración.Arrancar con mensaxes prolixas.Arranque de «%s»Arranque dunha lista de ordesArranque no modo cegoRuta de arranque: %s
Ruta de arranque: non está dispoñíbel
Alto dentro do GDBCGA CORORDE [ARGUMENTOS]A CPU inactiva non ralentiza o procesador
A CPU inactiva ralentiza o procesador
CS5536 en %d:%d.%d
Non se pode activar a área da ROM.Cambiar os dispositivos configurados.Cambiar o tipo de particiónComprobar a tecla Alt.Comprobar a tecla Control.Comprobar a tecla Maiús.Comprobar as funcionalidades da CPU.Comprobar os hashes de ficheiros co FICHEIRO da lista de hashes.Probar se a CPU é compatíbel co modo (predeterminado) de 64 bit (longo).Comprobar o estado do modificador de tecla.Comprobar se o usuario está na LISTAUSUARIOS.Comproba o ficheiro de configuración do script de GRUB en busca de erros de sintaxe.Despexar a pantalla.Despexada a marca activa en %d. 
Ordes:Comparar FICHEIRO co ficheiro local LOCAL.Comparar o ficheiro «%s» con «%s»:
Comparar dous ficheiros.Contar UUID XNU do dispositivo.Calcular ou comprobar a suma de comprobación do hash.Configurar o porto serie.Continuar buclesConverter os formatos comúns de tipos de letra en PF2Copiar FICHEIRO no ficheiro local LOCAL.Copiar FICHEIRO na saída estándar.Non foi posíbel localizar o controlador FPSWANon foi posíbel atopar o volume físico «%s». Algúns módulos da imaxe do núcleo deben faltar.Non foi posíbel cargar sha256Non foi posíbel cargar sha512Crear estruturas tipo BIOS para retrocompatibilidade co SO existente.Crear un ficheiro baleiro de bloque de entorno.Tipos de terminfo actuais:DISPOSITIVODISPOSITIVO [PARTICIÓN[+/-[TIPO]]] ...O DISPOSITIVO debe ser un de sistema operativo (i.e. /dev/sda).NOME_DO_DISPOSITIVOCARTAFOLCARTAFOL [OSBundleRequired]DNSSERVERFerramenta de depuración para o controlador do sistema de ficheiros.Declarar rexións de memoria como defectuosas (badram).O descompresor é demasiado grandeDefina unha entrada de menú.Defina un submenú.Eliminar un enderezo de rede.Retirar unha ruta de rede.Eliminar o controlador de bucle de retorno especificado.Eliminar variábeis.Determinar o controlador.Determinar o UUID do sistema de ficheiros.Determinar a etiqueta do sistema de ficheiros.Determinar o tipo de sistema de ficheiros.Determinar o tipo de mapa de particións.Dispositivo %s:Devid: %s
DevId: non está dispoñíbelCor directa, máscara:  %d/%d/%d/%d  pos: %d/%d/%d/%dDesactivar ACPI.Desactivar SMP.Desactivar toda a saída de arranque.Desactivar/activar SMART (0/1).Descartando a partición aniñada impropiamente (%s, %s, %s%d)Estatísticas da caché de disco = %lu (%lu.%02lu%%), perdidos = %lu
A conta de discos debe preceder a lista de discos.
Presentar a versión FPSWA.Amosar o estado de sanidade SMART.Presentar unha liña de texto.Amosar a lista de bloqueo do FICHEIRO.Presentar a saída en todas as consolas.Amosar o modo de enerxía.Presentar a utilización desta orde e saír.Presentar esta axuda e saír.Amosar/definir a data e hora actual.Non amosar nova liña ao final.Non imprimir mensaxes.Non probar ningún dispositivo de disquete.Non usar APM para deter o computador.Non fai nada, resultado satisfactorio.Non fai nada, resultado non satisfactorio.Non presentar as mensaxes de diagnóstico do arranque.Non carga as táboas do servidor especificadas en lista separada por comas.Non reiniciar, só deter.Non parar tras o primeiro erro.Non actualizar EBDA. Podería corrixir fallos ou paradas nalgúns BIOS, pero faise ineficaz se o SO non recibe RSDP do GRUB.ENVVARENVVAR [ENVVAR] ...ERRO: non se atopou un deseño de teclado correcto. Comprobe a entrada.
ESC en calquera momento para saír.EXPRESIÓNEXPRESIÓN ]Tempo transcorrido: %d.%03d s 
Tempo transcorrido: %d.%03d segundos 
Non é posíbel a incorporación. GRUB só se pode instalar nesta configuración mediante o uso de listas de bloques. Porén, as listas de bloques non son FIÁBEIS e non se recomenda o seu uso.Emular a secuencia de atallo de tecladoActivar que se interpreten os escapes coa barra invertida.Escriba o contrasinal ZFS: Entrar no KDB ao iniciar.Entrar no modo normal.Introducir frase de contrasinal de %s%s%s (%s): Introduza o contrasinal: Escriba o seu nome de usuario: Produciuse un erro ao procesar os argumentos da liña de ordes
Avaliar unha expresión.Fallou a saídaSaír do GRUB.Saír de buclesSaír do modo normal.Exportar variábeis.Exportar a versión 1 das táboa ao SO.Exportar a versión 2 e versión 3 das táboas ao SO.FICHEIROFICHEIRO [ARG ...]FICHEIRO [ARGUMENTOS...]FICHEIRO | TEMPO [PITCH1 DURACIÓN1] [PITCH2 DURACIÓN2] ... FICHEIRO...FICHEIRO1 FICHEIRO2NOMEDOFICHEIRO ORDESISTEMAFICHEIROS [VARIÁBEL]FICHEIRO|promptFORMATOO protocolo FPSWA non foi quen de atoar a interfaceRevisión de FPSWA: %x
DESDE-ATA[,DESDE-ATA]DE[K|M|G] A[K|M|G]Fallou FT_Init_FreeTypeProduciuse un fallo no arranque de ambas as entradas, a predeterminada e a proba de fallos.
Fallou ao crear a árbore do «device-mapper»Volta a «%s»Tamaño do ficheiro: %s
O sistema de ficheiro «%s» non admite a incorporaciónOs ficheiros difiren no desprazamento %llu: 0x%x [%s], 0x%x [%s]
Os ficheiros difiren en tamaño: %llu [%s], %llu [%s]
Non se pode acceder ao sistema de ficheirosSistema de ficheiros de tipo %sCompletar o MBR híbrido da unidade GPT do DISPOSITIVO. As particións especificadas serán unha parte do MBR híbrido. Permítense ata tres particións. O TIPO é un forma de MBR. + significa que esa partición está activa. Soamente pode estar activan unha partición.Finalizar a carga do emulador EFI.Proba primeiro o dispositivo SUXESTIÓN se se estiver a executar en ARC. Se SUXESTIÓN remata en coma, probe tamén as subparticiónsProba primeiro o dispositivo SUXESTIÓN se se estiver a executar no BIOS. Se SUXESTIÓN remata en coma, probe tamén as subparticiónsProba primeiro o dispositivo SUXESTIÓN se se estiver a executar en EFI. Se SUXESTIÓN remata en coma, probe tamén as subparticiónsProba primeiro o dispositivo SUXESTIÓN se se estiver a executar en IEEE1275. Se SUXESTIÓN remata en coma, probe tamén as subparticiónsProba primeiro o dispositivo SUXESTIÓN se admitir o acceso directo ao hardware. Se SUXESTIÓN remata en coma, probe tamén as subparticiónsPrimeiro, tente o HINT do dispositivo. Se HINT termina en coma, tente tamén subparticiónsCorrixir o problema de vídeo.Atopouse %s en %s (%s)\nAtopouse %s en %s\nAtopouse o micronúcleo GNU Mach: %sAtopouse o módulo Hurd: %sAtopouse o núcleo NetBSD: %s\nAtopouse o fondo: %s\nAtopouse a imaxe initrd: %s\nAtopouse o cartafol do módulo núcleo: %s\nAtopouse o núcleo de FreeBSD: %s\nAtopouse a imaxe de linux: %s\nAtopouse o tema: %s\nErro %d de Freetype ao cargar o glifo 0x%x para U+0x%x%sConxelar a configuración ATA de seguranza ata reiniciar.VenresGVersión do GNU GRUB %sMenú de arranque GRUBGRUB aínda non sabe como deter esta máquina!emulador GRUB.DISPOSITIVOGRUB=DISPOSITIVOPLAN9Lixo en ARGP_HELP_FMT: %sXerar un deseño de teclado GRUB a partir do da consola.Xerar o hash dun contrasinal PBKDF2.Xerar un ficheiro de configuración do GRUBXerar unha imaxe independente (que conteña todos os módulos) no formato seleccionadoObter a suma de comprobación CRC32 do FICHEIRO.Obter información sobre a caché do disco.Obter/estabelecer parámetros ATA do disco.GiBGiB/sHASHSUXESTIÓNDeter o sistema, se é posíbel usando APM.Detén o equipo. Esta orde non funciona en todas os sistemas de firmware.Manexar N bytes no ficheiro de saída.Ola mundoHércules IDIMAXE1 [IMAXE2 ...] PUNTO_DE_MONTAXEORDES de IMAGE_PATHImportar a chave ZFS de embalaxe almacenada no FICHEIRO.Dispositivo virtual incorrecto: non hai un tipo dispoñíbelInsira un módulo.Instalar o GRUB na súa unidade.A instalación finalizou. Non se informou de ningún erro.Referencia cara atrás incorrectaNome de clase de carácter incorrectoCarácter de ordenación incorrectoA orde %s é incorrecta.
O contido de \{\} é incorrectoDispositivo incorrecto «%s».
Conta de disco incorrecta.
A expresión regular precedente é incorrectaFin de intervalo incorrectoExpresión regular incorrectaInvocar a configuración de enrutamento do usuario.KARGUMENTOS DO NÚCLEOTECLATecla para arrancar rapidamente con esta entrada.KiBKiB/sDispositivo virtual como folla (sexa ficheiro ou disco)O antigo parámetro «ask» xa non se admite.Lenda: máscara/posición=vermello/verde/azul/reservadoTamaño do hash xeradoTamaño do salgado (salt)Listas os servidores de DNSLista os dispositivos PCI.Lista todos os ficheiros.Relacione os modos de vídeos dispoñíbeis. No caso de dar a resolución, amosar só os modos que sexan coincidentes.Listar táboas do arranque do núcleo.Lista dispositivos e ficheiros.Lista de dispositivos ou ficheiros.Listar dispositivos.Listar ficheiros nA RUTA.Lista o mapa de memoria fornecido polo firmware.Lista de modos de vídeo compatíbeis:Lista de usuarios aos que se lles permite arrancar con esta entrada.Liste ou seleccione un terminal de entrada.Liste ou seleccione un terminal de saída.Listar as variábeis actuais.Lista os tipos de letra cargados.Lista de variábeis procedentes do ficheiro de bloque de entorno.Cargar imaxe XNU de 64-bit.Cargar o envorcado do BIOS.Cargar o entorno FreeBSD.Cargar o módulo do núcleo FreeBSD (ELF).Cargar o módulo do núcleo FreeBSD.Cargar FreeDOS kernel.sys.Cargar Linux.Cargar NTLDR ou BootMGR.Cargar o módulo do núcleo NetBSD (ELF).Cargar o módulo do núcleo NetBSD.Cargar o núcleo de Plan9.Cargar o cartafol de extensión XNU.Cargar paquete de extensión XNU.Cargar extensión XNU.Cargar imaxe XNU.Cargar o disco de memoria XNU. Está dispoñíbel no SO como md0.Cargar o envorcado «propiedades-do-dispositivo».Cargar unha imaxe PXE.Cargar un mapa de teclado.Cargar o núcleo multiarranque 2.Cargar un módulo multiarranque 2.Cargar un núcleo multiarranque.Cargar un módulo multiarranque.Cargar unha imaxe de benvida para XNU.Cargar unha imaxe de hibernación XNU.Cargar e inicializar o emulador EFI.Cargar outro cargador de arranque.Cargar outro ficheiro de configuración e tomar só as entradas de menú.Cargar outro ficheiro de configuración sen cambiar o contexto e tomar del soamente as entradas de menú.Cargar outro ficheiro de configuración sen cambiar de contexto.Cargar outro ficheiro de configuración.Cargar outra carga útil en arranque do núcleoCargar imaxe de fondo no terminal activo.Cargar as táboas ACPI do servidor e as especificadas mediante argumentos.Cargar initrd.Cargar o disco de memoria kOpenBSD.Cargar o núcleo de FreeBSD.Cargar o núcleo de NetBSD.Cargar o núcleo de OpenBSD.Só carga as táboas especificadas en lista separada por comas.Carga o mesmo ficheiro de múltiplas maneiras.Carga variábeis procedentes do ficheiro de bloque de entorno.Cargar a chave de cifrado zfs.Tipos de letra cargados:Cargando GNU Mach ...Cargando Linux %s ...Cargando Xen %s ...Cargando o ramdisk inicial ...Cargando o núcleo de FreeBSD %s ...Cargando o núcleo de Illumos ...Cargando o Hurd ...MProduciuse un fallo na comprobación do MACENTRADA_DE_MENÚ é un número, un elemento do menú ou un identificador dun elemento do menú.MÓDULOO enderezo de correo para solicitudes de apoio técnico a <bug-xorriso@gnu.org>.Facer imaxe de do GRUB en CD-ROM, disco, dispositivo USB ou disquete arrancábel.Facer un ficheiro co deseño do teclado GRUB.Facer unha imaxe arrancábel de GRUB.Facer unha unidade virtual cun ficheiro.Facer activa a particiónXestionar o controlador de asignacións do BIOS.Os parámetros obrigatorios ou opcionais das opcións longas son tamén obrigatorios ou opcionais para calquera das opcións curtas que se correspondan.Manipular dispositivos PCI.Medida de tempo utilizado por ORDEEsgotouse a memoriaTipo de memoria: DDR2.Tipo de memoria: Descoñecida.Identificador da entrada de menú.A entrada do menú non está especificada.Tipo de entrada de menú.MiBMiB/saAdmítese unha liña de edición mínima tipo BASH. Para a primeira palabra, TAB lista as posíbeis ordes de compleción. En calquera outra posición, TAB lista os dispositivos posíbeis ou os ficheiros que completar. %sÉ compatíbel co modo mínimo de edición en pantalla estilo Emacs. Completado de listas con TAB. Prema Ctrl-x ou F10 para iniciar, Ctrl-c ou F2 para a liña de ordes ou ESC para descartar cambios e volver ao menú do GRUB.Faltan argumentos
Falta o ficheiro de entrada
LunsMonocromo Máis ca un dispositivo de instalación?Máis ca unha entrada do menú?Monta un dispositivo cifrado.Montar todos os volumes que teñan unha indicación «boot» estabelecida.Montar todos.Montar por UUID.Montar os dispositivos cifrados.NOMENOME [VARIABEL] [SUXESTIONS]NÚMERONÚMERO_DE_SEGUNDOSNome	Contador Ref	Dependencias
Están a utilizarse os controladores nativos do disco. Desbótase utilizar a interface do disco de firmware.Protocolos de rede:Escribiuse un novo MBR en «%s»
No foi posíbel atopar CS5536Non se atopou FPSWANon hai estatísticas dispoñíbeis sobre a duración do arranque
Sen ordes especificadas.
Non se especificou ningún dispositivo.
Non hai estatísticas dispoñíbeis sobre a caché do disco
Non se reasignaron controladoresNon se detectou ningún sistema de ficheiros coñecidoNon hai coincidenciasNon se especificou a ruta.
Non se especificou ruta nin dispositivo.
Non hai expresión regular anteriorNon hai ningunha árbore virtual de dispositivos dispoñíbelNon-chain 4 (modo de vídeo de 256 cores) Non hai parámetros abondo para a orde.
Agora conecte o depurador remoto, por favor.Número de iteracións PBKDF2SO disco #núm ------> dispositivo GRUB/BIOSErro na apertura do ficheiro do SO %s: %sOpción -- troca o modo de ordes ao nativo de xorriso.Opcións:Fóra do intervalo de procura: %d
Fóra do intervalo de substitución (%d, %d)
Sobrescribir a suposición dos dispositivos Plan9.PORDES DE PARTICIÓNRUTAO hash do PBKDF2 do seu contrasinal é %s
PORTPORTO VALOR [MÁSCARA]IDDECHAVEPÚBLICAEn paleta Procesa a configuración legada en novo contextoA análise da configuración legada en contexto novo collendo só as entradas do menúProcesa a configuración legada no mesmo contextoA análise da configuración legada no mesmo contexto collendo só as entradas do menúParte núm: %s.
A partición %d está activa agora. 
Partición %s:O estilo de partición «%s» non admite a incorporaciónCamiño : %s
Camiño: non está dispoñíbelLeva a efecto as ORDES na partición.
Utilice a «axuda da ferramenta partool para PARTICIÓN» para obter a lista das ordes dispoñíbeis.Realizar unha procura de DNSRealizar unha autoconfiguración IPV6Realizar asignacións directas e inversas.PiBPiB/sPlanar Afinar.Non use o vello título «%s» para GRUB_DEFAULT, utilice «%s» (para versións anteriores á 2.00) ou «%s» (para a 2.00 ou posteriores)GUID do grupo: %016llx
GUID do grupo: non dispoñíbelNome do grupo: %s
Nome do grupo: non dispoñíbelEstado do grupo: activoEstado do grupo: estragadoEstado do grupo: exportadoEstado do grupo: dispositivo ARC de nivel 2Estado do grupo: potencialmente activoEstado do grupo: reservado para repoñer en quenteEstado do grupo: non dispoñíbelEstado do grupo: desinicializadoOs argumentos posíbeis son:As ordes posíbeis son:Os dispositivos posíbeis son:Os ficheiros posíbeis son:As particións posíbeis son:As cousas posíbeis son:Remate de expresión regular prematuroPrema calquera tecla para continuar...Prema calquera chave para arrincar xnuPrema a tecla Intro para arrincar o sistema operativo seleccionado, «e» para editar as ordes antes de arrancar ou «c» para obter unha liña de ordes.Prema a tecla Intro para arrancar o sistema operativo seleccionado, «e» para editar as ordes antes de arrancar ou «c» para obter unha liña de ordes. ESC para volver ao menú anterior.Imprime información da memoria.Imprimir info de ZFS verbo do DISPOSITIVO.Imprimir ZFS-BOOTFSOBJ ou almacenala en VARIÁBELImprimir unha lista de bloques.Imprimir e executar argumento de bloque.Imprimir traza marcha atrás.Imprime a identidade do controlador e a configuración.Imprime os tamaños nun formato lexíbel por humanos.Comproba a información do dispositivo nunha ruta dada (ou nun dispositivo, no caso de ter a opción -d).RAM que contén táboas do arranque de núcleoRAM que contén código firmwareRañura da RAM número %d
CADEA REGEXPA imaxe da ROM está presente.Le o valor de 16 bit de ENDEREZO.Ler o valor de 16 bit de PORT.Le o valor de 32 bit de ENDEREZO.Ler o valor de 32 bit de PORT.Le o valor de 8 bit de ENDEREZO.Ler o valor de 8 bit de PORT.Ler só LENGTH bytes.Fallou o reinicioReiniciar no menú de configuración do firmware.Reiniciar o computador.Reescribir o contrasinal: Rexistro %x de %x:%02x.%x é %x
A expresión regular é demasiado grandeRetirar un servidor de DNSRetirar un módulo.Retirar unha variábel de entorno.Retirar calquera rexión de memoria dentro dun intervalo especificado.Renderizar a .disk_label de Apple.Informe dos erros a %s.
Informe dos erros a <bug-grub@gnu.org>.Solicitouse o terminal serie pero non está especificado GRUB_SERIAL_COMMAND. Utilizaranse os parámetros predeterminados.Restabelecer todas as asignacións nos valores predeterminados.Recuperar a información do dispositivo.Volver desde unha función.Volver ao indicador IEEE1275.Execute «gdb %s %d» e estabeleza os ARGS.HOLD a cero.
Executar «go» para retomar o GRUB.SEGSNOMECURTONOMECURTO TARXETA ENDEREZO [HWADDRESS]NOMECURTO REDE [INTERFACE] gw PASARELA]TAMAÑOORIXE|-u UUID|-a|-bCADEASábadoGardar o valor lido na variábel VARNAME.Garda as variábeis no ficheiro de bloque de entorno.Diga «Ola mundo».Buscar dispositivos por UUID. Se se especificou VARIÁBEL, o primeiro dispositivo atopado gárdase nunha variábel.Buscar dispositivos por un ficheiro.Buscar dispositivos por UUID de sistema de ficheiros.Buscar dispositivos por etiqueta de sistema de ficheiros.Buscar dispositivos por ficheiro, etiqueta de sistema de ficheiros ou UUID de sistema de ficheiros. Se --set estiver especificado, o primeiro dispositivo encontrado estabelécese como variábel. Se o nome da variábel non se especifica, úsase «root».Buscar dispositivos por ficheiro. Se se especificou VARIÁBEL, o primeiro dispositivo atopado gárdase nunha variábel.Buscar dispositivos por etiqueta. Se se especificou VARIÁBEL, o primeiro dispositivo atopado gárdase nunha variábel.O sector %llu xa o utiliza o controlador de raid «%s»; evítase. Pregúntelle ao fabricante para non almacenar datos na fenda MBRO sector %llu xa o utiliza o programa «%s»; evítase. Este software pode provocar no arranque ou noutros sitios problemas no futuro. Consúltelles aos seus autores para non almacenar datos no sector de inicioSelecciona o dispositivo pola súa posición no bus.Selecciona o dispositivo por fabricante e por ID.Estabelecer o xestor avanzado de enerxía
(1=baixo, ..., 254=alto, 255=apagado).Estabelecer o xestor automático de acústica
(0=apagado, 128=silencioso, ..., 254=rápido).Estabelecer OEMID de RSDP, XSDT e RSDT.Estabelecer OEMTABLE ID de RSDP, XSDT e RSDT.Estabelecer a revisión OEMTABLE de RSDP, XSDT e RSDT.Estabelecer a marca «agochada» no tipo de particiónEstabelecer unha variábel para devolver o valor.Estabeleza unha variábel para o primeiro dispositivo atopado.Defina unha variábel de entorno.Estabelecer cor de fondo no terminal activo.Estabelecer o campo creador para RSDP, CSDT e RSDT.Estabelecer a revisión do creador de RSDP, CSDT e RSDT.Estabelecer a variábel do entorno de depuración.Estabelecer a unidade en modo dormente.Estabelecer o controlador do modo de espera.Estabelecer parámetros posicionais.Estabelecer o dispositivo raíz.Estabelecer a caducidade do tempo de espera
(0=apagado, 1=5s, 2=10s, ..., 240=20m, 241=30m, ...).Estabelecer o tipo terminfo de TERM como TYPE.
Estabelecer a entrada predeterminada do menú de arranque no GRUB, só para o seguinte arranque.Estabelecer a entrada predeterminada do menú de arranque no GRUB.Estabelecer o enderezo do porto serie.Estabelecer a paridade do porto serie.Estabelecer a velocidade do porto serie.Estabelecer o bit de parada do porto serie.Estabelecer a lonxitude da palabra no porto serie.Estabelecer a unidade serie.Configurar imaxes de arranque desde o DISPOSITIVO.

Non debería executar este programa directamente de modo ordinario. Utilice grub-install maiormente.Estabelecer o contrasinal de usuario (PBKDF2). Estabelecer o contrasinal de usuario (texto simple). Non recomendado e inseguro.Estabelecer a variábel co usuario de entrada.Estabelecer as variábeis.Estabelecendo o tipo de partición como 0x%x
Modificar parámetros posicionais.Amosar a información da ACPI.Amosar a información APM.Amosar o contido da consola CBMEM.Amosa unha mensaxe de axuda.Amosa unha lista longa con información máis detallada.Amosar os contidos do FICHEIRO en hex.Amosar os módulos cargados.Amosar contido da memoria.Amosar o contido en bruto do sector ATA IDENTIFY.Amosar os contidos en bruto dun ficheiro ou da memoria.Amosar o contido dun ficheiro.Amosar as asignacións actuais.Amosar esta mensaxe.Amosa soamente as táboas da versión 1.Amosa soamente as táboas das versións 2 e 3.Fallou o apagadoSimula a antiga orde de grub «initrd»Simula a antiga orde de grub «kernel»Simula a antiga orde de grub «modulenounzip»Simula a antiga orde de grub «password»Simula a antiga orde de grub «password» no modo de entrada de menúSaltar N bytes do ficheiro de saída.Omitir o desprazamento de octetos desde o comezo do ficheiro.Rañura %d aberta
Atopouse algo máis de Hurd pero non chega para arrancar.Especifique o nome do ficheiro.Especificar o hash para usar.Especifique un ou máis ficheiros de tipos de letra para cargar.Especifica o tamaño de cada operación de lecturaEspecificar o número de ficheiros de entrada.Velocidade: %s 
Arrancar o servizo GDB no porto dadoDeter o servizo GDBGardar o compoñente de NÚMERO EN NOMEVARIBEL.CorrectoDomingoSuprimir a saída normal (permanecen os avisos).Trocar para utilizar controladores de disco nativos. De non especificar módulos, utilizarase o conxunto predeterminado (pata, ahci, usbms, ohci, uhci, ehci)Erro sintáctico na liña %u
Detectáronse erros sintácticos no ficheiro de configuración do GRUB xerado.
Asegúrese de que non hai erros en /etc/default/grub
e nos ficheiros /etc/grub.d/* ou escriba un informe de erro co
%s ficheiro anexado.O espazo do sistema de xestión do controlador de bus de E/S está en 0x%x
TDESTINOFormato de destino non especificado (utilice a opción -O).O terminal especificou a xeometría.O terminal só é ASCII [predeterminado].O terminal é un UTF-8 ordenado loxicamente.O terminal é un UTF-8 visualmente ordenado.Comprobar se é compatíbel con USB.Probar bit en BYTE:BIT no CMOS.Velocidade de lectura do ficheiro de proba.Probar se REGEXP coincide con CADEA.Probar o subsistema de vídeo en modo LARGOxALTO.Comprobar o subsistema de vídeo.Só texto Os ficheiros son idénticos.
A entrada realzada executarase automaticamente en %ds.Calquera usuario pode arrancar con esta entrada.Isto require a opción GRUB_PREDETERMINADO=gardada en %s/default/grub.\nXovesTiBTiB/sFerramenta para editar bloques de entorno.Tamaño total da flash: %d B.
Barra invertida na fin de liñaTransformar o UUID de 64 bits a formato adecuado para XNU. No caso de dar -l mantelo en minúsculas como o dá blkid.Transformar un nome de ficheiro do sistema nun de GRUB.Traduza a cadea que contén a configuración actual.Probe '%s --help' ou '%s --usage' para máis información.
MartesCONTRASINAL DE USUARIOUSUARIO CONTRASINAL_PBKDF2USUARIO[,USUARIO]UTF-8Non é posíbel crear a canalización: %sNon é posíbel determinar a súa plataforma. Utilice --target.Non é posíbel ramificar: %sNon é posíbel abrir o fluxo de %s: %sNon foi posíbel obter o estado do grupoDatos sen comprimir.Descomprimir o ficheiro antes da suma de comprobación.O tipo de enderezo %d é descoñecido
Orde «%s» descoñecida.
Formato de compresión descoñecido %sCodificación descoñecidaO argumento extra «%s» é descoñecido.Código de teclado descoñecido 0x%02x
Identificador do teclado descoñecido %s
Produciuse un erro descoñecido do sistemaModo de vídeo descoñecido Tipo de dispositivo virtual descoñecido: %s
Non se cargou o emulador EFI.Non hai coincidencia con ( ou \CNon hai coincidencia con ) ou \)Non hai coincidencia con [ ou [^Non hai coincidencia \{A opción «%s» non se recoñece\nO estado do grupo é irrecoñecíbelO tipo %d de enderezo non é compatíbel
Especificación de cobertura non compatíbel: %d
O tipo %d de enderezo de hw non é compatíbel
Formato de imaxe incompatíbelEspecificación de substitución non compatíbel: %d
Tipo de substitución non compatíbel: %d
Utilización:Utilización: %s -o SAÍDA ARGUMENTOS_CKBMAP...\nUtilización: %s DISPOSITIVO
Utilización: %s [FICHEIRO_ENTRADA [FICHEIRO_SAÍDA]]
Utilización: %s [OPCIÓN] ENTRADA_DE_MENÚ\nUtilización: %s [OPCIÓN]\nUtilizar o CDROM como root.Usar o depurador remoto GDB en lugar do DDB.Utilice CADEA como corpo da entrada de menú.Utilizar o dispositivo raíz integrado.Usar a consola serie.Use as teclas %C e %C para seleccionar que entrada realzar.VAR INTERFACE NÚMERO DESCRICIÓNVARNAMEConta atrás prolixa.Comprobar a sinatura extraída.Versión %u.%u
32-bit CS = 0x%x, len = 0x%x, offset = 0x%x
16-bit CS = 0x%x, len = 0x%x
DS = 0x%x, len = 0x%x
O dispositivo virtual no está óptimoFalta o dispositivo virtualO dispositivo virtual está desconectadoO dispositivo virtual está conectadoRetirouse o dispositivo virtualAVISO: non haberá consola para o sistema operativoAVISO: non se realizou ningunha instalación específica para ningunha plataformaAVISO: parámetros de funcionalidades do tipo de letra non compatíbeis: %x
LARGURAxALTURA.Agardar un número específico de segundos.Agardar por cada tecla presionada despois de cada liña de saída.Aviso:Aviso: a cor de fondo «%s» non é válida
Aviso: a cor de primeiro plano «%s» non é válida
Aviso: erro de sintaxe (falta a barra) en «%s»
MércoresWindows NT/2000/XP (cargador)Windows Vista/7 (cargador)Escribe o VALOR de 16 bit de ENDEREZO.Escribir o VALOR de 16 bit en PORT.Escribe o VALOR de 32 bit de ENDEREZO.Escribir o VALOR de 32 bit en PORT.Escribe o VALOR de 8 bit de ENDEREZO.Escribir o VALOR de 8 bit en PORT.Bytes SPD escritos: %d B.
Hipervisor Xen, versión %sYUV Cómpre especificar cando menos unha orde.
Terá que estabelecer «SystemPartition» e «OSLoader» manualmente.A súa área de incorporación é estrañamente pequena. A core.img no caberá nela.O seu xorriso non admite «--grub2-boot-info». Algunhas funcionalidades están desactivadas. Utilice xorriso 1.2.9 ou posterior.O seu xorriso non admite «--grub2-boot-info». A imaxe principal é demasiado grande. Arrancar como disco está desactivado. Utilice xorriso 1.2.9 ou posterior.[--append|--remove] [TERMINAL1] [TERMINAL2] ...[--force|--bpb] FICHEIRO[--md5] CONTRASINAL [FICHEIRO][--no-mem-option] [--type=TIPO] FICHEIRO [ARG ...][-1|-2] [--exclude=TÁBOA1,TÁBOA2|--load-only=TÁBOBA1, TÁBOA2] FICHEIRO1 [FICHEIRO2] [...][-c FICHEIRO [-p PREFIXO]] [FICHEIRO1 [FICHEIRO2 ...]][-d] NOMEDISPOSITIVO FICHEIRO.[-e|-n] CADEA[-f FICHEIRO][-f FICHEIRO] nome_variábel [...][-f|-l|-u|-s|-n] [--hint SUXESTIÓN [--hint SUXESTIÓN] ...] NOME[-h|-p|-r] [FICHEIRO][-l] UUIDDOGRUB [NOMEDAVARIÁBEL][-l|-h|-a] [FICHEIRO ...][-m (stretch|normal)] FICHEIRO[-s POSICIÓN] [-d DISPOSITIVO][-s POSICIÓN] [-d DISPOSITIVO] [-v VAR] [REXISTRO][=VALOR[:MÁSCARA]][-s TAMAÑO] NOMEDOFICHEIRO[ENDEREZO|comUNIDADE][,VELOCIDADE][ARG][TARXETA [HWADDRESS]][TARXETA][ENVVAR=VALOR][VARIABELENTORNO][KEYSTROKE1] [KEYSTROKE2] ...[MÓDULO1,MÓDULO2...][NÚMERO:]NOMEVARIABEL[NUM][OPCIÓNS...][OPCIÓNS][OPCIÓNS] DISCO[OPCIÓNS] FICHEIRO_OU_DISPOSITIVO[OPCIÓNS] FICHEIROS_LETRAS[OPCIÓN]... [MÓDULOS][OPCIÓN]... [RUTA|DISPOSITIVO][OPCS][RUTA][MODELO ...][LISTAUSUARIOS][VALOR]...[LARGOxALTO[xFONDO]][LARGOxALTO][[-a|-u|-v] [-g WxH] TERM [TIPO]][[ano-]mes-día] [hora:minuto[:segundo]][bus]:[rañuña][.func][fabricante]:[dispositivo]a orde «cryptomount» falla: %sa orde «loopback» falla: %snon se atopou «obppath» nos cartafoles superiores de «%s», non se descubre ningún nome IEEE1275asignouse un valor ao argumento «%s» malia que non require un argumentoacceso denegadoengadir o segmento NOTA para CHRP IEEE1275enderezonon se atopou o enderezotenta ler ou escribir fóra do disco «%s»tenta ler ou escribir fóra da particiónintenta ler pasado o remate do ficheirotenta procurar fóra do ficheirotentando ler a imaxe principal «%s» desde o GRUBtentando ler a imaxe principal «%s» desde o GRUB de novoRAM dispoñíbelformatos dispoñíbeis:mala sinaturaender_base = 0x%llx, tamaño = 0x%llx, %s
ender_base = 0x%llx, tamaño = 0x%llx, tipo = 0x%x
o ficheiro bitmap «%s» ten un formato incompatíbelFICHEIRO da lista de bloqueoas listas de bloques non son correctaso tamaño do bloque non se pode dividir entre 512non pode romper 0 buclesnon se pode determinar o sistema de ficheiros de %snon é posíbel atopar a orde «%s»non pode montar o volume cifrado «%s»: %snon se puido abrir «%s»: %snon se pode abrir o ficheiro %s, índice %d: erro %dnon é posíbel recuperar as listas de bloquesnon é posíbel recuperar as listas de bloques: %snon é posíbel comprimir a imaxe do núcleonon foi posíbel atopar unha unidade GRUB para %s. Comprobe o seu device.mapnon foi posíbel atopar un dispositivo para %s (está montado /dev?)non pode obter liña de ordes de tradutor para a ruta «%s»: %snon é posíbel abrir o ficheiro do SO «%s»: %snon se pode abrir «%s»: %snon é posíbel ler correctamente «%s»non foi posíbel ler «%s»: %snon é posíbel renomear o ficheiro de %s a %snon se pode restaurar o cartafol orixinalnon se pode procurar «%s»: %snon pode iniciar «%s»: %snon se pode escribir no CDROMnon é posíbel escribir en «%s»: %snon pode escribir na stdout: %snon se atopou a tarxetacat FICHEIROproduciuse un fallo na verificación da suma de comprobaciónescoller a compresión que se vai utilizar nas imaxes principaiscmp FICHEIRO LOCALcomUNIDADE[,VELOCIDADE]comparar fallo no desprazamento %lluconexión rexeitadaconexión esgotadaconverter en letra grosaa imaxe principal é demasiado grande (0x%x > 0x%x)non coincide a versión da core.imgnon foi posíbel autoconfigurar %snon foi posíbel atopar un dispositivo membro necesario do sistema de ficheiros multidispositivonon foi posíbel atopar un consumidor gelinon foi posíbel atopar a clase «part» do geomnon foi posíbel abrir o geomnon foi posíbel ler os metadatos ELInon foi posíbel recuperar o UUIDnon foi posíbel recuperar o UUID gelinon se poden recuperar datos aleatorios para o salgado (salt)non foi posíbel enviar un paquete de redecp FICHEIRO LOCALFICHEIRO crcerro de cifrado número %dfallou a cygwin_conv_path()eliminar o mapa do dispositivo se xa existenon se pode acadar o destinoa conta do dispositivo excede o límitedesactivar o suavizadoNon se atopou o disco «%s»o disco non existe, volvendo atrás ao dispositivo da partición %smódulo do disco para utilizar (biodisco ou nativo). Esta opción só está dispoñíbel no BIOS de destino.o tamaño de diskboot.img debe ser de %u bytesnon facer probas de sistemas de ficheiros no DISPOSITIVOo compoñente de nome de dominio é demasiado longonon actualizar o estado LEDfeitoincorpora FICHEIRO como configuración adiantadaincorpora FICHEIRO como chave pública para a comprobación de sinaturasa incorporación non é posíbel pero resulta requirida para instalación RAID e LVMnon é posíbel a incorporación pero resulta requirido para a instalación entre particións (cross-disk)activa o arranque ARCS (máquinas mips tipo big-endian, maiormente SGI). Desactiva HFS+, APM, sparc64 e arranca como imaxe de disco en PC i386activar arranque sparc. Desactiva HFS+, APM, ARCS e arranca como imaxe de disco para PC i386intro: arranque, «e»: opcións, «c»: liña cmdbloque de entorno demasiado pequenoerro: %s.
esperábanse as imaxes do GRUB no cartafol CARTAFOL//%s en lugar do cartafol %sproduciuse un fallo ao obter a ruta canónica de «%s»fallo ao ler o sector 0x%llx de «%s»fallo ao ler o contrasinalfallo ao escribir o sector 0x%llx de «%s»falsoRAM defectuosa (BadRAM)non se atopou o ficheiro «%s»agardábase o nome do ficheironome do ficheiro ou tempo e notas esperábeiso sistema de ficheiros «%s» non admite etiquetaso sistema de ficheiros «%s» non admite listas de bloquesa imaxe do firmware é demasiado grandeforzar o autosuavizadoagardábanse catro argumentosfwstart.img non acha a versión boa coñecida. Proceda segundo o seu propio criterioxerar unha imaxe en FORMATOdar unha mensaxe curta sobre o usodar esta lista de axudao argumento dado é un dispositivo do sistema, non unha rutagrub-mkimage compílase sen compatibilidade con XZgrub>agardar durante SEGS segundos (predeterminado 3600)FICHEIRO hexignorar os bitmap prefacturados ao cargara especificación de dimensións do terminal é incorrectainstalar as imaxes do GRUB no cartafol DIR/%s en lugar de facelo no cartafol %sinstalar incluso no caso de detectar problemascontrasinal PBKDF2 inpropiadoincorrecto ELF máxico dependente da arquitecturaincorrecto ELF máxico independente da arquitecturatamaño de bloque incorrectoespecificación de cor incorrecta «%s»o bloque de entorno non é correctoo nome do ficheiro «%s» é incorrectointervalo de tipo de letra incorrectoformato de liña incorrecto: %so parámetro %s non é correctoo valor %lld de escape non é correctonon é correcto o nome da variábel «%s»a especificación de vídeo «%s» é incorrectaerro de ioctl GET_ARRAY_INFO: %serro de ioctl GET_DISK_INFO: %serro de ioctl RAID_VERSION: %sa imaxe do núcleo é demasiado grande (0x%x > 0x%x)listar enderezos de redelistar tarxetas de redelistas rutas de redels RUTAO ficheiro lzop está corruptofacer a unidade tamén ser arrancábel como disquete (o predeterminado con dispositivos fdX). A unidade pode estropearse con algúns BIOS.falta o símbolo «%c»falta a opción obrigatoria «%s»o módulo «%s» non está cargadoo módulo non está cargadonomenecesita unha imaxe e un punto de montaxenon se atopu APMnon se atopou información de DHCPnon se atopou a opción %d de DHCPnon se atoparon opcións de DHCPnon se atopou ningún rexistro de DNSNon se recibiu ningunha resposta de DNSnon se configuraron servidores DNSfalta «/» no nome canónico do ficheirosen orde especificadanon hai ningunha chave de descifrado dispoñíbelnon se atopou a tarxeta de redenon se especificou ningún servidornon existe tal particiónnon se atopou o modo apropiado de vídeosen táboa de símbolonon se especificou ningún terminalnon hai terminador na imaxe principalatopáronse datos do sector non aliñado no ficheiro principalnon é un cartafolnon é unha partición primarianon é un ficheiro regularnon está no corpo da funciónagardábase un argumentoxa outro software está a usar a área de incorporación, e non sitio para o core.img. Tal software adoita tentar gardar datos de formas que evitan a detección. Recomendámoslle que investiguesen memoriaimprime unha imaxe xerada no FICHEIRO [predeterminado=stdout]debe especificarse o ficheiro de saídaimprime unha configuración xerada no FICHEIRO [predeterminado=stdout]detectouse desbordamentoos contrasinais non coincidenrealizar unha configuración automática bootpnon se atopou o volume físico %sremate do ficheiro prematurofin do ficheiro prematura %spremer a tecla de BloqMpremer a tecla de inserciónpremer a tecla de BloqNúmpremer a tecla de BloqDpremer PetSispremer Alt esquerdapremer Ctrl esquerdapremer a maiúscula esquerdapremer Alt dereitapremer Ctrl dereitapremer a maiúscula dereitaimprimir versión do programaimprimir a versión da información e saírimprimir esta mensaxe e saírimprimir mensaxes prolixas.non se atopou a chave pública %08xerro de lectura no desprazamento %llu: %sler o texto do FICHEIRO.cartafol relativo no servidor de redea relocación 0x%x aínda non está implementadaRAM reservadarecuperar a opción DHCP e gardala en VAR. Se VAR xa está - entón imprimir o valor.cartafol raíz no servidor TFTPdetectouse o bucle de rutasgardar imaxes ROM no CARTAFOL [opcional]gardar a saída en FICHEIRO [requirido]seleccionar o índice da faciananon se atopou o porto serie «%s»estabelecer [NOME=VALOR ...]definir o modo de BloqMaiúsestabelecer a medida ascendente da letraestabelecer a medida descendente da letraestabelecer o nome da familiaestabelecer o intervalo do tipo de letraestabelecer tamaño de letraestabelecer o nome do ficheiro de entrada para a parte de 32 bits.estabelecer o nome do ficheiro de entrada para a parte de 64 bits.estabelecer o nome de ficheiro de entrada. O predeterminado é STDINdefinir o modo de insercióndefinir o modo de BloqNúmestabelecer o nome do ficheiro de saída. O predeterminado é STDOUTdefinir o modo de pausadefinir o modo de BloqDesprestabelecer o nome do programatamañostretch(=%ESTENDIDA%)|normal(=%NORMAL%)non se atopou o símbolo «%s»temporalnon se atopou o terminal %s ou non o manexa o terminfonon se atopou o terminal «%s»o argumento «%s» require un enteiroa entrada «%s» do device.map é incorrecta. Ignórase. Corrixa ou elimine o seu device.mapo nome da unidade «%s» en device.map é incorrecto. Utilice %s no seu lugar. Utilice a forma [hfc]d[0-9]* (i.e. «hd0» ou «cd»)o primeiro sector do ficheiro principal non está aliñado co sectoro dispositivo de instalación é retirábel. Esta opción só está dispoñíbel en EFI.o tipo de partición 0x%x non é correctoos sectores do ficheiro principal están demasiado fragmentadoso tamaño de «%s» non é %uo tamaño de «%s» é demasiado grandeo tamaño de «%s» é demasiado pequenoeste ficheiro ELF non é do tipo apropiadoesta etiqueta de partición GPT non contén unha partición de arranque do BIOS; non será posíbel a incorporacióneste LDM non ten partición de incorporación; a incorporación non será posíbelesta etiqueta de partición con estilo msdos non ten o salto posterior ao MBR; non será posíbel a incoporaciónlagardábanse tres argumentosesgotouse o tempo ao abrir «%s»esgotouse o tempo de lectura de «%s»esgotado: non foi posíbel resolver o enderezo de hardwaredemasiada profundiade do aniñamento de ligazóns simbólicaso tradutor «%s» na ruta «%s» ten varias palabras sen opción, cando menos «%s» e «%s»o tradutor «%s» para a ruta «%s» dáse só con opcións, non pode  atopar a parte do dispositivoa liña de ordes de tradutor está baleira na ruta «%s»agardábanse dous argumentostiponon é posíbel identificar un sistema de ficheiros en %s; non se pode facer a proba de seguranzatamaño de dispositivo non aliñadoremate de ficheiro inesperadoo argumento «%s» é descoñecidosistema de ficheiros descoñecidoo dispositivo RAID  «%s» é dun tipo descoñecidoErro de expresión regular descoñecidoformato de destino descoñecido %s
tipo de terminfo descoñecido «%s»non se recoñece a especificación «%s» do formato de opción DHCPnon se recoñece o enderezo de rede «%s»a interface de rede «%s» é descoñecidanúmero non recoñecidonon se pode resolver o enderezo %ssen definir [NOME ...]O erro HTTP %d: %s non é compatíbelA resposta HTTP non é compatíbelversión de RAID incompatíbel: %d.%dO formato gzip non é compatíbelparidade do porto serie incompatíbelvelocidade do porto serie incompatíbelnúmero de bits de parada do porto serie incompatíbellargura de palabra do porto serie incompatíbelutilizar COR de fondoutilizar COR para etiquetautilizar COR para fondo de etiquetautilizar COR para textoutilice CARTAFOL como a raíz da partición do sistema EFI.utilizar FICHEIRO como tipo de letra (PF2).utilizar FICHEIRO como fonte para a etiquetautilizar FICHEIRO como imaxe de arranque [predeterminado=%s]utilizar FICHEIRO como imaxe principal [predeterminado=%s]utilice FICHEIRO como mapa de dispositivos [predeterminado=%s]utilizar FICHEIRO como xorriso [opcional]utilice os ficheiros GRUB no cartafol DIR [predeterminado=%s]utilizar CADEA como nome de produtoutilizar CADEA como versión de produtoutilizar o ficheiro identificador incluso se o UUID está dispoñíbelutilice imaxes e módulos baixo DIR [predeterminado=%s/<platform>]a variábel «%s» non está definidaUTF-8 visualmente ordenadoagardar ata que un depurador o enganchenon se procederá mediante listas de bloquesnon é o ELI máxico ou a versiónDISPOSITIVO xnu_uuidO ficheiro xz está corrupto ou ten opcións de bloque incompatíbeisnon pode eliminar este enderezocómpre cargar o núcleo primeiroa súa partición de arranque do BIOS é demasiado pequena, non será posíbel a incorporacióno seu core.img é inusualmente longo. Non se vai axustar á área de incorporacióna súa área de incorporación é estrañamente pequena. Core.img non vai caber nela.PK�m�\�vT!LC_MESSAGES/Linux-PAM.monu�[�����$,8�9Project-Id-Version: Linux-PAM
Report-Msgid-Bugs-To: http://sourceforge.net/projects/pam
POT-Creation-Date: 2018-05-18 12:58+0200
PO-Revision-Date: 2011-11-30 06:56-0500
Last-Translator: FULL NAME <EMAIL@ADDRESS>
Language-Team: Galician (http://www.transifex.com/projects/p/fedora/language/gl/)
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Zanata 3.8.3
PK�m�\Q�,�����LC_MESSAGES/gtk20.monu�[�����c4�L6xHFyH"�H"�H,I3ILIYI
_IjI
qI	|I�I �I7�I)�I4J=MJ�J�J�J�J�J'�J$�J(K)GKqK�K�K
�K
�K"�K#�K!�K0LFLRL
^L9iL6�L�L �L0
M5;M9qM8�M:�M7N2WN4�N1�N?�N11O?cO�O�O�O�O�O�O3�O
%P3PPPmP�P�P�P�P�P�P�P
�P!�P/�P"-Q>PQ�Q�Q�Q�Q
�QV�Q�(R�R�R�R�R�R�RS
S*S7SLS^StS�S�S�S�S�S�S�S�S+sT�T!�T)�T�TU$.USU1rU-�U�U!�U
V"VAV[VjV}V�V�V�V�V�V�V�V�V�VWW
.W<WDW,]W%�W+�W	�W;�W&"XIXfXlX�X�X�X�X�X Y#)YMY$\Y�Y�Y�Y�Y�YJ�Y/ZLZiZ�Z�Z�Z�Z�Z�Z[[+[	1[;[D[Z[b[g[v[�[�[�[�[�[�[\5\;\"C\f\�\�\,�\�\�\
�\$]']<]B]Q]l]
x]�]�]�]�]�]�]^&7^^^b^n^{^�^�^�^	�^�^
�^�^
_*_2_O_X_m_q_y_�_�_�_�_>�_,`
3`A`
J`U`[```
e`s`
�`�`+�`�`�`	aa!a2a-Cahqa�a�a�ab
-b;b
Rb]b	fb pb	�b	�b �b
�b
�b�b�b=�b3c?c
Vc/dc�c�c�c�c
�c
�c�c�c�cdd)d:d
@d
NdYd
fdqd�d	�d�d�d�d�d�d�d�d�d
e	e%e
2e=eCeRe
[e
iewe�e�e�e"�e2�e!f:fXf2vf!�f�f�f�f	g+g*Ag&lg�g�g�g�g�gh
 h.h=h#Ohshzh�h�h�h	�h
�h�h�h
	ii4iQiXi\ipixi�i�i
�i�i�i�i
�iw�i(?j%hj�jL�j�j
k%k@kRkek}k�k�k�k!�k�k+�k/lL0l}l�l�l�l�l�l�l�lm!m=mUmkm�m�m�m�m�mnn0nDnYnon�n�n�n�n�n�n�noo1oDoYokoo�o�o�o�o�o�op#p5pMpcpup�p�p�p�p�p�pq!q2qBq[qkq}q�q�q�q�q�q�q
r!r5rHrZrsr�r�r�r�r�r�r
s'sBs^sws�s�s�s�st t ?t`t~t�t�t�t>�t"u>u]ulu6uu�ue�u"+v!Nv�pvK�vDDwp�w*�w%x�ExG�x!!yCyG^yP�y��yg�z#0{:T{�{�{
�{�{
�{
�{�{|
-|;|V|n|	�|�|�|�|$�|!�|0}3G}{},�},�}�}�}�}+~G~T~f~v~~~	�~�~�~�~�~	�~�~
�~�~�~&/kB�������
�)�8�?�H�b�n�w�������
������ŀ̀ր!܀���
�� �'�3�8�
E�
P�^�	m�w�
����
��	��������́ԁ�������*�7�?�
E�P�X�`�h�l�p�������Âۂ�
��3�<�A�X�q�������ԃ����'�:�P�d�y�������ׄ���5�L�c������Ʌ���� �4�M�e�~�������Ն���/�D�[�n�����	������‡ڇ�	��+�<�M�^�o���������
؈���
��#�3�
C�Q�a�q�
��������ÉӉ�
���'�7�G�W�g�w���
����
��
NJ
Պ
����'�9�
K�
Y�g�
v�
��
��
����
‹Ћ
�
�
��
�
�'�
6�
D�
R�
`�
n�|�
����
��
��Ȍ��"�9�O�g�|�����΍ߍ��,�A�a�z�������َ�����%�4�C�R�a�p������ԏ�����&�8�H�X�h��������̐����0�G�^�p�����������ϑܑ��
�%�>�"X�{�������̒����1�J�c�|�����Ǔ(Γ��*�&B�$i�)����#ؔ���+�:�S�b�{���+��Еؕ���K—(�(7�2`���������	͘
ט��+�C7�"{�>��8ݙ��$�
0�;�+S�)�.��5ؚ��'�/�?�O�m�!��H����

��>+�<j���&��?ݜH�Kf�L��K��IK�B��A؞C�O^�=��M�:�Q�W�_�e�&��6���)�)�!G�i�����������
����,ˡ7��10�Ob�$��ע����f��u�	@�J�N�`�
l�z� ������Ƥߤ���'�0�
7�B�a�$y������<D���&��,æ$�$�3:�)n�B��:ۧ'�->�#l�+��-�����	��,�E�[�u�~�����
��©Ω���$�),�(V�5���Yƪ0 �,Q�~�/��:��2�$�18�(j�4��7Ȭ�<�2\�7��ǭԭ%�y�0��0��.�9�6K�.��,��ޯ���"�	:�D�P�\�
s�
~�����&�'��."�
Q�'_�-������0��*��9�8>�w�'{���5��
�����0�?�"Q�+t� ��-���*�-�-M�{�������)�� �)�
,�7�D�)Z�)����"��
ٵ�����,�$I�$n���J������
�
�
"�-�2�7�#Q�
u���=��0׷,�!5�W�n���?����%j���*��8ù�� 
�.�
=�H�)P�z�
��(��
��źԺ	ݺF�.� @�a�=u���"��
ڻ
���"�<�E�X�k�����������
ʼؼ�����"�@�T�m�u�~�
��
��
����˽Խ���� )�	J� T�2u�9��*�!
�'/�;W�%��!��ۿ�
	�4�3L�'��)�� �)�	�3'�$[�������/���� �,�@�_�k�w�����)��)��	���.�6�K�T�]�i�p�x���w��.�,?�5l�l���&�<�S�i�����	������ ����;�@H�Y��	�������	��#�8�=�V�j�
w����� ������������	�'�
0�;�D�M�Y�`�	h�r�{�����
����	����	������	����
��	����"�1�8�@�
I�W�`�f�	����������������
��	����������	�
��#�+�G�N�
W�b�	n�x�|�	��
����	��������������	���������	�!�J>�/��!������8��3�dJ�#��'�����N��Z��~3�.��!����Z��!���L+�Nx����f��"�D;�������������)��)�
?�M�c���������#��2�46�Bk�@����7��;6�r��� ��+������*�;�C�$T�y������������������#�4�uC�����#���0�9�	Q�[�n���
������
��	����	��
���-�:�B�K�(S�
|�����������������������
#�1�
:�E�
Y�	d�n�	������	��	��
������
���
��,�4�	;�E�I�M�a�
d�r�u�x���
��J�������	���-�=�D�I�R�Y�]�d�k�r�	z���	������	��
������
��
����
��	�
�	�!�*�/�	;�E�M�U�[�d�j�
r�}�������	��������	��	��	��	��	�����������	����	�	)�
3�>�A�F�K�N�R�W�\�_�d�i�n�q�z����������������������������������������������������
������#�&�,�/�2�5�8�;�?�B�E�H�K�N�T�W�]�`�c�s�����
����	�����������	��>�J�_�o�{���������������������������
��
��
������	�
���!�&�+�8�A�J�S�_�q�}���
��������������������������
���3�:�B�
J�U�
a�
l�
w�
��
��
��
��
��
������
����
��"�B�K�	Z�d�������������	��������x�'U;�`�.DZV�Ti��y����>��1�������Y:w�|���FA1���M�L�����q���_�dr�nJ3�W���Z�h�#xG�������+t�>?���;���6K�!C���[�������c}U���=��.'P���2�����%ab����m�@I�ng��g&����G���N��SoRO�/5a��%;(O~C�h�FG($vNz]0�+��y,���7><��PH`?I]��:������N9��8n�*��0Oc	�L��:0i��5I7Gz���(�2�&b@�4��c��}l�Y��r34�X�j�� /���"-$	���@��wO��M��]�e%-uL8�u�K�B�Y{�`��+Y�K�����i(+��\��	X
,���Hw��RQ�\|I'BZ�om�B7f{��E��"�����S���2�a�f��R?����K�AH�y��X��<�	~H
,�WD��F1���V��U�B��o[9��DL�&����tm�C�2>����}k�R�t�����T��M�F5Q��U�S��A!P����\��5��)jq�s<%M�p�T������������`����EE^:��#b�c� Q�dd��*3@�Tje)��A�'_v����$�[]X��uhE"/�)�=q��f?V���6~Z�,\!p.!������l|��7lNp��#���
�;��a9Vk$0�W 6���6C/�� ���D����r#��S��3e��b�^8
�.J�
��1)�"{���J�<���*sQv�[9�
=W�-�4P���g��_�-=�z�^��
��4Jx����*��s^�&��k�8��
_�����"%s" could not be converted to a value of type "%s" for attribute "%s""%s" is not a valid attribute name"%s" is not a valid attribute type"%s" is not a valid value for attribute "%s""Deepness" of the color.%1$s on %2$s%H:%M%s job #%d(None)(disabled)(unknown)--- No Tip ---<%s> element has invalid ID "%s"<%s> element has neither a "name" nor an "id" attributeA <%s> element has already been specifiedA <text> element can't occur before a <tags> elementA file named "%s" already exists.  Do you want to replace it?A_t:About %sAcceleratorDisabledAcceleratorInvalidAdd Cover PageAdd the current folder to the bookmarksAdd the folder '%s' to the bookmarksAdd the selected folder to the BookmarksAdd the selected folders to the bookmarksAdjusts the volumeAdvancedAfterAll sheetsAmharic (EZ+)Amount of blue light in the color.Amount of green light in the color.Amount of red light in the color.Anonymous tag found and tags can not be created.Any PrinterApplicationArtwork byAttribute "%s" is invalid on <%s> element in this contextAttribute "%s" repeated twice on the same <%s> elementAuthenticationAuthentication is required on %sAuthentication is required to get a file from %sAuthentication is required to get attributes of a jobAuthentication is required to get attributes of a printerAuthentication is required to get attributes of job '%s'Authentication is required to get attributes of printer %sAuthentication is required to get default printer of %sAuthentication is required to get printers from %sAuthentication is required to print a document on %sAuthentication is required to print document '%s'Authentication is required to print document '%s' on printer %sAuthentication is required to print this documentAuthentication is required to print this document on printer %sAuto SelectAxesBe_fore:BeforeBilling InfoBookmark '%s' cannot be removedBoth "id" and "name" were found on the <%s> elementBottom to topBottom to top, left to rightBottom to top, right to leftBourne Again ShellBourne ShellBrightness of the color.CLASSCOLORSC_ollateC_reateC_reditsC_urrent PageCache file created successfully.
Cannot change to folder because it is not localCannot end process with PID %d: %sCannot kill process with PID %d. Operation is not implemented.Cannot open display: %sCaps Lock is onCedillaCl_earClassifiedClick the eyedropper, then click a color anywhere on your screen to select that color.Click this palette entry to make it the current color. To change this entry, drag a color swatch here or right-click it and select "Save color here."Co_nnectColorColor SelectionColor WheelColor _name:Command LineComplete, but not uniqueCompleting...ConfidentialConnect _anonymouslyConnect as u_ser:Convert to PS level 1Convert to PS level 2Copie_s:CopiesCopy URLCopy _Link AddressCopy _LocationCould not add a bookmarkCould not clear listCould not find the icon '%s'. The '%s' theme
was not found either, perhaps you need to install it.
You can get a copy from:
	%sCould not get information for file '%s': %sCould not mount %sCould not read the contents of %sCould not read the contents of the folderCould not remove bookmarkCould not remove itemCould not rename %s back to %s: %s.
Could not rename %s to %s: %s
Could not rename %s to %s: %s, removing %s then.
Could not retrieve information about the fileCould not select fileCould not send the search requestCould not show linkCould not start the search processCouldn't convert filenameCreate Fo_lderCreate in _folder:CreditsCustom %sx%sCustom Size %dCustom sizeCyrillic (Transliterated)DISPLAYDe_lete FileDecreases the volumeDelete FileDesktopDisabledDo use the Wintab API [default]Documented byDomain:Don't batch GDI requestsDon't check for the existence of index.themeDon't include image data in the cacheDon't use the Wintab API for tablet supportDown PathDuplicate object ID '%s' on line %d (previously on line %d)Element <%s> is not allowed below <%s>Embed GhostScript fonts onlyEmptyError creating folder '%s': %sError creating print previewError deleting file '%s': %sError from StartDocError launching previewError loading icon: %sError parsing option --gdk-debugError parsing option --gdk-no-debugError printingError renaming file "%s" to "%s": %sError renaming file "%s": %sError renaming file to "%s": %sEven sheetsFLAGSFailed to load iconFailed to load image '%s': reason not known, probably a corrupt image fileFailed to open file %s : %s
Failed to open file '%s': %sFailed to rewrite header
Failed to write cache file: %s
Failed to write folder index
Failed to write hash table
Failed to write header
FileFile SystemFile System RootFile not found: %s
FilesFinishingFol_dersFolder unreadable: %sFoldersFontFont SelectionFor portable documentsForget password _immediatelyFull VolumeGDK debugging flags to setGDK debugging flags to unsetGTK+ OptionsGTK+ debugging flags to setGTK+ debugging flags to unsetGammaGeneralGetting printer information failedGetting printer information...GhostScript pre-filteringHighHold the job until it is explicitly releasedIPAIcon '%s' not present in themeImage QualityIncomplete hostname; end it with '/'Increases the volumeInputInput _MethodsInuktitut (Transliterated)Invalid URIInvalid UTF-8Invalid argument to CreateDCInvalid argument to PrintDlgExInvalid file nameInvalid handle to PrintDlgExInvalid pathInvalid pointer to PrintDlgExInvalid root element: '%s'Invalid type function on line %d: '%s'JobJob DetailsJob PriorityKeysLRE Left-to-right _embeddingLRM _Left-to-right markLRO Left-to-right _overrideLandscapeLayoutLeft to rightLeft to right, bottom to topLeft to right, top to bottomLicenseLoad additional GTK+ modulesLocationLong Edge (Standard)LowMODULESMake X calls synchronousMake all warnings fatalManage Custom SizesManage Custom Sizes...Margins from Printer...Margins:
 Left: %s %s
 Right: %s %s
 Top: %s %s
 Bottom: %s %sMediumMiscellaneousModifiedMultipressMutedNAMENameName too longNeed user interventionNew FolderNew accelerator...No deserialize function found for format %sNo extended input devicesNo item for URI '%s' foundNo items foundNo matchNo pre-filteringNo printer foundNo recently used resource found with URI `%s'No theme index file in '%s'.
If you really want to create an icon cache here, use --ignore-theme-index.
No theme index file.
NoneNot a valid icon cache: %s
Not a valid page setup fileNot availableNot enough free memoryOdd sheetsOn _holdOne SidedOnly local files may be selectedOp_acity:Open '%s'Opening %d ItemOpening %d ItemsOpening %sOr_ientation:Other...Out of paperOutermost element in text must be <text_view_markup> not <%s>Output TrayOutput a C header fileOutput t_ray:Overwrite an existing cache, even if up to datePDFPDF _Pop directional formattingPag_es:Page %uPage OrderingPage SetupPage or_dering:PagesPages Per SheetPages per SheetPages per _sheet:Pages per _side:PaperPaper MarginsPaper SizePaper SourcePaper TypePaper _source:Paper _type:Password:Path does not existPausedPaused ; Rejecting JobsPick a ColorPick a FontPlacesPortraitPosition on the color wheel.PostscriptPreparingPreparing %dPri_ority:PrintPrint DocumentPrint atPrint at timePrint to FilePrint to LPRPrint to Test PrinterPrinterPrinter '%s' has no toner left.Printer '%s' is currently offline.Printer '%s' is low on at least one marker supply.Printer '%s' is low on developer.Printer '%s' is low on paper.Printer '%s' is low on toner.Printer '%s' is out of at least one marker supply.Printer '%s' is out of developer.Printer '%s' is out of paper.Printer DefaultPrinter offlinePrinting %dProgram class as used by the window managerProgram name as used by the window managerProvides visual indication of progressRLE Right-to-left e_mbeddingRLM _Right-to-left markRLO Right-to-left o_verrideRangeReally delete file "%s"?Received invalid color data
Recently UsedRejecting JobsRemember _foreverRemember password until you _logoutRemoveRemove the bookmark '%s'Remove the selected bookmarkRename FileRename file "%s" to:Rename...ResolutionReverse landscapeReverse portraitRight to leftRight to left, bottom to topRight to left, top to bottomSCREENSVGSame as --no-wintabSans 12Save in _folder:Sc_ale:ScreenSe_lectionSearchSearch:SecretSelect A FileSelect the color you want from the outer ring. Select the darkness or lightness of that color using the inner triangle.Select which type of documents are shownSelect which types of files are shownSerialized data is malformedSerialized data is malformed. First section isn't GTKTEXTBUFFERCONTENTS-0001Short Edge (Flip)Shortcut %s already existsShortcut %s does not existShow GTK+ OptionsShow _Hidden FilesShow _Private ResourcesShow _Size ColumnSi_ze:SimpleSizeSize of the palette in 8 bit modeSole completionSome of the settings in the dialog conflictSpecify one or more page ranges,
 e.g. 1-3,7,11Specify the time of print,
 e.g. 15:30, 2:35 pm, 14:15:20, 11:46:30 am, 4 pmStandardStarting %sStatusStock labelBest _FitStock labelC_onnectStock labelCu_tStock labelDecrease IndentStock labelErrorStock labelFind and _ReplaceStock labelIncrease IndentStock labelInformationStock labelLandscapeStock labelPage Set_upStock labelPortraitStock labelPrint Pre_viewStock labelQuestionStock labelReverse landscapeStock labelReverse portraitStock labelSave _AsStock labelSelect _AllStock labelWarningStock labelZoom _InStock labelZoom _OutStock label_AboutStock label_AddStock label_ApplyStock label_AscendingStock label_BoldStock label_CD-RomStock label_CancelStock label_CenterStock label_ClearStock label_CloseStock label_ColorStock label_ConvertStock label_CopyStock label_DeleteStock label_DescendingStock label_DiscardStock label_DisconnectStock label_EditStock label_ExecuteStock label_FillStock label_FindStock label_FloppyStock label_FontStock label_FullscreenStock label_HarddiskStock label_HelpStock label_HomeStock label_IndexStock label_InformationStock label_ItalicStock label_Jump toStock label_Leave FullscreenStock label_LeftStock label_NetworkStock label_NewStock label_NoStock label_Normal SizeStock label_OKStock label_OpenStock label_PasteStock label_PreferencesStock label_PrintStock label_PropertiesStock label_QuitStock label_RedoStock label_RefreshStock label_RemoveStock label_RevertStock label_RightStock label_SaveStock label_Spell CheckStock label_StopStock label_StrikethroughStock label_UndeleteStock label_UnderlineStock label_UndoStock label_YesStock label, mediaP_auseStock label, mediaPre_viousStock label, mediaR_ewindStock label, media_ForwardStock label, media_NextStock label, media_PlayStock label, media_RecordStock label, media_StopStock label, navigation_BackStock label, navigation_BottomStock label, navigation_DownStock label, navigation_FirstStock label, navigation_ForwardStock label, navigation_LastStock label, navigation_TopStock label, navigation_UpT_wo-sided:Tag "%s" already definedTag "%s" does not exist in buffer and tags can not be created.Tag "%s" has invalid priority "%s"Tag "%s" has not been defined.Terminal PagerThai-LaoThe attribute "%s" was found twice on the <%s> elementThe color you've chosen.The color you've chosen. You can drag this color to a palette entry to save it for use in the future.The cover is open on printer '%s'.The door is open on printer '%s'.The file "%s" resides on another machine (called %s) and may not be available to this program.
Are you sure that you want to select it?The file already exists in "%s".  Replacing it will overwrite its contents.The filename "%s" contains symbols that are not allowed in filenamesThe filename "%s" couldn't be converted to UTF-8. (try setting the environment variable G_FILENAME_ENCODING): %sThe folder contents could not be displayedThe folder could not be createdThe folder could not be created, as a file with the same name already exists.  Try using a different name for the folder, or rename the file first.The folder name "%s" contains symbols that are not allowed in filenamesThe generated cache was invalid.
The license of the programThe most probable reason is that a temporary file could not be created.The previously-selected color, for comparison to the color you're selecting now.The previously-selected color, for comparison to the color you're selecting now. You can drag this color to a palette entry, or select this color as current by dragging it to the other color swatch alongside.The program was not able to create a connection to the indexer daemon.  Please make sure it is running.There is a problem on printer '%s'.This function is not implemented for widgets of class '%s'Tigrigna-Eritrean (EZ+)Tigrigna-Ethiopian (EZ+)Time of printTop CommandTop SecretTop to bottomTop to bottom, left to rightTop to bottom, right to leftTranslated byTransparency of the color.Turn off verbose outputTurns volume down or upTwo SidedType a file nameType name of new folderUnable to end processUnable to find an item with URI '%s'Unable to find include file: "%s"Unable to locate image file in pixmap_path: "%s"Unable to locate theme engine in module_path: "%s",UnclassifiedUnexpected character data on line %d char %dUnexpected start tag '%s' on line %d char %dUnhandled tag: '%s'UnknownUnknown Application (PID %d)Unknown error when trying to deserialize %sUnknown itemUnspecified errorUntitled filterUp PathUrgentUsername:Validate existing icon cacheVietnamese (VIQR)VolumeVolume DownVolume UpWindowWritten byX Input MethodX _tilt:X display to useX screen to useY t_ilt:Yesterday at %H:%MYou can enter an HTML-style hexadecimal color value, or simply a color name such as 'orange' in this entry.Z ShellZWJ Zero width _joinerZWNJ Zero width _non-joinerZWS _Zero width space_Add_Add to Bookmarks_After:_All Pages_Billing info:_Blue:_Bottom:_Browse for other folders_Clear List_Device:_Domain:_End Process_Family:_Files_Folder name:_Format for:_Gamma value_Green:_Height:_Hue:_Insert Unicode Control Character_Left:_License_Location:_Mode:_Name:_New Folder_Now_Only print:_Open Link_Orientation:_Output format_Palette:_Paper size:_Password:_Places_Pressure:_Preview:_Red:_Remove_Remove From List_Rename_Rename File_Replace_Reverse_Right:_Saturation:_Save color here_Save in folder:_Selection: _Style:_Top:_Username:_Value:_Wheel:_Width:_X:_Y:abcdefghijk ABCDEFGHIJKcalendar year format%Ycalendar:MYcalendar:day:digits%dcalendar:week:digits%dcalendar:week_start:0default:LTRdefault:mmdifferent idatas found for symlinked '%s' and '%s'
inchinput method menuNoneinput method menuSysteminput method menuSystem (%s)keyboard labelAltkeyboard labelBackSpacekeyboard labelBackslashkeyboard labelBeginkeyboard labelCtrlkeyboard labelDeletekeyboard labelDownkeyboard labelEndkeyboard labelEscapekeyboard labelHomekeyboard labelHyperkeyboard labelInsertkeyboard labelKP_Beginkeyboard labelKP_Deletekeyboard labelKP_Downkeyboard labelKP_Endkeyboard labelKP_Enterkeyboard labelKP_Homekeyboard labelKP_Insertkeyboard labelKP_Leftkeyboard labelKP_Nextkeyboard labelKP_Page_Downkeyboard labelKP_Page_Upkeyboard labelKP_Priorkeyboard labelKP_Rightkeyboard labelKP_Spacekeyboard labelKP_Tabkeyboard labelKP_Upkeyboard labelLeftkeyboard labelMetakeyboard labelMulti_keykeyboard labelNum_Lockkeyboard labelPage_Downkeyboard labelPage_Upkeyboard labelPausekeyboard labelPrintkeyboard labelReturnkeyboard labelRightkeyboard labelScroll_Lockkeyboard labelShiftkeyboard labelSpacekeyboard labelSuperkeyboard labelSys_Reqkeyboard labelTabkeyboard labelUpmmnoneoutput.%spaper size#10 Envelopepaper size#11 Envelopepaper size#12 Envelopepaper size#14 Envelopepaper size#9 Envelopepaper size10x11paper size10x13paper size10x14paper size10x15paper size11x12paper size11x15paper size12x19paper size5x7paper size6x9 Envelopepaper size7x9 Envelopepaper size9x11 Envelopepaper sizeA0paper sizeA0x2paper sizeA0x3paper sizeA1paper sizeA10paper sizeA1x3paper sizeA1x4paper sizeA2paper sizeA2x3paper sizeA2x4paper sizeA2x5paper sizeA3paper sizeA3 Extrapaper sizeA3x3paper sizeA3x4paper sizeA3x5paper sizeA3x6paper sizeA3x7paper sizeA4paper sizeA4 Extrapaper sizeA4 Tabpaper sizeA4x3paper sizeA4x4paper sizeA4x5paper sizeA4x6paper sizeA4x7paper sizeA4x8paper sizeA4x9paper sizeA5paper sizeA5 Extrapaper sizeA6paper sizeA7paper sizeA8paper sizeA9paper sizeArch Apaper sizeArch Bpaper sizeArch Cpaper sizeArch Dpaper sizeArch Epaper sizeB0paper sizeB1paper sizeB10paper sizeB2paper sizeB3paper sizeB4paper sizeB5paper sizeB5 Extrapaper sizeB6paper sizeB6/C4paper sizeB7paper sizeB8paper sizeB9paper sizeC0paper sizeC1paper sizeC10paper sizeC2paper sizeC3paper sizeC4paper sizeC5paper sizeC6paper sizeC6/C5paper sizeC7paper sizeC7/C6paper sizeC8paper sizeC9paper sizeChoukei 2 Envelopepaper sizeChoukei 3 Envelopepaper sizeChoukei 4 Envelopepaper sizeDL Envelopepaper sizeDai-pa-kaipaper sizeEuropean edppaper sizeExecutivepaper sizeFanFold Europeanpaper sizeFanFold German Legalpaper sizeFanFold USpaper sizeFoliopaper sizeFolio sppaper sizeGovernment Legalpaper sizeGovernment Letterpaper sizeIndex 3x5paper sizeIndex 4x6 (postcard)paper sizeIndex 4x6 extpaper sizeIndex 5x8paper sizeInvite Envelopepaper sizeInvoicepaper sizeItalian Envelopepaper sizeJB0paper sizeJB1paper sizeJB10paper sizeJB2paper sizeJB3paper sizeJB4paper sizeJB5paper sizeJB6paper sizeJB7paper sizeJB8paper sizeJB9paper sizeMonarch Envelopepaper sizePersonal Envelopepaper sizePostfix Envelopepaper sizeQuartopaper sizeRA0paper sizeRA1paper sizeRA2paper sizeROC 16kpaper sizeROC 8kpaper sizeSRA0paper sizeSRA1paper sizeSRA2paper sizeSmall Photopaper sizeSuper Apaper sizeSuper Bpaper sizeTabloidpaper sizeUS Legalpaper sizeUS Legal Extrapaper sizeUS Letterpaper sizeUS Letter Extrapaper sizeUS Letter Pluspaper sizeWide Formatpaper sizea2 Envelopepaper sizeasme_fpaper sizeb-pluspaper sizecpaper sizec5 Envelopepaper sizedpaper sizeepaper sizeedppaper sizefpaper sizehagaki (postcard)paper sizejis execpaper sizejuuro-ku-kaipaper sizekahu Envelopepaper sizekaku2 Envelopepaper sizeoufuku (reply postcard)paper sizepa-kaipaper sizeprc 16kpaper sizeprc 32kpaper sizeprc1 Envelopepaper sizeprc10 Envelopepaper sizeprc2 Envelopepaper sizeprc3 Envelopepaper sizeprc4 Envelopepaper sizeprc5 Envelopepaper sizeprc6 Envelopepaper sizeprc7 Envelopepaper sizeprc8 Envelopepaper sizeprc9 Envelopepaper sizeyou4 Envelopepausedprint operation statusBlocking on issueprint operation statusFinishedprint operation statusFinished with errorprint operation statusGenerating dataprint operation statusInitial stateprint operation statusPreparing to printprint operation statusPrintingprint operation statusSending dataprint operation statusWaitingprinter offlineprocessing jobprogress bar label%d %%ready to printrecent menu label%d. %srecent menu label_%d. %stest-output.%sthrobbing progress animation widgetSpinnerunknownvolume percentage%d %%year measurement template2000Project-Id-Version: gtk+-master-po-gl-77922___.merged
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2010-08-29 22:39+0200
PO-Revision-Date: 2010-08-29 22:42+0200
Last-Translator: Fran Dieguez <frandieguez@ubuntu.com>
Language-Team: Galician <gnome-gl-list@gnome.org>
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Language: gl
Plural-Forms: nplurals=2; plural=(n!=1);
X-Generator: KBabel 1.11.4
Non foi posíbel converter "%s" nun valor de tipo "%s" para o atributo "%s""%s" non é un nome de atributo correcto"%s" non é un tipo de atributo correcto"%s" non é un valor correcto para o atributo "%s""Profundidade" da cor.%1$s en %2$s%H:%M%s traballo #%d(Ningún)(desactivado)(descoñecido)--- Sen suxestión ---O elemento <%s> ten un id «%s» incorrectoO elemento <%s> non ten nin un atributo "name" nin un atributo "id"Xa se especificou un elemento <%s>Un elemento <text> non pode aparecer antes dun elemento <tags>Xa existe un ficheiro con nome "%s". Quere substituílo?_En:Sobre %sDesactivadaIncorrectaEngadir páxina de tapaEngadirlle o cartafol actual aos marcadoresEngadirlle o cartafol '%s' aos marcadoresEngadir o cartafol seleccionado aos marcadoresEngadirlle os cartafoles seleccionados aos marcadoresAxusta o volumeAvanzadoDespoisTodas as follasAmhárico (EZ+)Cantidade de luz azul na cor.Cantidade de luz verde na cor.Cantidade de luz vermella na cor.Localizouse unha etiqueta anónima e non é posíbel crear as etiquetas.Calquera impresoraAplicativoMaterial gráfico porO atributo "%s" non é válido no elemento <%s> neste contextoO atributo "%s" repítese dúas veces no mesmo elemento <%s>AutenticaciónRequírese a súa autenticación en %sRequírese a súa autenticación para obter o ficheiro dende %sRequírese a súa autenticación para recoller os atributos dun traballoRequírese a súa autenticación para recoller os atributos dunha impresoraRequírese a súa autenticación para recoller os atributos do traballo '%s'Requírese a súa autenticación para recoller os atributos da impresora %sRequírese a súa autenticación para obter a impresora predefinida de %sRequírese a súa autenticación para obter as impresoras desde %sRequírese a súa autenticación para imprimir un documento en %sRequírese a súa autenticación para imprimir un documento en '%s'Requírese a súa autenticación para imprimir o documento '%s' na impresora %sRequírese a súa autenticación para imprimir este documentoRequírese a súa autenticación para imprimir este documento na impresora %sSelección automáticaEixesAn_tes:AntesInformación de facturaciónO marcador '%s' non pode ser eliminadoLocalizáronse tanto "id" como "name" no elemento <%s>De abaixo a arribaDe abaixo a arriba, de esquerda a dereitaDe arriba a abaixo, de esquerda a dereitaIntérprete de ordes Bourne AgainIntérprete de ordes BourneBrillo da cor.CLASECORES_OrdenarC_rearC_réditosPáxina act_ualO ficheiro da caché creouse correctamente.
Non é posíbel cambiar ao cartafol porque non é localNon é posíbel finalizar o proceso co PID %d: %sNon é posíbel matar o proceso co PID %d. A operación non está implementada.Non é posíbel abrir a pantalla: %sBloq Maiús está activadoCedillaLi_mparClasificadoSeleccione o contagotas, despois prema sobre calquera cor que haxa na súa pantalla para seleccionala.Prema sobre esta entrada da paleta para convertela na cor actual. Para modificar esta entrada, arrastre unha cor de mostra aquí ou prema co botón dereito sobre a cor e seleccione "Gardar a cor aquí."Co_nectarCorSelección de corRoda de cor_Nome da cor:Liña de ordesCompletado, mais non é o únicoCompletando...ConfidencialConectarse _anonimamenteConectar como o u_suario:Converter a PS nivel 1Converter a PS nivel 2Copia_s:CopiasCopiar URLCopiar o enderezo da _ligazónCopiar a _localizaciónNon foi posíbel engadir un marcadorNon foi posíbel limpar a listaNon é posíbel localizar a icona '%s'. O tema '%s'
non se localizou ou pode que necesite instalalo.
Pode obter unha copia desde:
	%sNon foi posíbel obter información para o ficheiro '%s': %sNon foi posíbel montar %sNon foi posíbel ler os contidos do %sNon foi posíbel ler os contidos do cartafolNon foi posíbel eliminar o marcadorNon foi posíbel eliminar o elementoNon foi posíbel volver a renomear %s como %s: %s.
Non foi posíbel renomear %s como %s: %s
Non foi posíbel renomear %s como %s: %s, ao eliminar %s despois.
Non foi posíbel recuperar a información sobre o ficheiroNon foi posíbel seleccionar o ficheiroNon foi posíbel enviar a solicitude de buscaNon foi posíbel mostrar a ligazónNon foi posíbel iniciar o proceso de buscaNon foi posíbel converter o nome do ficheiroCrear car_tafolCrear no _cartafol:CréditosPersonalizado %sx%sTamaño personalizado %dTamaño personalizadoCirílico (transliterado)PANTALLA_Eliminar o ficheiroAbaixa o volumeEliminar o ficheiroEscritorioDesactivadoUsar a API Wintab [predefinido]Documentado porDominio:Non procesar en lotes os pedidos GDINon verificar a existencia de index.themeNon incluír os datos da imaxe na cachéNon usar a API Wintab para a compatibilide de táboasCamiño inferiorO identificador de obxecto «%s» na liña %d está duplicado (anteriormente na liña %d)Non se permite o elemento <%s> por baixo de <%s>Incorporar só os tipos de letra GhostScriptBaleiroProduciuse un erro ao crear o cartafol '%s': %sProduciuse un erro ao crear a previsualización da páxinaProduciuse un erro ao eliminar o ficheiro '%s': %sErro desde StartDocProduciuse un erro ao iniciar a previsualizaciónProduciuse un erro ao cargar a icona: %sProduciuse un erro ao analizar a opción --gdk-debugProduciuse un erro ao analizar a opción --gdk-no-debugProduciuse un erro ao imprimirProduciuse un erro ao renomear o ficheiro "%s" como "%s": %sProduciuse un erro ao renomear o ficheiro "%s": %sProduciuse un erro ao renomear o ficheiro como "%s": %sFollas paresPARÁMETROSProduciuse un fallo ao cargar a iconaProduciuse un fallo ao cargar a imaxe '%s': o motivo é descoñecido, é probábel que o ficheiro de imaxe estea corruptoProduciuse un fallo ao abrir o ficheiro %s : %s
Produciuse un fallo ao abrir o ficheiro '%s': %sProduciuse un fallo ao reescribir a cabeceira
Produciuse un fallo ao escribir o ficheiro da caché: %s
Produciuse un fallo ao escribir o índice do cartafol
Produciuse un fallo ao escribir a táboa hash
Produciuse un fallo ao escribir a cabeceira
FicheiroSistema de ficheirosSistema de ficheiros raízO ficheiro non foi encontrado: %s
FicheirosFinalizandoCar_tafolesCartafol ilexíbel: %sCartafolesTipo de letraSelección do tipo de letraPara documentos portátilesEsquecer o contrasinal _inmediatamenteVolume máximoMarcas de depuración GTK+ para activarMarcas de depuración GTK+ para desestabelecerOpcións GTK+Marcas de depuración GTK+ para activarMarcas de depuración GTK+ para desconfigurarGammaXeralFallou a obtención de información da impresoraObtención de información da impresora...Filtraxe previa GhostScriptAltoTermar do traballo até que sexa explicitamente liberadoIPAA icona '%s' non está presente no temaCalidade da imaxeO nome do servidor está incompleto; finaliza con '/'Sobe o volumeEntrada_Métodos de entradaInuktitut (transliterado)URI incorrectoUTF-8 non válidoArgumento incorrecto para CreateDCO argumento non é correcto para PrintDlgExO nome do ficheiro é incorrectoO manipulador non é correcto para PrintDlgExCamiño incorrectoO punteiro non é correcto para PrintDlgExElemento raíz incorrecto: '%s'Tipo de función incorrecta na liña %d: '%s'TraballoDetalles do traballoPrioridade do traballoTeclasLRE Incorpora_ción de esquerda-a-dereitaLRM Marca de _esquerda-a-dereitaLRO S_obreposición de esquerda-a-dereitaHorizontalDisposiciónDe esquerda a dereitaDe esquerda a dereita, de abaixo a arribaDe esquerda a dereita, de arriba a abaixoLicenzaCargar os módulos adicionais GTK+LocalizaciónMarxe longa (estándar)BaixoMÓDULOSFacer chamadas a X síncronasFacer todos os avisos fataisXestionar os tamaños personalizadosXestionar tamaños personalizados...Marxes de impresora...Marxes:
 Esquerda: %s %s
 Dereita: %s %s
 Superior: %s %s
 Inferior: %s %sMedioVariosModificadoPulsación múltipleSilenciadoNOMENomeO nome é demasiado longoNecesita a intervención do usuarioCartafol novoTecla rápida nova...Non se localizou a función de deserializar para o formato %sNon hai ningún dispositivo estendido de entradaNon se encontrou un elemento para o URI '%s'Non se localizou ningún elementoNon houbo coincidenciaSen filtrado previoNon se encontrou unha impresoraNon se localizou ningún recurso usado recentemente co URI `%s'Non hai ficheiro de índice de tema en '%s'.
Se está seguro de que quere crear unha caché de iconas aquí, use --ignore-theme-index.
Non hai ficheiro de índice de tema.
NingúnNon é unha caché de iconas correcta: %s
Non é un ficheiro correcto de configuración de páxinaNon dispoñíbelNon hai suficiente memoria libreFollas imparesEn e_speraUn ladoSó se poden seleccionar ficheiros locaisOp_acidade:Abrir '%s'Abrindo %d elementoAbrindo %d elementosAbrindo %sOr_ientación:Outro...Sen papelO elemento máis extremo no texto debe ser <text_view_markup> non <%s>Bandexa de saídaXerar un ficheiro de cabeceira C_Bandexa de saída:Substituír unha caché existente, mesmo se está actualizadaPDF_PDF Mostrar formatado direccionalPáx_inas:Páxina %uOrdenación de páxinasConfiguración de páxinaOr_denación de páxinas:PáxinasPáxinas por follaPáxinas por follaPá_xinas por folla:Pá_xinas por lado:PapelMarxes do papelTamaño do papelOrixe do papelTipo de papel_Orixe do papel:_Tipo de papel:Contrasinal:O camiño non existeDetidaDetida ; Rexeitando traballosSeleccione unha corEscolla un tipo de letraLugaresVerticalPosición na roda de cores.PostscriptPreparandoPreparando %dPri_oridade:ImprimirImprimir o documentoImprimirImprimir á horaImprimir a un ficheiroImprimir a LPRImprimir para probar a impresoraImpresoraA impresora '%s' non ten tóner.A impresora «%s» está desconectada actualmente.A impresora '%s' ten baixo polo menos un cartucho de cor.A impresora '%s' está baixa de revelador.A impresora '%s' ten pouco papel.A impresora '%s' está baixa de tóner.A impresora '%s' ten baleiro polo menos un cartucho de cor.A impresora '%s' está sen revelador.A impresora '%s' está sen papel.Impresora predefinidaImpresora sen conexiónImprimindo %dClase de programa tal como a usa o xestor de xanelasNome do programa tal como o usa o xestor de xanelasFornece un indicador visual de progresoRLE Incor_poración de dereita-a-esquerdaRLM Marca de _dereita-a-esquerdaRLO So_breposición de dereita-a-esquerdaIntervaloEstá seguro de que quere eliminar o ficheiro "%s"?Recibiuse un dato de cor incorrecto
Usado recentementeRexeitando traballosRecordar _sempreRecordar o contrasinal até _terminar a sesiónEliminarEliminar o marcador '%s'Eliminar o marcador seleccionadoRenomear o ficheiroRenomear o ficheiro "%s" como:Renomear...ResoluciónHorizontal invertidoVertical invertidoDe dereita a esquerdaDe dereita a esquerda, de abaixo a arribaDe dereita a esquerda, de arriba a abaixoPANTALLASVGO mesmo que --no-wintabSans 12Gardar no _cartafol:Esc_ala:Pantalla_SelecciónBuscarBuscar:SecretoSeleccionar un ficheiroSeleccione a cor que quere desde o anel exterior. Seleccione a escuridade ou luminosidade usando o triángulo interior.Seleccione o tipo de documentos que se mostranSeleccione que tipos de ficheiros se mostranOs datos serializados están formados incorrectamenteOs datos serializados están formados incorrectamente. A primeira sección non é GTKTEXTBUFFERCONTENTS-0001Marxe estreita (xirar)O atallo %s xa existeO atallo %s non existeMostrar opcións GTK+Mostrar os ficheiros _ocultosMostrar recursos _privadosMostrar a columna de _tamaño_Tamaño:SimpleTamañoTamaño da paleta en modo 8 bitsÚnico completadoAlgunhas das configuracións do diálogo están en conflitoEspecificar un ou máis intervalos de páxina,
 por ex. 1-3,7,11Especifique a hora de impresión,
por exemplo 15:30, 2:35 pm, 14:15:20, 11:46:30 am, 4 pmEstándarIniciando %sEstadoA_xuste óptimoC_onectarCor_tarDiminuír a sangríaErroLocalizar e _substituírAumentar a sangríaInformaciónHorizontalConfig_uración da páxinaVerticalPre_visualización da impresiónPreguntaHorizontal invertidoVertical invertidoGardar _comoSeleccionar _todoAviso_AumentarRed_ucir_Acerca de_Engadir_Aplicar_Ascendente_Negra_CD-ROM_Cancelar_Centrar_Limpar_Pechar_Cor_Converter_CopiarE_liminar_Descendente_Rexeitar_Desconectar_Editar_Executar_Encher_Localizar_Disquete_Tipo de letra_Pantalla completa_Disco ríxido_Axuda_InicioÍnd_ice_Información_Cursiva_Ir a_Saír da pantalla completa_Esquerda_Rede_Novo_NonTamaño _normal_Aceptar_Abrir_Pegar_Preferencias_Imprimir_Propiedades_Saír_Refacer_Actualizar_Eliminar_Recuperar_Dereita_GardarVerificación _ortográficaDe_ter_Riscado_Recuperar_Subliñada_Desfacer_SiP_ausaAn_teriorR_ebobinar_Avanzar_Seguinte_Reproducir_GravarDe_ter_Atrás_Final_Abaixo_Primeira_AdianteÚ_ltima_Inicio_ArribaPolos dous _lados:A etiqueta "%s" xa está definidaA etiqueta "%s" non existe no búfer e non é posíbel crear as etiquetas.A etiqueta "%s" ten a prioridade incorrecta"%s"A etiqueta "%s" non foi definida.Paxinador de terminalThai-LaoO atributo "%s" localizouse dúas veces no elemento <%s>A cor que seleccionou.A cor que escolleu. Pode arrastrar esta cor a unha entrada da paleta e gardala para usala no futuro.A impresora '%s' ten a tapa aberta.A porta da impresora '%s' está aberta.O ficheiro "%s" reside noutra máquina (chamada %s) e pode non estar dispoñíbel para este programa.
Está seguro de que quere seleccionalo?O ficheiro xa existe en "%s". Se o substitúe sobrescribirá os seus contidos.O nome do ficheiro "%s" contén símbolos que non están permitidos nos nomes de ficheirosNon foi posíbel converter o nome de ficheiro "%s" a UTF-8. (Tente configurar a variábel de contorno G_FILENAME_ENCODING): %sNon foi posíbel mostrar o contido do cartafolNon foi posíbel crear o cartafolNon foi posíbel crear o cartafol: xa existe un ficheiro co mesmo nome. Tente usar un nome diferente para o cartafol ou renomee o ficheiro primeiro.O nome do cartafol "%s" contén símbolos que non están permitidos nos nomes de ficheirosA caché xerada non é correcta.
A licenza do programaO motivo máis probábel é que non foi posíbel crear un ficheiro temporal.A cor seleccionada anteriormente, para comparar coa cor que seleccionou agora.A cor seleccionada anteriormente, para a comparación coa cor que está a seleccionar agora. Pode arrastrar esta cor cara a unha entrada de paleta ou seleccionar esta cor como actual arrastrándoa até a outra cor ao longo da mostra.O programa non puido crear unha conexión co deamon indexador.  Asegúrese de que está en execución.Hai un problema na impresora '%s'.Esta función non está implementada para os trebellos da clase '%s'Tigrigna-Eritreo (EZ+)Tigrigna-Etíope (EZ+)Tempo de impresiónOrde topAlto segredoDe arriba a abaixoDe arriba a abaixo, de esquerda a dereitaDe arriba a abaixo, de dereita a esquerdaTraducido porTransparencia da cor.Desactivar a saída detalladaSobe ou baixa o volumeDúas carasTeclee un nome de ficheiroEscriba o nome do cartafol novoNon fo posíbel finalizar o procesoNon foi posíbel localizar un elemento co URI '%s'Non é posíbel localizar o ficheiro 'include': "%s"Non é posíbel localizar o ficheiro de imaxe no pixmap_path: "%s"Non é posíbel localizar o motor de temas no module_path: "%s",Sen clasificarDatos de carácter inesperados na liña %d carácter %dEtiqueta de inicio inesperada '%s' na liña %d carácter %dEtiqueta non compatíbel: '%s'DescoñecidoAplicativo descoñecido (PID %d)Erro descoñecido ao tentar deserializar %sElemento descoñecidoErro non especificadoFiltro sen títuloCamiño superiorUrxenteNome de usuario:Validar a caché de iconas existenteVietnamita (VIQR)VolumeBaixar o volumeSubir o volumeXanelaEscrito porMétodo da entrada XI_nclinación X:Pantalla de X que se vai usarPantalla X que se vai usarI_nclinación Y:Onte ás %H:%MNesta entrada pode introducir un valor de cor en estilo HTML hexadecimal ou simplemente un nome de cor como 'orange'.Intérprete de ordes ZZWJ En_samblaxe de largura ceroZWNJ _Desensamblaxe de largura ceroZWS Espazo de largura _cero_Engadir_Engadir aos marcadores_Despois:Tod_as as páxinasInformación de _facturación:_Azul:In_ferior:_Buscar outros cartafolesLi_mpar a lista_Dispositivo:_Dominio:Finalizar o _proceso_Familia:_FicheirosNome do _cartafol:_Formato para:Valor _gammaV_erde:A_ltura:_Matiz:_Inserir un carácter de control Unicode_Esquerdo:_Licenza_Localización:_Modo:_Nome:Cartafol _novo_AgoraImprimir _só:_Abrir a ligazón_Orientación:Formato de _saída_Paleta:Tamaño de _papel:C_ontrasinal:_Lugares_Presión:_Previsualización:_Vermello:_EliminarElimina_r da lista_Renomear_Renomear o ficheiro_SubstituírIn_verter_Dereito:_Saturación:_Gardar a cor aquí_Gardar no cartafol:_Selección: _Estilo:_Superior:Nome de _usuario:_Valor:_Roda:Lar_gura:_X:_Y:abcdefghi ABCDEFGHI%Ycalendario:MY%d%dcalendar:week_start:1default:LTRdefault:mmlocalizáronse diferentes idatas para o '%s' ligado simbolicamente e '%s'
polgadasNingúnSistemaSistema (%s)AltTecla de retrocesoBarra invertidaInicioCtrlEliminarAbaixoFinEscapeInicioHíperInserirTN_InicioTN_SuprTN_AbaixoTN_FinTN_IntroTN_InicioTN_InserirTN_EsquerdaTN_SeguinteTN_Av_PáxTN_Re_PáxTN_AnteriorTN_DereitaTN_EspazoTN_TabuladorTN_ArribaEsquerdaMetaMulti_teclaBloq_NúmAv_PáxRe_PáxPausaImprimirIntroDereitaBloq_DesprMaiúsEspazoSúperPet_SisTabuladorArribammningúnsaída.%sSobre #10Sobre #11Sobre #12Sobre #14Sobre #910x1110x1310x1410x1511x1211x1512x195x7Sobre 6x9Sobre 7x9Sobre 9x11A0A0x2A0x3A1A10A1x3A1x4A2A2x3A2x4A2x5A3A3 ExtraA3x3A3x4A3x5A3x6A3x7A4A4 ExtraA4 TabA4x3A4x4A4x5A4x6A4x7A4x8A4x9A5A5 ExtraA6A7A8A9Arch AArch BArch CArch DArch EB0B1B10B2B3B4B5B5 ExtraB6B6/C4B7B8B9C0C1C10C2C3C4C5C6C6/C5C7C7/C6C8C9Sobre Choukei 2Sobre Choukei 3Sobre Choukei 4Sobre DLDai-pa-kaiedp europeoExecutivoFanFold europeoFanFold alemán legalFanFold norteamericanoFolioFolio spPapel de oficio legalPapel de oficio administrativoÍndice 3x5Índice 4x6 (postal)Índice 4x6 extÍndice 5x8Sobre de conviteFacturaSobre italianoJB0JB1JB10JB2JB3JB4JB5JB6JB7JB8JB9Sobre monarchSobre persoalSobre postfixCuartoRA0RA1RA2ROC 16kROC 8kSRA0SRA1SRA2Foto pequenaSúper ASúper BTabloideLegal de USLegal de US extraCarta de USCarta de US extraCarta de US plusFormato largoSobre a2asme_fb-pluscSobre c5deedpfhagaki (postal)jis execjuuro-ku-kaiSobre kahuSobre kaku2oufuku (postal de resposta)pa-kaiprc 16kprc 32kSobre prc1Sobre prc10Sobre prc2Sobre prc3Sobre prc4Sobre prc5Sobre prc6Sobre prc7Sobre prc8Sobre prc1Sobre you4detidaBloqueada por un problemaFinalizadoFinalizado con errosXerando datosEstado inicialPreparándose para a impresiónImprimirEnviando datosEn esperaa impresora non está en liñaprocesando o traballo%d %%preparada para imprimir%d. %s_%d. %ssaída-de-proba.%sAxustador(descoñecido)%d %%2000PK�m�\��U�."."LC_MESSAGES/grep.monu�[�����L|e�p�q�A/!kQ	�
0�
(GIM^?v���$CUp�����#��
1
9
L
a
s
�
(�
�
�
;�
3#/W+�'�#��;KM4j�"� �-H`����>�	P",s�������(����#�j�#=a5z �+���J5"�'���.6Qp��+���%(*Ssz����+�7:M2�.�*�&"<_~���>�"-+-Y$����,�" < Y "j A� � _� "N!q!�!�!!�!�!$�!
""
';?#%*E$:&C8,> 9.@A=+5
1KD-30J46)L"<(G/!B7F2	HI
Context control:
  -B, --before-context=NUM  print NUM lines of leading context
  -A, --after-context=NUM   print NUM lines of trailing context
  -C, --context=NUM         print NUM lines of output context

License GPLv3+: GNU GPL version 3 or later <http://gnu.org/licenses/gpl.html>.
This is free software: you are free to change and redistribute it.
There is NO WARRANTY, to the extent permitted by law.


Report bugs to: %s
      --include=FILE_PATTERN  search only files that match FILE_PATTERN
      --exclude=FILE_PATTERN  skip files and directories matching FILE_PATTERN
      --exclude-from=FILE   skip files matching any file pattern from FILE
      --exclude-dir=PATTERN  directories that match PATTERN will be skipped.
  -e, --regexp=PATTERN      use PATTERN for matching
  -f, --file=FILE           obtain PATTERN from FILE
  -i, --ignore-case         ignore case distinctions
  -w, --word-regexp         force PATTERN to match only whole words
  -x, --line-regexp         force PATTERN to match only whole lines
  -z, --null-data           a data line ends in 0 byte, not newline
%s home page: <%s>
%s home page: <http://www.gnu.org/software/%s/>
%s: invalid option -- '%c'
%s: option requires an argument -- '%c'
'(C)(standard input)Binary file %s matches
General help using GNU software: <http://www.gnu.org/gethelp/>
Invalid back referenceInvalid character class nameInvalid collation characterInvalid content of \{\}Invalid preceding regular expressionInvalid range endInvalid regular expressionMemory exhaustedMike HaertelNo matchNo previous regular expressionPackaged by %s
Packaged by %s (%s)
Premature end of regular expressionRegular expression too bigReport %s bugs to: %s
SuccessTrailing backslashUnknown system errorUnmatched ( or \(Unmatched ) or \)Unmatched \{Usage: %s [OPTION]... PATTERN [FILE]...
Valid arguments are:Written by %s and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, %s, and others.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
and %s.
Written by %s, %s, %s,
%s, %s, %s, and %s.
Written by %s, %s, %s,
%s, %s, and %s.
Written by %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
and %s.
Written by %s, %s, and %s.
Written by %s.
`ambiguous argument %s for %scharacter class syntax is [[:space:]], not [:space:]conflicting matchers specifiedexceeded PCRE's backtracking limitinput file %s is also the outputinput is too large to countinternal errorinvalid argument %s for %sinvalid character classinvalid context length argumentinvalid matcher %sinvalid max countmemory exhaustedno syntax specifiedothers, see <http://git.sv.gnu.org/cgit/grep.git/tree/AUTHORS>recursive directory loopsupport for the -P option is not compiled into this --disable-perl-regexp binarythe -P option only supports a single patternunbalanced (unbalanced )unbalanced [unfinished \ escapeunknown binary-files typeunknown devices methodwarning: %s: %swrite errorProject-Id-Version: grep 2.10
Report-Msgid-Bugs-To: bug-grep@gnu.org
POT-Creation-Date: 2017-07-02 13:21-0700
PO-Revision-Date: 2012-02-23 18:30+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=(n!=1);

Control do contexto:
  -B, --before-context=NÚM  mostra NÚM liñas de contexto anterior
  -A, --after-context=NÚM   mostra NÚM liñas de contexto posterior
  -C, --context=NÚM         mostra NÚM liñas de contexto

Licencia GPLv3+: GPL de GNU versión 3 ou posterior
<http://gnu.org/licenses/gpl.html>
Isto é software libre: vostede é libre de cambialo e redistribuilo.
Non hai NINGUNHA GARANTÍA, até onde permite a ley.

Comunicar erros no programa a: %s
      --include=PATRÓN        examina os ficheiros que coinciden con PATRÓN
      --exclude=PATRÓN        omítense os ficheiros que coinciden con PATRÓN
      --exclude-from=FICHEIRO omítense os ficheiros que coinciden cos patróns
                              de FICHEIRO
      --exclude-dir=PATRÓN    omítense os directorios que coinciden con PATRÓN
  -e, --regexp=PATRÓN       utiliza PATRÓN como expresión regular
  -f, --file=FICHERO        obtén PATRÓN de FICHEIRO
  -i, --ignore-case         considera iguais maiúsculas e minúsculas
  -w, --word-regexp         obriga a que PATRÓN coincida só con
                            palabras completas
  -x, --line-regexp         obriga a que PATRÓN coincida só con
                            liñas completas
  -z, --null-data           unha liña de datos termina nun byte 0, non
                            nun carácter de nova liña
Páxina web de %s: <%s>
páxina web de %s: <http://www.gnu.org/software/%s/>
%s: opción non válida -- '%c'
%s: a opción require un argumento -- '%c'
"(C)(entrada estándar)Arquivo binario %s aparicins
Axuda xeral sobre o uso de software de GNU: <http://www.gnu.org/gethelp/>
Referencia cara atrás non válidaNome de clase de caracteres non válidoCarácter de unión non válidoContido non válido de \{\}A expresión regular precedente non é válidaFinal de rango non válidoExpresión regular non válidaMemoria esgotadaMike HaertelNo hai ningunha coincidenciaNo hai ningunha expresión regular anteriorEmpaquetado por %s
Empaquetado por %s (%s)
Final prematuro da expresión regularA expresión regular é demasiado grandeComunicar erros sobre %s a: %s
ÉxitoBarra invertida ao finalErro do sistema descoñecido( ou \( desemparellado) o \) desemparellado\{ desemparelladoEmprego: %s [OPCIN]... PATRN [FICHEIRO]...
Os argumentos válidos son:Escrito por %s e %s.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
%s, %s, e outros.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
%s, e %s.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
e %s.
Escrito por %s, %s, %s,
%s, %s, %s, e %s.
Escrito por %s, %s, %s,
%s, %s, e %s.
Escrito por %s, %s, %s,
%s, e %s.
Escrito por %s, %s, %s,
e %s.
Escrito por %s, %s, e %s.
Escrito por %s.
"argumento %s ambiguo para %sa sintaxe da clase de caracteres é [[:space:]], non [:space:]especificronse patrns conflictivosexcedeuse o límite de volta atrás das PCREso fichero de entrada %s tamén é o de salidaa entrada  longa de mis para contalaerro internoargumento %s non válido %sclase de caracteres non válidaargumento de lonxitude do contexto non vlidoexpresión non válida %scontador máximo non válidomemoria esgotadano se especificou ningunha sintaxeoutros, véase <http://git.sv.gnu.org/cgit/grep.git/tree/AUTHORS>ciclo de directorios recursivoa compatibilidade para a opción -P non está compilada neste executábel --disable-perl-regexpa opción -P só admite un patrón( desemparellado) desemparellado[ desemparelladosecuencia de escape \ sen rematartipo binary-files descoñecidométodo de dispositivos descoñecidoatención: %s: %serro de escrituraPK�m�\�7(]��LC_MESSAGES/libsecret.monu�[�����
l
��.� /0'`0�-�0�! :�[9�,BH,�E�0�5/*e0�
	Couldn’t communicate with the secret storageDefault keyringReceived invalid secret from the secret storageattribute value pairs of item to lookupattribute value pairs which match items to clearreturn all results, instead of just first onethe collection in which to place the stored itemthe label for the new stored itemunlock item results if necessaryProject-Id-Version: PACKAGE VERSION
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2013-06-02 00:02+0200
PO-Revision-Date: 2013-06-02 00:02+0200
Last-Translator: Fran Dieguez <frandieguez@gnome.org>
Language-Team: gnome-l10n-gl@gnome.org
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
Non foi posíbel comunicarse co almacenamento de segredosAnel de chaves por omisiónRecibiuse un segredo non válido desde o almacenamento de segredospares de atributo-valor do elemento a buscarpares de atributo-valor nos que os elementos a limpar deben coincidirdevolver todos os resultados, no lugar de só unA colección na que se poñerá o elemento almacenadoa etiqueta para o novo elemento almacenadodesbloquear resultados do elemento se é precisoPK�m�\u��d�2�2#LC_MESSAGES/gst-plugins-base-1.0.monu�[������d�������
�

':Sjr�/�3�/
32

f
7t
�
'�
'�
"%>)dV�*�W6h0�2�61:3l��'��
/
=$T	y#�8�4� 6K^f+r��
���<:?,z9���	%;$Pu#��!��	*H\6q���*�%)6%`)�D�F�E<6�.�1�H/c3�0�1�2*]y&�����7Lcx�	�����4I`v�����+CXkt���bw������3P]y'�7�'�7 
J OX 8� 0� 1!,D!4q!<�!h�!8L"e�"G�"F3#Jz#C�#>	$BH$�$�$G�$
%
(%53%i%7�%	�%@�%6&-;& i&�&�&�&�&-�&'':'I'c'D'B�'-(?5(u(�(&�(�(�(6)*=)>h).�))�)***3*-^*�*>�*�*
++52+h+/�+�+/�+@,BI,>�,;�,/-37-Ik-/�-+�-0.0B.6s.!�.$�.5�.'/9/M/(b/�/&�/&�/�/0!0.0
F0T0#f0)�0�0�0�0	1171J1e1|1�1�1�1�1
�12 282N2Z2%j2cs=
}lH�~xjg�y7&'�a"A+�8#M�;f_kW*
V2t[iLh`I�%XurDQ E>p@F.<	BKR-C��n(9z4�OUJ^e]dv,P56mYN:?!b0Z1/$SG{)w�3o\|qT%s RTP depayloader%s RTP payloader%s audio RTP depayloader%s audio RTP payloader%s decoder%s demuxer%s encoder%s muxer%s protocol source%s video RTP depayloader%s video RTP payloaderAPE tagApple Lossless Audio (ALAC)Audio CD sourceBoth autoaudiosink and %s elements are missing.Both autoaudiosink and %s elements are not working.Both autovideosink and %s elements are missing.Both autovideosink and %s elements are not working.CYUV LosslessCan't play a text file without video or visualizations.Can't record audio fast enoughConfigured audiosink %s is not working.Configured videosink %s is not working.Could not determine type of streamCould not open CD device for reading.Could not open audio device for playback.Could not open audio device for playback. Device is being used by another application.Could not open audio device for recording.Could not open audio device for recording. Device is being used by another application.Could not open device for playback in %d-channel mode.Could not open device for playback in mono mode.Could not open device for playback in stereo mode.Could not open device for recording in %d-channel modeCould not open device for recording in mono mode.Could not open device for recording in stereo mode.Could not read CD.Could not seek CD.Custom text sink element is not usable.DKS subtitle formatDVD sourceDigital zoom ratio used when capturing an imageDivX MPEG-4 Version %dError while sending data to "%s:%d".FFMpeg v1Failed to read tag: not enough dataFocal length of the lens used capturing the image, in mmFocal ratio (f-number) used when capturing the imageFree Lossless Audio Codec (FLAC)GStreamer element %sICY internet radioID3 tagID3v2 frameIf the flash fired while capturing an imageInvalid URI "%s".Kate subtitle formatLossless MSZHLossless True Audio (TTA)MPL2 subtitle formatMedia (image/video) intended horizontal pixel density in ppiMedia (image/video) intended vertical pixel density in ppiMicrosoft Media Server (MMS) protocol sourceMissing element '%s' - check your GStreamer installation.MusicBrainz TRM IDMusicBrainz album IDMusicBrainz album artist IDMusicBrainz artist IDMusicBrainz track IDNo URI handler implemented for "%s".No URI specified to play from.No decoder available for type '%s'.No volume control foundPlugin or element of unknown typeQTtext subtitle formatRaw %d-bit %s audioReal Time Streaming Protocol (RTSP) sourceRun-length encodingSami subtitle formatShutter speed used when capturing an image, in secondsSource element is invalid.SubtitleTMPlayer subtitle formatThe ISO speed used when capturing an imageThe autoaudiosink element is missing.The autoaudiosink element is not working.The autovideosink element is missing.The autovideosink element is not working.The direction of contrast processing applied when capturing an imageThe direction of saturation processing applied when capturing an imageThe direction of sharpness processing applied when capturing an imageThe exposure compensation used when capturing an imageThe exposure mode used when capturing an imageThe exposure program used when capturing an imageThe metering mode used while determining exposure for capturing an imageThe overall gain adjustment applied on an imageThe scene capture mode used when capturing an imageThe selected flash mode while capturing an imageThe source or type of device used for the captureThe white balance mode set when capturing an imageThis CD has no audio tracksThis appears to be a text fileThis stream type cannot be played yet.Uncompressed audioUncompressed grayUncompressed videoUnknown decoder elementUnknown elementUnknown encoder elementUnknown sink elementUnknown source elementWindows Media Speechalbum IDalbum artist IDartist IDcapturing contrastcapturing digital zoom ratiocapturing exposure compensationcapturing exposure modecapturing exposure programcapturing flash firedcapturing flash modecapturing focal lengthcapturing focal ratiocapturing gain adjustmentcapturing iso speedcapturing metering modecapturing saturationcapturing scene capture typecapturing sharpnesscapturing shutter speedcapturing sourcecapturing white balanceimage horizontal ppiimage vertical ppitrack IDtrack TRM IDunparsed id3v2 tag frameProject-Id-Version: gst-plugins-base 1.0.3
Report-Msgid-Bugs-To: http://bugzilla.gnome.org/
PO-Revision-Date: 2012-12-15 03:40+0200
Last-Translator: Fran Dieguez <frandieguez@ubuntu.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
X-Poedit-Language: galego
X-Project-Style: gnome
decodificador RTP %scodificador RTP %sdecodificador de son RTP %scodificador de son RTP %sdecodificador %sdemultiplexor %scodificador %smultiplexor %sFonte: Protocolo %sdecodificador de vídeo RTP %scodificador de vídeo RTP %sEtiqueta APEApple Lossless Audio (ALAC)Fonte: CD de sonFaltan os elementos autoaudiosink e %s.Os elementos autoaudiosink e %s non están funcionando.Faltan os elementos autivideosink e %s.Os elementos autovideosink e %s non están funcionando.CYUV LosslessNon é posíbel reproducir un ficheiro de texto sen vídeo nin visualizacións.Non é posíbel gravar o son cunha velocidade suficienteO audiosink configurado %s non está funcionandoO videosink configurado %s non está funcionando.Non foi posíbel determinar o tipo de fluxo.Non foi posíbel abrir o dispositivo de CD para ler.Non foi posíbel abrir o dispositivo de son para reproducir.Non foi posíbel abrir o dispositivo de son para reproducir. Outro aplicativo está usado o dispositivo.Non foi posíbel abrir o dispositivo de son para gravar.Non foi posíbel abrir o dispositivo de son para gravar. Outro aplicativo está usando o dispositivo.Non foi posíbel abrir o dispositivo para reproducir no modo %d-canles.Non foi posíbel abrir o dispositivo para a reprodución en modo mono.Non foi posíbel abrir o dispositivo para a reprodución en modo estéreo.Non foi posíbel abrir o dispositivo para gravar en modo %d-canles.Non foi posíbel abrir o dispositivo para gravar en modo mono.Non foi posíbel abrir o dispositivo para gravar en modo estéreo.Non foi posíbel ler o CD.Non foi posíbel buscar no CD.Non é posíbel usar o elemento sumideiro (sink) de texto personaizado.Formato de subtítulos DKSFonte: DVDTaxa de ampliación dixital usada ao tomar unha imaxeDivX MPEG-4 Versión %dProduciuse un erro mentres se enviaban datos a "%s:%d".FFMpeg v1Produciuse un fallo ao ler a etiqueta: non hai datos suficientesLonxitude focal da lente usada ao tomar a imaxe, en mmTaxa focal (número-f) usada ao tomar a imaxeFree Lossless Audio Codec (FLAC)Elemento %s do GStreamerEmisora de internet ICYEtiqueta ID3Marco ID3v2Se o flash se disparou ao capturar unha imaxeO URI «%s» é incorrecto.Formato de subtítulos KateMSZH sen perdaLossless True Audio (TTA)Formato de subtítulos MPL2Densidade horizontal de píxeles, en ppi, do medio (imaxe ou vídeo)Densidade vertical de píxeles, en ppi, do medio (imaxe ou vídeo)Fonte: protocolo Microsoft Media Server (MMS)Falta o elemento «%s» - comprobe a instalación do GStreamer.ID TRM en MusicBrainzID do álbum en MusicBrainzID do álbum do artista en MusicBrainzID do artista en MusicBrainzID da pista en MusicBrainzNon hai implementado un manexador de URIs para «%s».Non se especificou un URI para reproducir.Non hai dispoñíbel ningún decodificador para o tipo «%s».Non foi posíbel encontrar o control do volumeEngadido ou elemento de tipo descoñecidoFormato de subtítulos QTtextSon RAW de %d-bit %sFonte: Real Time Streaming Protocol (RTSP)Codificación do tamaño durante a execuciónFormato de subtítulos SamiVelocidade do obturador usada ao tomar unha imaxe, en segundosO elemento fonte é incorrecto.SubtítuloFormato de subtítulos TMPlayerA velocidade de captura ISO usada ao tomar unha imaxeFalta o elemento autoaudiosink.O elemento autoaudiosink non está funcionando.Falta o elemento autovideosink.O elemento autovideosink non está funcionando.A dirección de contraste procesada aplicada ao tomar unha imaxeA dirección de saturación procesada aplicada ao tomar unha imaxeA dirección de nitidez procesada aplicada ao tomar unha imaxeA compensación de exposición usada ao capturar unha imaxeO modo de exposición usado ao tomar unha imaxeO programa de exposición usado ao tomar unha imaxeO modo de medición usado ao determinar a exposición ao tomar unha imaxeO axuste xeral de ganancia aplicado nunha imaxeO modo de captura usado ao tomar unha imaxeO modo de flash seleccionado ao tomar unha imaxeA orixe ou tipo de dispositivo usado para a tomaO modo de balance de brancos usado ao tomar unha imaxeEste CD non contén pistas de sonIsto parece ser un ficheiro de textoAínda non é posíbel reproducir este tipo de fluxo.Son sen comprimirGris non comprimidoVídeo sen comprimirO elemento decodificador é descoñecidoElemento descoñecidoO elemento codificador é descoñecidoElemento sumideiro (sink) descoñecidoFonte: Elemento descoñecidoWindows Media SpeechID do álbumID do álbum do artistaID do artistacontraste da tomataxa de ampliación dixital da tomacapturando a compensación de exposiciónmodo de exposición da tomaprograma de exposición da tomadisparo de flash da tomamodo de flash da tomalonxitude focal da tomataxa focal da tomaaxuste de ganancia da tomavelocidade ISO da tomamodo de medición da tomasaturación da tomatipo de escena usado na tomanitidez da tomavelocidade do obturador da tomaorixe da tomabalance de brancos da tomappi horizontal da imaxeppi vertical da imaxeID da pistaID TRM da pistamarco da etiqueta id3v2 non analizadoPK�m�\����)�)LC_MESSAGES/tar.monu�[�����v��|�	�	�	"
$8

]
k
/�
�
;�
/AYo��:�"�+281k4�#��

",
"O
r
�
1�
#�
!�
-/6P)c5�,��+F<3�*�"�50;>l�!�+�!#7"[~�,�� �!&,Hu2��!���&;Xl������*,%W}�����*-%=c}������')
FQp
������	0)�Z!!C+`�#�8�1�B.q�����?$+d�
�3�F�F48{�"�%�)A%VF|*�(�-/>W4p>�-�36FO}>�5  B ;c I� 7� 5!!/W!7�!.�!.�!<""Z"}"4�"�".�"#
#D1#7v#�#E�#$# $D$Z$ w$�$+�$�$�$%!4%"V%y%�%%�%�%�%,�%-)&W&k&(&�&�&�&8�&/'O'o'�'%�'�'�'
�'(!&( H(i(k(�(!�(!�(
�(!�());)L)])#l)4�)`hfMI=+3OqULj&Q>.H,N
W7)t
^Y1E	op@_Flc %<GX$v?J2n#rSi]b\Cg-eRP"A0mZ:Tk8u*BKdas9/!V6';5[4(D link to %s
 unknown file type %s
%s is not continued on this volume%s is the wrong size (%s != %s + %s)%s: Cannot %s%s: Cannot change mode to %s%s: Cannot change ownership to uid %lu, gid %lu%s: Cannot create symlink to %s%s: Cannot extract -- file is continued from another volume%s: Cannot hard link to %s%s: Cannot remove%s: Cannot rename to %s%s: Cannot seek to %s%s: Deleting %s
%s: Directory has been renamed%s: Directory is new%s: Directory renamed before its status could be extracted%s: File removed before we read it%s: Not found in archive%s: Omitting%s: Unexpected inconsistency when making directory%s: Unknown file type '%c', diffed as normal file%s: Unknown file type '%c', extracted as normal file%s: Unknown file type; file ignored%s: Warning: Cannot %s%s: Warning: Cannot seek to %s%s: Was unable to backup this file%s: contains invalid volume number%s: door ignored%s: file changed as we read it%s: file is on a different filesystem; not dumped%s: file is the archive; not dumped%s: file is unchanged; not dumped%s: socket ignored'(pipe)--Continued at byte %s--
--Volume Header--
Archive base-256 value is out of %s rangeArchive contains %.*s where numeric %s value expectedArchive contains obsolescent base-64 headersArchive not labeled to match %sArchive octal value %.*s is out of %s rangeArchive octal value %.*s is out of %s range; assuming two's complementArchive signed base-64 string %s is out of %s rangeArchive value %s is out of %s range %s..%sAt beginning of tape, quitting nowAttempting extraction of symbolic links as hard linksBlanks in header where numeric %s value expectedCannot backspace archive file; it may be unreadable without -iCannot execute remote shellCannot update compressed archivesCannot use multi-volume compressed archivesCannot verify compressed archivesCannot verify multi-volume archivesCannot verify stdin/stdout archiveConflicting compression optionsContents differCowardly refusing to create an empty archiveCreating directory:Deleting non-header from archiveDevice number differsEOF where user reply was expectedExtracting contiguous files as regular filesFile type differsGNU features wanted on incompatible archive formatGarbage commandGenerating negative octal headersGid differsInvalid blocking factorInvalid device numberInvalid inode numberInvalid mode given on optionInvalid record sizeInvalid tape lengthInvalid time stampInvalid value for record_sizeMod time differsMode differsMore than one threshold dateNo archive name givenNo new volume; exiting.
Not linked to %sPrepare volume #%d for %s and hit return: Record size must be a multiple of %d.Renaming %s back to %s
Renaming %s to %s
Seek direction out of rangeSeek offset out of rangeSize differsSkipping to next headerSubstituting %s for unknown date format %sSymlink differsThis does not look like a tar archiveToo many errors, quittingUid differsUnexpected EOF in archiveUnknown system errorValid arguments are:Verify Volume %s does not match %sVolume number overflowWARNING: Archive is incomplete`ambiguous argument %s for %sblock %s: block %s: ** Block of NULs **
block %s: ** End of File **
child processexec/tcp: Service not availableinterprocess channelinvalid argument %s for %smemory exhaustedstdinstdoutvalue %s out of %s range %s..%svalue %s out of %s range %s..%s; substituting %sProject-Id-Version: tar 1.13.25
Report-Msgid-Bugs-To: bug-tar@gnu.org
POT-Creation-Date: 2017-12-17 12:31+0200
PO-Revision-Date: 2002-03-26 19:17+0100
Last-Translator: Jacobo Tarr�o Barreiro <jtarrio@iname.com>
Language-Team: Galician <gpul-traduccion@ceu.fi.udc.es>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=iso-8859-1
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
 ligaz�n a %s
 Tipo de ficheiro %s desco�ecido
%s non contin�a neste volume%s ten un tama�o incorrecto (%s != %s + %s)%s: Non se pode %s%s: Non se pode cambia-lo modo a %s%s: Non se pode cambia-la propiedade ao uid %lu, gid %lu%s: Non se pode crear unha ligaz�n simb�lica a %s%s: Non se pode extraer -- o ficheiro � continuaci�n doutro volume%s: Non se pode libar a %s%s: Non se pode eliminar%s: Non se pode renomear a %s%s: Non se pode saltar a %s%s: Borrando %s
%s: Renomeouse o directorio%s: O directorio � novo%s: Renomeouse o directorio antes de poder estrae-lo seu estado%s: Ficheiro eliminado antes da s�a lectura%s: Non atopado no arquivo%s: Omit�ndoo%s: Inconsistencia inesperada ao crea-lo directorio%s: Tipo de ficheiro "%c" desco�ecido; tr�tase coma un ficheiro normal%s: Tipo de ficheiro "%c" desco�ecido, extra�ndoo coma ficheiro normal%s: Tipo de ficheiro desco�ecido; ign�rase este ficheiro%s: Aviso: Non se pode %s%s: Aviso: Non se pode saltar a %s%s: Non se puido copiar este ficheiro%s: cont�n un n�mero de volume non v�lido%s: ign�rase a porta%s: o ficheiro cambiou mentres se l�a%s: o ficheiro est� nun sistema de ficheiros diferente; non se envorca%s: o ficheiro � o arquivo; non se envorca%s: ficheiro sen cambios; non se envorca%s: ign�rase o socket"(canalizaci�n)--Contin�a no byte %s--
--Cabeceira de Volume--
O valor base-256 do arquivo est� f�ra do rango de %sO arquivo cont�n %.*s onde se esperaba un valor num�rico de %sO arquivo cont�n cabeceiras base-64 obsoletasO arquivo non est� etiquetado para coincidir con %sO valor octal do arquivo %.*s est� f�ra do rango de %sO valor octal do arquivo %.*s est� f�ra do rango de %s; suponse complemento a 2A cadea base-64 asinada do arquivo %s est� f�ra do rango de %sO valor do arquivo %s est� f�ra do rango de %s %s..%sNo comezo da cinta, sa�ndo agoraTentando extrae-las ligaz�ns simb�licas coma ligaz�ns durasAtop�ronse espacios na cabeceira onde se esperaba un valor n�merico de %sNon se pode recuar no arquivo; pode ser ilexible sen -iNon se pode executar un int�rprete de comandos remotoNon se poden actualiza-los arquivos comprimidosNon se poden empregar arquivos comprimidos multi-volumeNon se poden verifica-los arquivos comprimidosNon se pode verifica-los arquivos multi-volumeNon se poden verifica-los arquivos da entrada/sa�da est�ndarOpci�ns de compresi�n conflictivasO contido � diferenteDe xeito cobarde rex�itase crear un ficheiro baleiroCreando o directorio:Borrando o que non sexan cabeceiras do arquivoO n�mero de dispositivo � diferenteChegouse � fin de ficheiro onde se esperaba unha resposta do usuarioExtraendo os ficheiros contiguos coma ficheiros normaisO tipo de ficheiro � diferenteQu�rense as caracter�sticas de GNU no formato de arquivo incompatibleComando lixoXerando cabeceiras octais negativasOs gid son diferentesFactor de bloqueo non v�lidoN�mero de dispositivo non v�lidoN�mero de inode non v�lidoProporcionouse na opci�n un modo non v�lidoTama�o de rexistro non v�lidoLonxitude da fita non v�lidaMarca de tempo non v�lidaValor non v�lido para record_sizeA data de modificaci�n � diferenteO modo � diferenteM�is dunha data de umbralNon se proporcionou o nome do arquivoNon hai novos volumes; sa�ndo.
Non ligado a %sPrepare o volume #%d para %s e prema enter: O tama�o do rexistro debe ser m�ltiplo de %d.Renomeando %s a %s
Renomeando %s a %s
Direcci�n de desprazamento f�ra de rangoDesprazamento f�ra de rangoO tama�o � diferentePasando � seguinte cabeceiraSubstitu�ndo o formato de data desco�ecido %2$s por %1$sA ligaz�n simb�lica � diferenteIsto non semella un arquivo tarDemasiados erros, sa�ndoOs uid son diferentesFin de ficheiro inesperado no arquivoErro do sistema desco�ecidoOs argumentos v�lidos son:Verificar O volume %s non coincide con %sDesbordamento no n�mero de volumeAVISO: O arquivo est� incompleto"argumento %s ambiguo para %sbloque %s: bloque %s: ** Bloque de nulos **
bloque %s: ** Fin de Ficheiro **
proceso filloexec/tcp: Servicio non dispo�iblecanle interprocesoargumento %s non v�lido para %smemoria esgotadaentrada est�ndarsa�da est�ndarvalor %s f�ra do rango de %s %s..%svalor %s f�ra do rango de %s %s..%s; substitu�ndo %sPK�m�\�����LC_MESSAGES/passwd.monu�[�����$,8�9Project-Id-Version: passwd
Report-Msgid-Bugs-To: http://bugzilla.redhat.com/
POT-Creation-Date: 2018-04-01 02:30+0200
PO-Revision-Date: 2011-11-28 13:42+0000
Last-Translator: FULL NAME <EMAIL@ADDRESS>
Language-Team: Galician (http://www.transifex.com/projects/p/fedora/language/gl/)
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
PK�m�\���@��"LC_MESSAGES/gst-plugins-bad-1.0.monu�[�����t�1%C$i�k�)8T t���AH2�5���5� �6�:$-_	
Could not get settings from frontend device "%s".Could not open file "%s" for reading.Could not open frontend device "%s".Could not read DVD.Could not read DVD. This may be because the DVD is encrypted and a DVD decryption library is not installed.Could not read title information for DVD.Device "%s" does not exist.Failed to open DVD device '%s'.Failed to set PGC based seeking.Internal data stream error.Project-Id-Version: gst-plugins-bad 0.10.21.2
Report-Msgid-Bugs-To: http://bugzilla.gnome.org/
PO-Revision-Date: 2011-09-05 12:50+0200
Last-Translator: Fran Dieguez <frandieguez@ubuntu.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n!=1);
X-Poedit-Language: galego
Non foi posíbel obter os axustes do dispositivo frontend «%s».Non foi posíbel abrir o ficheiro «%s» para ler.Non foi posíbel abrir o dispositivo frontend «%s».Non foi posíbel ler o DVD.Non foi posíbel ler o DVD. Isto pode ser cause de que o DVD estea cifrado e non teña instalada unha biblioteca de descifrado de DVD.Non foi posíbel ler a información do título do DVDO dispositivo «%s» non existe.Produciuse un fallo ao abrir o dispositivo DVD «%s».Produciuse un fallo ao estabelecer a busca baseada en PGC.Produciuse un erro interno no fluxo de datos.PK�m�\Y.b��j�jLC_MESSAGES/findutils.monu�[������0p��
DL\�)�����wH�N�7'"_'�|�'tB$�"��*4_p1��#��$$4-Y�!� �<�'>6u�)�"��I
W9f#�1��<bPb�c�z�(>5t6�7�g�4c��+P3|W�x�?�X�<8)u3�6�9
 (D �m �� D�!�!"7""[Z"-�"'�"�#��$/7%*g%2�%4�%A�%o<&q�&:'�Y'((6(7M(3�(�(�(�(�()!)8)=)!D)f)�)�)!�)=�)!*+:*f* �* �*#�*6�*$#+H+^+v+�+P�+6�+n/,)�,P�,-)-3H-|-D�-(�-�.�.)�.%�. �.�/!�/	061F1*M1x1�1)�1�2�2�2	3)313WH3?�3I�3C*5+n5q�5>6"K6-n6@�6��6�7�7��7��9,:�?:�:;�;W�;oM<>�<&�<$#=qH=�=��="q>+�>�>�>3�>)?:?8Z?)�?8�?.�?5%@<[@2�@!�@)�@$AN<A�AL�A�A;BB>B4�B�B_�Bf2CD�D8�D:E#REDvEs�Et/Fo�F�G%�G�G�GZ�G#DHQhH4�Hr�H;bI��I6qJ5�J]�Js<K �KF�K[LDtL-�LJ�LM2ML�M+�M��M��NO"OrO"�O8�Oa�O+MP%yP��P{>RD�R,�R:,S=gSR�Sv�SnoT?�T�U�U"�U#V>:VOyV�V�V�V3WJW8_W�W�W#�W,�W�W!	X(+XHTX-�X0�X7�X84Y8mY9�YN�Y//Z_ZuZ �Z�ZU�ZF![�h[,�[G\^\&r\;�\�\b�\<Q]��]%^:C^/~^*�^��^+�_�_G�`;a/Bara�a7�a2�b�b c'5c
]chck�c;�cX.dO�e-�e�fE�f+�f-�fR*g�}goh�htL&�[jE!w�|�R
�r81ce�ZbUVldWm^%.B#�O��"�} Jo�a6��NHK	��Gh_x��M/'sIvun����`*\k�f�<$9-Q{=�:��3�Cg����q5
P(F���zT7)�p�i0+2�Y>SX�~���?y�@4]A;D,�hl�������h7$����
i$����9i2����mi/�����iC2����-j(����]j=�����j6����
Execution of xargs will continue now, and it will try to read its input and run commands; if this is not what you wanted to happen, please type the end-of-file keystroke.

Report bugs to <bug-findutils@gnu.org>.

actions: -delete -print0 -printf FORMAT -fprintf FILE FORMAT -print 
      -fprint0 FILE -fprint FILE -ls -fls FILE -prune -quit
      -exec COMMAND ; -exec COMMAND {} + -ok COMMAND ;
      -execdir COMMAND ; -execdir COMMAND {} + -okdir COMMAND ;

default path is the current directory; default expression is -print
expression may consist of: operators, options, tests, and actions:
      -context CONTEXT
%s is an slocate database of unsupported security level %d; skipping it.%s is an slocate database.  Support for these is new, expect problems for now.%s is an slocate database.  Turning on the '-e' option.%s is not the name of a known user%s is not the name of an existing group%s is not the name of an existing group and it does not look like a numeric group ID because it has the unexpected suffix %s%s terminated by signal %d%s%s changed during execution of %s (old device number %ld, new device number %ld, file system type is %s) [ref %ld]%s: exited with status 255; aborting%s: invalid number for -%c option
%s: stopped by signal %d%s: terminated by signal %d%s: value for -%c option should be >= %ld
< %s ... %s > ? All Filenames: %s
Arguments to -type should contain only one letterCannot close standard inputCannot obtain birth time of file %sCannot open input file %sCannot read list of mounted devices.Cannot read mounted file system listCompression ratio %4.2f%% (higher is better)
Compression ratio is undefined
Database %s is in the %s format.
Empty argument to the -D option.Environment variable %s is not set to a valid decimal numberEric B. DeckerExpected a positive decimal integer argument to %s, but got %sExpected an integer: %sFailed to fully drop privilegesFailed to safely change directory into %sFailed to write to standard outputFeatures enabled: File system loop detected; %s is part of the same file system loop as %s.Filesystem loop detected; %s has the same device number and inode as a directory which is %d level higher in the file system hierarchyFilesystem loop detected; %s has the same device number and inode as a directory which is %d levels higher in the file system hierarchyI cannot figure out how to interpret %s as a date or timeIgnoring unrecognised debug flag %sInvalid argument %s for option --max-database-ageInvalid argument %s to -usedInvalid escape sequence %s in input delimiter specification.Invalid escape sequence %s in input delimiter specification; character values must not exceed %lo.Invalid escape sequence %s in input delimiter specification; character values must not exceed %lx.Invalid escape sequence %s in input delimiter specification; trailing characters %s not recognised.Invalid input delimiter specification %s: the delimiter must be either a single character or an escape sequence starting with \.Invalid optimisation level %sJames YoungmanKevin DalleyLocate database size: %s byte
Locate database size: %s bytes
Matching Filenames: %s
Old-format locate database %s is too short to be validOnly one instance of {} is supported with -exec%s ... +Optimisation level %lu is too high.  If you want to find files very quickly, consider using GNU locate.Please specify a decimal number immediately after -OReport (and track progress on fixing) bugs via the findutils bug-reporting
page at http://savannah.gnu.org/ or, if you have no web access, by sending
email to <bug-findutils@gnu.org>.Security level %s has unexpected suffix %s.Security level %s is outside the convertible range.Some filenames may have been filtered out, so we cannot compute the compression ratio.
Symbolic link %s is part of a loop in the directory hierarchy; we have already visited the directory to which it points.The %s test needs an argumentThe -O option must be immediately followed by a decimal integerThe -show-control-chars option takes a single argument which must be 'literal' or 'safe'The argument for option --max-database-age must not be emptyThe argument to -user should not be emptyThe database has big-endian machine-word encoding.
The database has little-endian machine-word encoding.
The database machine-word encoding order is not obvious.
The environment is too large for exec().The environment variable FIND_BLOCK_SIZE is not supported, the only thing that affects the block size is the POSIXLY_CORRECT environment variableThe relative path %s is included in the PATH environment variable, which is insecure in combination with the %s action of find.  Please remove that entry from $PATHThis system does not provide a way to find the birth time of a file.Unexpected suffix %s on %sUnknown argument to -type: %cUnknown regular expression type %s; valid types are %s.Usage: %s [--version | --help]
or     %s most_common_bigrams < file-list > locate-database
Usage: %s [-0 | --null] [--version] [--help]
Usage: %s [-H] [-L] [-P] [-Olevel] [-D Usage: %s [-d path | --database=path] [-e | -E | --[non-]existing]
      [-i | --ignore-case] [-w | --wholename] [-b | --basename] 
      [--limit=N | -l N] [-S | --statistics] [-0 | --null] [-c | --count]
      [-P | -H | --nofollow] [-L | --follow] [-m | --mmap] [-s | --stdio]
      [-A | --all] [-p | --print] [-r | --regex] [--regextype=TYPE]
      [--max-database-age D] [--version] [--help]
      pattern...
WARNING: a NUL character occurred in the input.  It cannot be passed through in the argument list.  Did you mean to use the --null option?WARNING: cannot determine birth time of file %sWARNING: file %s appears to have mode 0000WARNING: file system %s has recently been mounted.WARNING: file system %s has recently been unmounted.WARNING: locate database %s was built with a different byte orderWarning: %s will be run at least once.  If you do not want that to happen, then press the interrupt keystroke.
You may not use {} within the utility name for -execdir and -okdir, because this is a potential security problem.You need to specify a security level as a decimal integer.You specified the -E option, but that option cannot be used with slocate-format databases with a non-zero security level.  No results will be generated for this database.
] [path...] [expression]
argument line too longargument list too longargument to -group is empty, but should be a group namecan't call exec() due to argument size restrictionscannot delete %scannot forkcannot search %scannot stat current directorycommand too longcould not create pipe before forkdaysdoubleenvironment is too large for execerror reading a word from %serror waiting for %serror waiting for child processerror: %s at end of format stringerror: the format directive `%%%c' is reserved for future useexpected an expression after '%s'expected an expression between '%s' and ')'failed to drop group privilegesfailed to drop setgid privilegesfailed to drop setuid privilegesfailed to open /dev/tty for readingfailed to restore working directory after searching %sfailed to return to parent directorygetfilecon failed: %sinvalid -size type `%c'invalid argument `%s' to `%s'invalid expressioninvalid expression; I was expecting to find a ')' somewhere but did not see one.invalid expression; empty parentheses are not allowed.invalid expression; expected to find a ')' but didn't see one.  Perhaps you need an extra predicate after '%s'invalid expression; you have too many ')'invalid expression; you have used a binary operator '%s' with nothing before it.invalid mode %sinvalid null argument to -sizeinvalid predicate -context: SELinux is not enabled.invalid predicate `%s'locate database %s contains a filename longer than locate can handlelocate database %s is corrupt or invalidlocate database %s looks like an slocate database but it seems to have security level %c, which GNU findutils does not currently supportmissing argument to `%s'oops -- invalid default insertion of and!oops -- invalid expression type (%d)!oops -- invalid expression type!operators (decreasing precedence; -and is implicit where no others are given):
      ( EXPR )   ! EXPR   -not EXPR   EXPR1 -a EXPR2   EXPR1 -and EXPR2
      EXPR1 -o EXPR2   EXPR1 -or EXPR2   EXPR1 , EXPR2
paths must precede expression: %spositional options (always true): -daystart -follow -regextype

normal options (always true, specified before other expressions):
      -depth --help -maxdepth LEVELS -mindepth LEVELS -mount -noleaf
      --version -xdev -ignore_readdir_race -noignore_readdir_race
sanity check of the fnmatch() library function failed.singleslocate security level %ld is unsupported.standard errorstandard outputtests (N can be +N or -N or N): -amin N -anewer FILE -atime N -cmin N
      -cnewer FILE -ctime N -empty -false -fstype TYPE -gid N -group NAME
      -ilname PATTERN -iname PATTERN -inum N -iwholename PATTERN -iregex PATTERN
      -links N -lname PATTERN -mmin N -mtime N -name PATTERN -newer FILEtime system call failedunexpected EOF in %sunexpected extra predicateunexpected extra predicate '%s'unknownunknown predicate `%s'unmatched %s quote; by default quotes are special to xargs unless you use the -0 optionwarning: -%s %s will not match anything because it ends with /.warning: Unix filenames usually don't contain slashes (though pathnames do).  That means that '%s %s' will probably evaluate to false all the time on this system.  You might find the '-wholename' test more useful, or perhaps '-samefile'.  Alternatively, if you are using GNU grep, you could use 'find ... -print0 | grep -FzZ %s'.warning: database %s is more than %d %s old (actual age is %.1f %s)warning: not following the symbolic link %swarning: the -d option is deprecated; please use -depth instead, because the latter is a POSIX-compliant feature.warning: the locate database can only be read from stdin once.warning: unrecognized escape `\%c'warning: unrecognized format directive `%%%c'warning: value %ld for -s option is too large, using %ld insteadwarning: you have specified a mode pattern %s (which is equivalent to /000). The meaning of -perm /000 has now been changed to be consistent with -perm -000; that is, while it used to match no files, it now matches all files.write erroryou have too many ')'Project-Id-Version: findutils 4.5.7
Report-Msgid-Bugs-To: bug-findutils@gnu.org
POT-Creation-Date: 2015-12-28 21:37+0000
PO-Revision-Date: 2012-02-24 12:27+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n!=1);

A execución de xargs continuará agora, e tentará ler a súa entrada e executar ordes; se non quere que isto aconteza, prema «end-of-file».

Informe de erros a <bug-findutils@gnu.org>

accións: -delete -print0 -printf FORMATO -fprintf FICHEIRO FORMATO -print 
      -fprint0 FICHEIRO -fprint FICHEIRO -ls -fls FICHEIRO -prune -quit
      -exec ORDE ; -exec ORDE {} + -ok ORDE ;
      -execdir ORDE ; -execdir ORDE {} + -okdir ORDE ;

a ruta por omisión está no directorio actual; a expresión por omisión
é a expresión -print que pode consistir en: operadores, opcións, tests e
accións:
      -context CONTEXTO
%s é unha base de datos de slocate dun nivel de seguranza %d non admitido; omitíndoa.%s é unha base de datos de slocate.  A compatibilidade para estas é moi nova, pode ver algún erro por agora.%s é unha base de datos slocate.  Activando a opción «-e».%s non é o nome dun usuario coñecido%s non é o nome dun grupo existente%s non é un nome dun grupo existente e non semella un ID de grupo numérico xa que ten un sufixo non agardado %s%s terminado por sinal %d%s%s cambiou durante a execución de %s (número de dispositivo antigo %ld, número de dispositivo novo %ld, o tipo de sistema de ficheiros é %s) [ref %ld]%s: saíu co estado 255; abortando%s: número non válido para a opción -%c
%s: parado polo sinal %d%s: terminado polo sinal %d%s: o valor para a opción -%c debería ser >= %ld
< %s ... %s > ? Todos os nomes de ficheiro: %s
Os argumentos para -type non deben conter só unha letraNon é posíbel pechar a saída estándarNon é posíbel obter a hora de nacemento do ficheiro %sNon é posíbel abrir o ficheiro de entrada %sNon é posíbel ler a lista de dispositivos montados.Non é pośibel ler a lista de sistema de ficheiros montadosTaxa de compresión %4.2f%% (máis grande mellor)
Taxa de compresión non definida
A base de datos %s están no formato %s.
Argumento baleiro para a opción -D.A variábel de contorno %s non está estabelecida a un número decimal válidoEric B. DeckerAgardábase un argumento enteiro decimal positivo para %s, pero obtívose %sAgardábase un enteiro: %sproduciuse un fallo ao eliminar os privilexios por completoProduciuse un fallo ao cambiar de directorio de forma segura en %sProduciuse un fallo ao escribir na entrada estándarCaracterísticas activadas:Detectouse un bucle no sistema de ficheiros; %s é parte do mesmo sistema de ficheiros como %s.Detectouse un bucle no sistema de ficheiros; %s ten o mesmo número de dispositivo e nodo-i como un directorio que está %d nivel por enriba na xerarquía do sistema de ficheirosDetectouse un bucle no sistema de ficheiros; %s ten o mesmo número de dispositivo e nodo-i como un directorio que está %d niveis por enriba na xerarquía do sistema de ficheirosNon é posíbel adiviñar como interpretar %s como unha data ou horaIgnorando o parámetro de depuración non recoñecido %sArgumento %s non válido para a opción --max-database-ageArgumento %s non válido para -usedSecuencia de escape %s na especificación do delimitador de entrada.Secuencia de escape %s na especificación do delimitador de entrada os valores de caracteres non deben exceder %lo.Secuencia de escape %s na especificación do delimitador de entrada; os valores de caracteres non deben esceder %lx.Secuencia de escape %s na especificación do delimitador de entrada; os caracteres finais %s non se recoñecen.Especificación de delimitador de entrada %s non vaĺida: o delimitador debe ser ou un só caractér ou unha secuencia de escape que comece por \.Nivel %s de optimización non válidoJames YoungmanKevin DalleyTamaño de base de datos de locate: %s byte
Tamaño de base de datos de locate: %s bytes
Nomes de ficheiro coincidentes: %s
Base de datos de locate %s de formato antigo é demasiado antiga para ser válidaSó se admite unha instancia de {} con -exec%s ... +O nivel de optimización %lu é demasiado alto.  Se quere atopar ficheiros moi rápido, considere usar GNU locate.Especifique un número decimal inmediatamente despois de -OInforme (e siga o proceso de arranxo) de erros na páxina de informe de erros
de findutils en http://savannah.gnu.org/ ou, se non ten acceso a internet,
enviando un correo electrónico a <bug-findutils@gnu.org>O nivel de seguranza %s ten un sufixo %s non agardado.O nivel de seguranza %s está for rango convertíbel.Algúns nomes de ficheiro foron filtrados, polo que non pode computar a taxa de compresión.
A ligazóns simbólica %s é poarte dun bucle na xerarquía de directorios, xa visitamos o direcorio ao que apunta.A proba %s necesita un argumentoA opcións -O debe estar seguida inmediatamente por un enteiro decimalA opción -show-control-chars toma un único argumento que debe ser «literal» ou «safe»O argumento para a opción --max-database-age non debe estar baleiroO argumento para -user non debe estar baleiroA base de datos ten unha codificación de palabra-de-máquina big-endian.
A base de datos ten unha codificación de palabra-de-máquina little-endian.
A base de datos ten unha codificación de palabra-de-máquina non é obvia.
O contorno é demasiado grande para exec().A variábel de contorno FIND_BLOCK_SIZE non se admite, a única cousa que afecta o tamaño de bloque é a variábel de contorno POSIXLY_CORRECTA ruta relativa %s está incluida na variábel de contorno PATH, que non é segura en combinación coa acción %s de find. Elimine dita entradad e $PATHEste sistema non fornece unha forma de atopar a hora de nacemento dun ficheiro.Sufixo %s non agardado en %sArgumento descoñecido a -type: %cTipo de expresión regular %s; os tipos válidos son %s.Uso: %s [--version | --help]
ou     %s most_common_bigrams < file-list > base-de-datos-de-locate
Uso: %s [-0 | --null] [--version] [--help]
Uso: %s [-H] [-L] [-P] [-Onivel] [-D Uso:  %s [-d ruta | --database=ruta] [-e | -E | --[non-]existing]
      [-i | --ignore-case] [-w | --wholename] [-b | --basename] 
      [--limit=N | -l N] [-S | --statistics] [-0 | --null] [-c | --count]
      [-P | -H | --nofollow] [-L | --follow] [-m | --mmap] [-s | --stdio]
      [-A | --all] [-p | --print] [-r | --regex] [--regextype=TYPE]
      [--max-database-age D] [--version] [--help]
      patrón...
AVISO: hai un caracter NUL na entrada.  Non pode pasarse mediante unha lista de argumentos.  Desexa usar a opcións --null?AVISO: non é posíbel determinar a hora de nacemento do ficheiro %sAVISO: o ficheiro %s semella ter o modo 0000AVISO: o sistema de ficheiros %s foi montado recentemente.AVISO: o sistema de ficheiros %s foi desmontado recentemente.AVISO: a base de datos %s de locale foi construido con unha orde de byte diferenteAviso: %s execuratase cando menos unha vez.  Se non quere que isto se produza, prema a combinación de interrupción.
Non debe usar {} nunha utilidade de nome para -execdir e -okdir, xa que é un potencial problema de seguranza.Debe especificar un nivel de seguranza como un número decimal.Especificou a opción -E, pero dita opción non pode usarse coa base de datos de formato slocate con un nivel de seguranza non cero.  Non se xerarán resultados para esta base de datos.
] [ruta...] [expresión]
liña de argumento demasaido longalista de argumentos demasiado longao argumento de -group está baleiro, debe ser un nome de gruponon é posíbel chamar a exec() debido ás restricións de tamaño de argumentonon é posíbel eliminar %snon se pode facer forknon é posíbel buscar %snon é posíbel facer «stat» no directorio actualorde demasiado longanon é posíbel crear unha canalización despois de forkdíasdobreo ambiente  grande de mis para execproduciuse un erro ao ler a palabra desde %serro agardando a %serro agardando polo proceso filloerro: %s ao final dunha cadea de formatoerro: a directiva de formato «%%%c» está reservada para un uso futuroagardábase unha expresión despois de «%s»agardábase unha expresión entre «%s» e «)»produciuse un fallo ao eliminar os privilexios de grupoproduciuse un fallo ao eliminar os privilexios de setgidproduciuse un fallo ao eliminar os privilexios de setuidproduciuse un fallo ao abrir /dev/tty para a súa lecturaproduciuse un fallo ao restaurar o directorio de traballo despois de buscar %sproduciuse un fallo ao volver ao directorio paigetfilecon fallou: %stipo -size non válido «%c»argumento `%s' de `%s' non vlidoexpresión non válidaexpresión non válida; agardaba atopar un «)» nalgún lugar pero non vexo ningún.expresión non válida; os parénteses baleiros non están permitidos.expresión non válida; agardaba atopar un «)» pero non vexo ningún. Quizais precise un predicado adicional despois de «%s»expresión non válida; ten demasiados «)»expresión non válida; usou un operador binario «%s» con nada antes.modo %s non válidoargumento nuloo non válido para -sizepredicado non válido -context: SELinux non está activado.predicado `%s' non vlidoA base de datos %s de locate contén un nome de ficheiro máis grande do que locate pode xestionarA base de datos %s de locate está corrompida ou non válidaA base de datos de locate %s semella unha base de datos de slocate pero semella ter un nivel de seguranza %c, que GNU findutils non admite actualmentenon atopado argumento de `%s'recoiro -- inserción por omisión de «and» non válida!recoiro -- tipo de expresión non válida (%d)!recoiro -- tipo de expresión non válida!operators (reducindo a precedencia; -and é implícita onde non se fornece outra):
      ( EXPR )   ! EXPR   -not EXPR   EXPR1 -a EXPR2   EXPR1 -and EXPR2
      EXPR1 -o EXPR2   EXPR1 -or EXPR2   EXPR1 , EXPR2
as rutas deben preceder ás expresións: %sopcións posicionais (sempre true): -daystart -follow -regextype

opcións normais (sempre true, especificado antes de calquera outra expresión):
      -depth --help -maxdepth NIVEIS -mindepth NIVEIS -mount -noleaf
      --version -xdev -ignore_readdir_race -noignore_readdir_race
fallou a comprobación de sanidade da función da biblioteca fnmatch().simpleNivel de seguranza %ld de slocate non admitido.erro estándarsaída estándartests (N pode ser +N ou -N or N): -amin N -anewer FICHEIRO -atime N -cmin N
      -cnewer FICHEIRO -ctime N -empty -false -fstype TIPO -gid N -group NOME
      -ilname PATRÓN -iname PATRÓN -inum N -iwholename PATRÓN -iregex PATRÓN
      -links N -lname PATRÓN -mmin N -mtime N -name PATRÓN -newer FICHEIROproduciuse un fallo na chamada do sistema «time»EOF non agardado en %spredicado adicional non agardadopredicado adicional non agardado «%s»descoecidopredicado «%s» descoñecidocomiña %s non emparellada; por omisión as comiñas son especiais para xargs a menos que use a opción -0.aviso: -%s %s non coincidirá con nada xa que remata con /.aviso: os nomes de ficheiro de Unix normalmente non conteñen barras (con nomes de ruta si). Isto significa que «%s %s» probabelmente avaliarase a false todo o tempo no seu sistema. Pode atopar «-wholename» máis útil, ou nese caso «-samefile». De forma alternativa, se está usando GNU grup, pode usar «find ... -print0| grep -FzZ %s»aviso: a base de datos %s é máis antiga que %d %s (a idade actual é %.1f %s)aviso: non se sigue a ligazóns simbólica %saviso: a opción -d está obsoleta; use -depth non seu lugar, xa que a última é unha característica de compatibilidade con POSIX.aviso: a base de datos de locate só pode lerse desde stdin unha vez.aviso: secuencia de escape `\%c' descoecidaaviso: directiva de formato `%%%c' descoecidaaviso: o valor %ld para a opción -s é demasiado longo, usando %ld non seu lugar.aviso: debe especificar un patrón de modo %s (que é o equivalente a /000). O significado de -perm /000 cambiou para ser consistente con -perm -000; isto é, foi usado para coincidir con non ficheiros, agora coincide con todos os ficheiros.erro de escrituraten demasiados «)»PRIuMAX%s%s changed during execution of %s (old inode number %, new inode number %, file system type is %s) [ref %ld]Your environment variables take up % bytes
Maximum length of command we could actually use: %
Size of command buffer we are actually using: %
%s%s cambiou durante a execución de %s (antigo número de nodo-i %, novo número de nodo-i %, o tipo do sistema de ficheiros é %s) [ref %ld]As súas variábeis de contorno ocupan % bytes
Lonxitude máxida para a orde que podemos usar actualmente: %
O tamaño do bufer de orde está usando actualmente: %
PK�m�\r��*�*LC_MESSAGES/diffutils.monu�[�����r��<�	��	|
�
0�
�
0�
'9(U~��(�(��!!4Vv�F�=�&
>
]
?u
�
�
�
$BT	oy�������#>Je|��?GSex���"�4�.3b;y3�/�+'E#m�����)�)F ]~�	�n� -NSh1z2�0�)1:-l�
�"�%�
/	<F[bq���
����
������#�(�9�2$W!i-�!���7�/-I w&�$���^R_:�$�$@7#x&�#�$�(5O	mw��)�(��
 ! : %F l #x "� � �� �!�!�!�!*�!�!	"!"!4"-V"�"3�"�"8�"0'#-X#)�#$�# �#�#$.$?$B$8_$9�$�$(�$.%J%
j%�u%0'5':'R'6p'7�'/�'5(HE(=�(�(�(&�(/)H)Y)j)�)	�)�)�)�)�)�)**&*,:*g*�*�*�*@U_;C\nHZS[P8/-f^2A"WlY
.)3!?	X1>9
$ki*G5jmp+#]r<I7aBN`O 6ETFDQ:&'4cV=JL%eo,qh(RgMdb0K
License GPLv3+: GNU GPL version 3 or later <http://gnu.org/licenses/gpl.html>.
This is free software: you are free to change and redistribute it.
There is NO WARRANTY, to the extent permitted by law.


Report bugs to: %s
%s %s differ: byte %s, line %s
%s %s differ: byte %s, line %s is %3o %s %3o %s
%s home page: <%s>
%s home page: <http://www.gnu.org/software/%s/>
%s: diff failed: %s: invalid option -- '%c'
%s: option requires an argument -- '%c'
%s: recursive directory loop'(C)--from-file and --to-file both specified-D option not supported with directoriesBinary files %s and %s differ
Common subdirectories: %s and %s
Compare three files line by line.Compare two files byte by byte.David HayesDavid MacKenzieExit status is 0 if inputs are the same, 1 if different, 2 if trouble.Exit status is 0 if successful, 1 if conflicts, 2 if trouble.File %s is a %s while file %s is a %s
Files %s and %s are identical
Files %s and %s differ
General help using GNU software: <http://www.gnu.org/gethelp/>
Invalid back referenceInvalid character class nameInvalid collation characterInvalid content of \{\}Invalid preceding regular expressionInvalid range endInvalid regular expressionLen TowerMemory exhaustedMike HaertelNo matchNo newline at end of fileNo previous regular expressionOnly in %s: %s
Packaged by %s
Packaged by %s (%s)
Paul EggertPremature end of regular expressionRandy SmithRegular expression too bigReport %s bugs to: %s
Richard StallmanSKIP values may be followed by the following multiplicative suffixes:
kB 1000, K 1024, MB 1,000,000, M 1,048,576,
GB 1,000,000,000, G 1,073,741,824, and so on for T, P, E, Z, Y.SuccessThomas LordTorbjorn GranlundTrailing backslashUnknown system errorUnmatched ( or \(Unmatched ) or \)Unmatched \{Usage: %s [OPTION]... FILE1 FILE2
Usage: %s [OPTION]... FILE1 [FILE2 [SKIP1 [SKIP2]]]
Usage: %s [OPTION]... FILES
Usage: %s [OPTION]... MYFILE OLDFILE YOURFILE
Written by %s and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, %s, and others.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
and %s.
Written by %s, %s, %s,
%s, %s, %s, and %s.
Written by %s, %s, %s,
%s, %s, and %s.
Written by %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
and %s.
Written by %s, %s, and %s.
Written by %s.
`block special fileboth files to be compared are directoriescannot interactively merge standard inputcharacter special fileconflicting output style optionsconflicting tabsize optionsconflicting width optionsdirectoryed:	Edit then use both versions, each decorated with a header.
eb:	Edit then use both versions.
el or e1:	Edit then use the left version.
er or e2:	Edit then use the right version.
e:	Discard both versions then edit a new one.
l or 1:	Use the left version.
r or 2:	Use the right version.
s:	Silently include common lines.
v:	Verbosely include common lines.
q:	Quit.
failed to reopen %s with mode %sfifoincompatible optionsinput file shrankinternal error: invalid diff type in process_diffinternal error: invalid diff type passed to outputinternal error: screwup in format of diff blocksinvalid diff format; incomplete last lineinvalid diff format; incorrect leading line charsinvalid diff format; invalid change separatormemory exhaustedmessage queueoptions -l and -s are incompatiblepagination not supported on this hostprogram errorread failedregular empty fileregular filesemaphoreshared memory objectsocketstack overflowstandard outputstderrstdinstdoutsymbolic linktoo many file label optionstyped memory objectunknown streamweird filewrite failedProject-Id-Version: GNU diffutils 3.2
Report-Msgid-Bugs-To: bug-diffutils@gnu.org
POT-Creation-Date: 2017-05-21 13:26-0700
PO-Revision-Date: 2011-10-17 12:43+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.

Licenza GPLv3+: GNU GPL versión 3 ou posterior <http://gnu.org/licenses/gpl.html>.
Isto é software libre: vostede é libre para modificalo e redistribuílo.
NON HAI GARANTÍA, ata o punto permitido pola lei.


Envíe os informes de erros a: %s
%s %s son diferentes: byte %s, liña %s
%s %s son diferentes: byte %s, liña %s é %3o %s %3o %s
%s páxina web: <%s>
%s páxina web: <http://www.gnu.org/software/%s/>
%s: diff fallou: %s: opción incorrecta -- «%c»
%s: a opción require un argumento -- «%c»
%s: bucle de directorio recursivo»©Especificáronse --from-file e --to-file ao mesmo tempoA opción -D non está admitida con directoriosOs ficheiros binarios %s e %s son diferentes
Subdirectorios comúns: %s e %s
Comparar tres ficheiros liña a liña.Comparar dous ficheiros byte a byte.David HayesDavid MacKenzieO estado de saída é 0 se as entradas son iguais, 1 se son diferentes, 2 en caso de problema.O estado de saída é 0 se é correcto, 1 se hai conflitos, 2 en caso de problema.O ficheiro %s é un %s mentres que o ficheiro %s é un %s
Os ficheiros %s e %s son idénticos
Os ficheiros %s e %s son diferentes
Axuda xeral ao usar software GNU: <http://www.gnu.org/gethelp/>
Referencia cara a atrás incorrectaNome da clase de caracteres incorrectoCarácter de ordenamento incorrectoO contido entre \{\} non é correctoExpresión regular precedente incorrectaFinal do rango incorrectoExpresión regular incorrectaLen TowerMemoria esgotadaMike HaertelNon hai coincidenciasNon hai un salto de liña na fin da liñaNon hai unha expresión regular anteriorSó en %s: %s
Empaquetado por %s
Empaquetado por %s (%s)
Paul EggertFinal prematura da expresión regularRandy SmithExpresión regular demasiado grandeEnvíe %s informes de erros a: %s
Richard StallmanOs valores N poden estar seguidos polos seguintes sufixos multiplicativos:
kB 1000, K 1024, MB 1.000.000, M 1.048.576,
GB 1.000.000.000, G 1.073.741.824, e así para T, P, E, Z e Y.CorrectoThomas LordTorbjorn GranlundBarra invertida ao finalProduciuse un erro descoñecido do sistema( ou \( non emparellado) ou \) non emparellado\{ non emparelladoUso: %s [OPCIÓN]... FICH1 FICH2
Uso: %s [OPCIÓN]... FICH1 [FICH2 [N1 [N2]]]
Uso: %s [OPCIÓN]... FICHEIROS
Uso: %s [OPCIÓN]... MEU-FICH ANTIGO-FICH TEU-FICH
Escrito por %s e %s.
Escrito por %s, %s, %s
%s, %s, %s, %s,
%s, %s e outros.
Escrito por %s, %s, %s
%s, %s, %s, %s,
%s e %s.
Escrito por %s, %s, %s
%s, %s, %s, %s,
e %s.
Escrito por %s, %s, %s
%s, %s, %s, e %s.
Escrito por %s, %s, %s
%s, %s e %s.
Escrito por %s, %s, %s
%s e %s.
Escrito por %s, %s, %s
e %s.
Escrito por %s, %s e %s.
Escrito por %s.
«ficheiro especial de bloquesámbolos dous ficheiros a ser comparados son directoriosnon se pode mesturar a entrada estándar interactivamenteficheiro especial de caracteresopcións de estilo da saída conflitivasopcións de tamaño de tabulación conflitivasopcións de largura conflitivasdirectorioed:	Edita e usa ambas versións, cada unha decorada cunha cabeceira.
eb:	Edita e usa ambas versións.
el ou e1:	Edita e usa a versión esquerda.
er ou e2:	Edita e usa a versión dereita.
e:	Edita unha nova versión.
l ou 1:	Usa a versión esquerda.
r ou 2:	Usa a versión dereita.
s:       Inclúe liñas comúns silenciosamente.
v:       Inclúe liñas comúns de xeito detallado.
q:       Saír.
produciuse un erro ao volver abrir %s en modo %sfifoopcións incompatíbeiso ficheiro de entrada minguouerro interno: tipo de diff non válido en process_differro interno_ tipo de diff non válido pasado á saídaerro interno: fallo no formato dos bloques diffformato de diff non válido: última liña incompletaformato de diff non válido: caracteres a principio de liña incorrectosformato de diff non válido; separador de cambios non válidoesgotouse a memoriacola de mensaxesas opcións -l e -s son incompatíbeisa paxinación non está admitida nesta máquinaerro do programafallou a lecturaficheiro regular baleiroficheiro regularsemáforoobxecto de memoria compartidasocketdesbordamento da pilasaída estándarsaída estándar de erroentrada estándarsaída estándarligazón simbólicademasiadas opcións de etiquetas de ficheiroobxecto de memoria con tipofluxo descoñecidoficheiro estrañofallou a escrituraPK�m�\I�R�����LC_MESSAGES/bash.monu�[����������'*�'�'$�'
$(/(>(E(d(y(�(�(	�(�(�(�()'):)X) h)�)�)�)�)/�);*$D*:i*�*�*(�*"�*+3+P+3n+ �+&�+&�+/,/A,q,�,.�,�,�,--7-U-"i-�-�-�-�-/�-.+.A.-T.�.�.�.�.�.�./)/!B/d/)�/�/�/�/�/00 :0![0}0 �0�0
�0�0�01%151H1_1w1�1�1
�1�1�1&282V2l2�2&�23�2�2	3%3:3F3W3
f3t39�3#�3�344H4g7w7�7F�7�8�8�89	9	9&9:9LC9��:?:;z>>�>��>��?�*@"A�&B�CuDw�E�F|G�~G�UH
�H�HII8I�KIJ.JGJ bJ�J�J�J	�J�J�J	�J�JN�J,9KffL�L�LP�L2M�>M7PF;QF�Q��QS�S�S�S?�SD?V�V	�V�V�V�V�V�VO�V*<X
gXrX�X�XO�XBZEUZ�Z�Z
�Z�Z�ZX�ZI[*g[
�[
�[�[�[�[
�[�[\\%6\$\\'�\�\�\�\�\!]1]N]j]w]'�]0�].�]^95^o^x^�^$�^�^�^
�^_&_'2_9Z_�_	�_�_!�_
�_3�_-`=L`-�`�`'�`&a*'a*Ra)}a)�a%�a%�a b1>b#pb1�b&�b5�b#c2c!Oc!qc:�c�c �c1
d�<d#�d'e$.eSe$`e#�e'�e�e.�ef'f=fSf
jfxf�f�f�f,�f%g,-g%Zg�g@�g�g�g�g,�g(h#<h@`h
�h�h�h-�h,i'Bi.ji,�i&�i0�i6jPUj(�j�j)�jk'k?AkT�k�k�k
�k8lVDl&�l'�l�l
m"m(/mXmkmzm�m"�m�m5�mOn[nmnn	�n�n�n�n
�n
�n+�n9o;Lo$�o�o�o�o�opp 9pZpup�pH�p�p�pqq"1q+Tq�q�q4�q
�qD�q?.r,nr�r�r!�r"�r"s.s@s	[soes�s[�s1Dt/vt)�t3�tu&u2Eu5xu,�u
�u
�u1�uI#v4mv.�v8�v(
w,3w,`w0�w)�w	�w�w �w"xBx^xxx�x&�x=�x�xy')yQyhy,�y)�y�y$�y z6zBzUz"hz�z�z�z�z%�z.{-N{7|{6�{2�{1|*P|,{|,�|;�|#}5}=}!S}u}6�}*�}"�}~63~	j~t~-�~-�~!�~'':b���7�J�&^�������*��߁)�� #�D�	Z�d�!y�"����ւ(��')�Q�X�n�+��@��F��,?�Bl�(��؄8��,0�]�#x�%��;…-��;,�=h�?��?�&�!E�>g�/��!և'��+ �1L�~�2��Ј�0�5�0N��"����?׉"�$:�_�{���'��Ί�,�";�8^�$����܋��(,�(U�7~���*ˌ��
��)7�a�������#Ս#���!=�_�%q�"��)��'��(�E�.U�>��Ï"��	�(�9�L�]�5u�+��א����̓ޓ�M��J�^�z�
������&��	ٕk��O�C�L�	R�\��l��h���'���
������	c��m�����u�����¦ަ��ԧ ��%3�Y�q�x�
��������ͨVԨN+�fz����U�W��m�T�Rq�Mį��M�
T�b��y�S�`�t�}�������
е�۵2o�����ķ�n��Ok�O��� �7�I�]�\v� Ӻ+� �3�F�V�i�
������&��.ܻ-�59�$o���0��"�>�%G�#m�����-��4�0!�R�Cq�	����3ؾ1�>�^�t���8��7οW�^�	s�4}�&���H�&6�[]�@��$��9�6Y�C��F��=�?Y�8��:��1
�@?�8��F��@�DA���-��)��(��:!�\�v�A�����(��(��+����#�-/�/]���5��%��#���3�J�(\�����#��0��,�61�0h���>�������,�D�-`�D����$��+	�*5�,`�6��;��2�;3�Go�0��]��3F�"z�%������T��[J�������H��F/�'v�,�� ����	�-�H�h�|���-����5��Y$�~�����
��!������
��
�3�CO�J��*��	�)�H�U�#d� ��0��"�����d;���'������*�0?�&p�
��7����M��LA�5������%��$�"?�b�x�	��o��
�Z%�1��5��>��J'�+r�3��5��:�1C�u�
��6��R��G�.^�9��A��E	�DO�I��;��	�$�%3�'Y��� ������+��D�L�j�2����#��8��14�(f�4����������;�[�y���&��5��8
�=C�<��8��7��*/�,Z�,��E��)��$�1�K�"g�@��1��,��(*�;S���
��?��?��%�A�(W�1��$�����g�^?6�)	Ns�� ��52��������c�o���c,1����w#����`r���*9b��h����HKe�vol�
N4��4+-�{SwPZ<�m���(�iI���a]����LT�[�+���]hF�tP@6
z�k)�r|=�|��\Xd	��XA��O;�u��/��E��y���1�@���m��W�V ���.��j8���M0�W���'�S3���"�i��kbG�~��Y�`:g2��������-�"n�7����ft�E��q�u�����p&_��~?�fMa�%���(�����C����e�5��Q�_
��y$>�l=��G}�d��\pIO#}�/H�[�Yz�v�D��J�s����!��'��K98*C��!�;:�Q�R�xJ�>A�7j�q$���V��,����BnZU
�D���������F.�B�<%x��U�{0�&�T��3�R��^L����timed out waiting for input: auto-logout
	-%s or -o option

malloc: %s:%d: assertion botched
  (wd: %s) (core dumped) line $%s: cannot assign in this way%c%c: invalid option%d: invalid file descriptor: %s%s can be invoked via %s has null exportstr%s is %s
%s is a function
%s is a shell builtin
%s is a shell keyword
%s is aliased to `%s'
%s is hashed (%s)
%s is not bound to any keys.
%s out of range%s%s%s: %s (error token is "%s")%s: %s%s: %s out of range%s: %s: bad interpreter%s: %s: cannot open as FILE%s: %s: invalid value for trace file descriptor%s: %s: must use subscript when assigning associative array%s: %s:%d: cannot allocate %lu bytes%s: %s:%d: cannot allocate %lu bytes (%lu bytes allocated)%s: ambiguous job spec%s: ambiguous redirect%s: arguments must be process or job IDs%s: bad network path specification%s: bad substitution%s: binary operator expected%s: cannot allocate %lu bytes%s: cannot allocate %lu bytes (%lu bytes allocated)%s: cannot assign fd to variable%s: cannot assign list to array member%s: cannot assign to non-numeric index%s: cannot convert associative to indexed array%s: cannot convert indexed to associative array%s: cannot create: %s%s: cannot delete: %s%s: cannot destroy array variables in this way%s: cannot execute binary file%s: cannot execute: %s%s: cannot get limit: %s%s: cannot modify limit: %s%s: cannot open temp file: %s%s: cannot open: %s%s: cannot overwrite existing file%s: cannot read: %s%s: cannot unset%s: cannot unset: readonly %s%s: command not found%s: error retrieving current directory: %s: %s
%s: expression error
%s: file is too large%s: file not found%s: first non-whitespace character is not `"'%s: hash table empty
%s: history expansion failed%s: host unknown%s: illegal option -- %c
%s: inlib failed%s: integer expression expected%s: invalid action name%s: invalid array origin%s: invalid associative array key%s: invalid callback quantum%s: invalid file descriptor specification%s: invalid limit argument%s: invalid line count%s: invalid option%s: invalid option name%s: invalid service%s: invalid shell option name%s: invalid signal specification%s: invalid timeout specification%s: is a directory%s: job %d already in background%s: job has terminated%s: line %d: %s: missing colon separator%s: no completion specification%s: no job control%s: no such job%s: not a function%s: not a regular file%s: not a shell builtin%s: not an array variable%s: not an indexed array%s: not dynamically loaded%s: not found%s: numeric argument required%s: option requires an argument%s: option requires an argument -- %c
%s: parameter null or not set%s: readonly function%s: readonly variable%s: restricted%s: restricted: cannot redirect output%s: restricted: cannot specify `/' in command names%s: substring expression < 0%s: unary operator expected%s: unbound variable%s: usage: (( expression ))(core dumped) (wd now: %s)
. filename [arguments]/dev/(tcp|udp)/host/port not supported without networking/tmp must be a valid directory name<no current directory>ABORT instructionAborting...Adds a directory to the top of the directory stack, or rotates
    the stack, making the new top of the stack the current working
    directory.  With no arguments, exchanges the top two directories.
    
    Options:
      -n	Suppresses the normal change of directory when adding
    	directories to the stack, so only the stack is manipulated.
    
    Arguments:
      +N	Rotates the stack so that the Nth directory (counting
    	from the left of the list shown by `dirs', starting with
    	zero) is at the top.
    
      -N	Rotates the stack so that the Nth directory (counting
    	from the right of the list shown by `dirs', starting with
    	zero) is at the top.
    
      dir	Adds DIR to the directory stack at the top, making it the
    	new current working directory.
    
    The `dirs' builtin displays the directory stack.Alarm (profile)Alarm (virtual)Alarm clockArithmetic for loop.
    
    Equivalent to
    	(( EXP1 ))
    	while (( EXP2 )); do
    		COMMANDS
    		(( EXP3 ))
    	done
    EXP1, EXP2, and EXP3 are arithmetic expressions.  If any expression is
    omitted, it behaves as if it evaluates to 1.
    
    Exit Status:
    Returns the status of the last command executed.BPT trace/trapBad system callBogus signalBroken pipeBus errorCPU limitChild death or stopContinueDisplay possible completions depending on the options.
    
    Intended to be used from within a shell function generating possible
    completions.  If the optional WORD argument is supplied, matches against
    WORD are generated.
    
    Exit Status:
    Returns success unless an invalid option is supplied or an error occurs.Display process times.
    
    Prints the accumulated user and system times for the shell and all of its
    child processes.
    
    Exit Status:
    Always succeeds.Display the list of currently remembered directories.  Directories
    find their way onto the list with the `pushd' command; you can get
    back up through the list with the `popd' command.
    
    Options:
      -c	clear the directory stack by deleting all of the elements
      -l	do not print tilde-prefixed versions of directories relative
    	to your home directory
      -p	print the directory stack with one entry per line
      -v	print the directory stack with one entry per line prefixed
    	with its position in the stack
    
    Arguments:
      +N	Displays the Nth entry counting from the left of the list shown by
    	dirs when invoked without options, starting with zero.
    
      -N	Displays the Nth entry counting from the right of the list shown by
	dirs when invoked without options, starting with zero.DoneDone(%d)EMT instructionEvaluate arithmetic expression.
    
    The EXPRESSION is evaluated according to the rules for arithmetic
    evaluation.  Equivalent to "let EXPRESSION".
    
    Exit Status:
    Returns 1 if EXPRESSION evaluates to 0; returns 0 otherwise.Evaluate conditional expression.
    
    This is a synonym for the "test" builtin, but the last argument must
    be a literal `]', to match the opening `['.Execute arguments as a shell command.
    
    Combine ARGs into a single string, use the result as input to the shell,
    and execute the resulting commands.
    
    Exit Status:
    Returns exit status of command or success if command is null.Execute commands as long as a test does not succeed.
    
    Expand and execute COMMANDS as long as the final command in the
    `until' COMMANDS has an exit status which is not zero.
    
    Exit Status:
    Returns the status of the last command executed.Execute commands as long as a test succeeds.
    
    Expand and execute COMMANDS as long as the final command in the
    `while' COMMANDS has an exit status of zero.
    
    Exit Status:
    Returns the status of the last command executed.Execute commands based on pattern matching.
    
    Selectively execute COMMANDS based upon WORD matching PATTERN.  The
    `|' is used to separate multiple patterns.
    
    Exit Status:
    Returns the status of the last command executed.Execute commands for each member in a list.
    
    The `for' loop executes a sequence of commands for each member in a
    list of items.  If `in WORDS ...;' is not present, then `in "$@"' is
    assumed.  For each element in WORDS, NAME is set to that element, and
    the COMMANDS are executed.
    
    Exit Status:
    Returns the status of the last command executed.Execute shell builtins.
    
    Execute SHELL-BUILTIN with arguments ARGs without performing command
    lookup.  This is useful when you wish to reimplement a shell builtin
    as a shell function, but need to execute the builtin within the function.
    
    Exit Status:
    Returns the exit status of SHELL-BUILTIN, or false if SHELL-BUILTIN is
    not a shell builtin..Exit %dExit a login shell.
    
    Exits a login shell with exit status N.  Returns an error if not executed
    in a login shell.Exit for, while, or until loops.
    
    Exit a FOR, WHILE or UNTIL loop.  If N is specified, break N enclosing
    loops.
    
    Exit Status:
    The exit status is 0 unless N is not greater than or equal to 1.Exit the shell.
    
    Exits the shell with a status of N.  If N is omitted, the exit status
    is that of the last command executed.File limitFloating point exceptionGNU bash, version %s (%s)
GNU bash, version %s-(%s)
GNU long options:
Group commands as a unit.
    
    Run a set of commands in a group.  This is one way to redirect an
    entire set of commands.
    
    Exit Status:
    Returns the status of the last command executed.HFT input data pendingHFT monitor mode grantedHFT monitor mode retractedHFT sound sequence has completedHOME not setHangupI have no name!I/O readyIllegal instructionInformation requestInterruptKilledLicense GPLv3+: GNU GPL version 3 or later <http://gnu.org/licenses/gpl.html>
Move job to the foreground.
    
    Place the job identified by JOB_SPEC in the foreground, making it the
    current job.  If JOB_SPEC is not present, the shell's notion of the
    current job is used.
    
    Exit Status:
    Status of command placed in foreground, or failure if an error occurs.Null command.
    
    No effect; the command does nothing.
    
    Exit Status:
    Always succeeds.OLDPWD not setQuitRead lines from a file into an array variable.
    
    A synonym for `mapfile'.Record lockRemoves entries from the directory stack.  With no arguments, removes
    the top directory from the stack, and changes to the new top directory.
    
    Options:
      -n	Suppresses the normal change of directory when removing
    	directories from the stack, so only the stack is manipulated.
    
    Arguments:
      +N	Removes the Nth entry counting from the left of the list
    	shown by `dirs', starting with zero.  For example: `popd +0'
    	removes the first directory, `popd +1' the second.
    
      -N	Removes the Nth entry counting from the right of the list
    	shown by `dirs', starting with zero.  For example: `popd -0'
    	removes the last directory, `popd -1' the next to last.
    
    The `dirs' builtin displays the directory stack.Resume for, while, or until loops.
    
    Resumes the next iteration of the enclosing FOR, WHILE or UNTIL loop.
    If N is specified, resumes the Nth enclosing loop.
    
    Exit Status:
    The exit status is 0 unless N is not greater than or equal to 1.Return a successful result.
    
    Exit Status:
    Always succeeds.Return an unsuccessful result.
    
    Exit Status:
    Always fails.Return the context of the current subroutine call.
    
    Without EXPR, returns "$line $filename".  With EXPR, returns
    "$line $subroutine $filename"; this extra information can be used to
    provide a stack trace.
    
    The value of EXPR indicates how many call frames to go back before the
    current one; the top frame is frame 0.
    
    Exit Status:
    Returns 0 unless the shell is not executing a shell function or EXPR
    is invalid.Returns the context of the current subroutine call.
    
    Without EXPR, returns RunningSegmentation faultSet and unset shell options.
    
    Change the setting of each shell option OPTNAME.  Without any option
    arguments, list all shell options with an indication of whether or not each
    is set.
    
    Options:
      -o	restrict OPTNAMEs to those defined for use with `set -o'
      -p	print each shell option with an indication of its status
      -q	suppress output
      -s	enable (set) each OPTNAME
      -u	disable (unset) each OPTNAME
    
    Exit Status:
    Returns success if OPTNAME is enabled; fails if an invalid option is
    given or OPTNAME is disabled.Shell commands matching keyword `Shell commands matching keywords `Shell options:
Signal %dStoppedStopped (signal)Stopped (tty input)Stopped (tty output)Stopped(%s)Suspend shell execution.
    
    Suspend the execution of this shell until it receives a SIGCONT signal.
    Unless forced, login shells cannot be suspended.
    
    Options:
      -f	force the suspend, even if the shell is a login shell
    
    Exit Status:
    Returns success unless job control is not enabled or an error occurs.TIMEFORMAT: `%c': invalid format characterTerminatedThe mail in %s has been read
There are running jobs.
There are stopped jobs.
These shell commands are defined internally.  Type `help' to see this list.
Type `help name' to find out more about the function `name'.
Use `info bash' to find out more about the shell in general.
Use `man -k' or `info' to find out more about commands not in this list.

A star (*) next to a name means that the command is disabled.

Type `%s -c "help set"' for more information about shell options.
Type `%s -c help' for more information about shell builtin commands.
Unknown Signal #Unknown Signal #%dUnknown errorUnknown statusUrgent IO conditionUsage:	%s [GNU long option] [option] ...
	%s [GNU long option] [option] script-file ...
Use "%s" to leave the shell.
Use the `bashbug' command to report bugs.
User signal 1User signal 2Window changedYou have mail in $_You have new mail in $_[ arg... ][[ expression ]]`%c': bad command`%c': invalid format character`%c': invalid symbolic mode character`%c': invalid symbolic mode operator`%c': invalid time format specification`%s': cannot unbind`%s': invalid alias name`%s': invalid keymap name`%s': missing format character`%s': not a pid or valid job spec`%s': not a valid identifier`%s': unknown function name`)' expected`)' expected, found %s`:' expected for conditional expressionadd_process: pid %5ld (%s) marked as still aliveadd_process: process %5ld (%s) in the_pipelinealias [-p] [name[=value] ... ]all_local_variables: no function context at current scopeargumentargument expectedarray variable support requiredattempted assignment to non-variablebad array subscriptbad command typebad connectorbad jumpbad substitution: no closing "`" in %sbad substitution: no closing `%s' in %sbash_execute_unix_command: cannot find keymap for commandbg [job_spec ...]break [n]bug: bad expassign tokenbuiltin [shell-builtin [arg ...]]caller [expr]can only `return' from a function or sourced scriptcan only be used in a functioncannot allocate new file descriptor for bash input from fd %dcannot create temp file for here-document: %scannot duplicate fd %d to fd %dcannot duplicate named pipe %s as fd %dcannot find %s in shared object %s: %scannot make child for command substitutioncannot make child for process substitutioncannot make pipe for command substitutioncannot make pipe for process substitutioncannot open named pipe %s for readingcannot open named pipe %s for writingcannot open shared object %s: %scannot redirect standard input from /dev/null: %scannot reset nodelay mode for fd %dcannot set and unset shell options simultaneouslycannot set terminal process group (%d)cannot simultaneously unset a function and a variablecannot suspendcannot suspend a login shellcannot use `-f' to make functionscannot use more than one of -anrwcase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacchild setpgid (%ld to %ld)command [-pVv] command [arg ...]command_substitute: cannot duplicate pipe as fd 1complete [-abcdefgjksuv] [-pr] [-DE] [-o option] [-A action] [-G globpat] [-W wordlist]  [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [name ...]completion: function `%s' not foundcompopt [-o|+o option] [-DE] [name ...]conditional binary operator expectedcontinue [n]coproc [NAME] command [redirections]could not find /tmp, please create!cprintf: `%c': invalid format charactercurrentdeleting stopped job %d with process group %lddescribe_pid: %ld: no such piddirectory stack emptydirectory stack indexdirs [-clpv] [+N] [-N]division by 0dynamic loading not availableecho [-n] [arg ...]echo [-neE] [arg ...]empty array variable nameenable [-a] [-dnps] [-f filename] [name ...]error getting terminal attributes: %serror importing function definition for `%s'error setting terminal attributes: %seval [arg ...]exec [-cl] [-a name] [command [arguments ...]] [redirection ...]exit [n]expected `)'exponent less than 0export [-fn] [name[=value] ...] or export -pexpression expectedexpression recursion level exceededfc [-e ename] [-lnr] [first] [last] or fc -s [pat=rep] [command]fg [job_spec]file descriptor out of rangefilename argument requiredfor (( exp1; exp2; exp3 )); do COMMANDS; donefor NAME [in WORDS ... ] ; do COMMANDS; doneforked pid %d appears in running job %dfree: called with already freed block argumentfree: called with unallocated block argumentfree: start and end chunk sizes differfree: underflow detected; mh_nbytes out of rangefunction name { COMMANDS ; } or name () { COMMANDS ; }future versions of the shell will force evaluation as an arithmetic substitutiongetcwd: cannot access parent directoriesgetopts optstring name [arg]hash [-lr] [-p pathname] [-dt] [name ...]hashing disabledhelp [-dms] [pattern ...]here-document at line %d delimited by end-of-file (wanted `%s')history [-c] [-d offset] [n] or history -anrw [filename] or history -ps arg [arg...]history positionhistory specificationhits	command
identifier expected after pre-increment or pre-decrementif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiinitialize_job_control: getpgrp failedinitialize_job_control: line disciplineinitialize_job_control: setpgidinvalid arithmetic baseinvalid baseinvalid character %d in exportstr for %sinvalid hex numberinvalid numberinvalid octal numberinvalid signal numberjob %d started without job controljob_spec [&]jobs [-lnprs] [jobspec ...] or jobs -x command [args]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]last command: %s
let arg [arg ...]limitline %d: line editing not enabledlocal [option] name[=value] ...logout
logout [n]loop countmake_here_document: bad instruction type %dmake_local_variable: no function context at current scopemake_redirection: redirection instruction `%d' out of rangemalloc: block on free list clobberedmalloc: failed assertion: %s
migrate process to another CPUmissing `)'missing `]'missing hex digit for \xmissing unicode digit for \%cnetwork operations not supportedno `=' in exportstr for %sno closing `%c' in %sno command foundno help topics match `%s'.  Try `help help' or `man -k %s' or `info %s'.no job controlno job control in this shellno match: %sno other directoryno other options allowed with `-x'not currently executing completion functionnot login shell: use `exit'octal numberonly meaningful in a `for', `while', or `until' looppipe errorpop_scope: head of shell_variables not a temporary environment scopepop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpopd [-n] [+N | -N]power failure imminentprint_command: bad connector `%d'printf [-v var] format [arguments]progcomp_insert: %s: NULL COMPSPECprogramming errorpushd [-n] [+N | -N | dir]pwd [-LP]read [-ers] [-a array] [-d delim] [-i text] [-n nchars] [-N nchars] [-p prompt] [-t timeout] [-u fd] [name ...]read error: %d: %sreadarray [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]readonly [-aAf] [name[=value] ...] or readonly -prealloc: called with unallocated block argumentrealloc: start and end chunk sizes differrealloc: underflow detected; mh_nbytes out of rangerecursion stack underflowredirection error: cannot duplicate fdregister_alloc: %p already in table as allocated?
register_alloc: alloc table is full with FIND_ALLOC?
register_free: %p already in table as free?
restrictedreturn [n]run_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfsave_bash_input: buffer already exists for new fd %dselect NAME [in WORDS ... ;] do COMMANDS; doneset [-abefhkmnptuvxBCHP] [-o option-name] [--] [arg ...]setlocale: %s: cannot change locale (%s)setlocale: %s: cannot change locale (%s): %ssetlocale: LC_ALL: cannot change locale (%s)setlocale: LC_ALL: cannot change locale (%s): %sshell level (%d) too high, resetting to 1shift [n]shift countshopt [-pqsu] [-o] [optname ...]sigprocmask: %d: invalid operationsource filename [arguments]start_pipeline: pgrp pipesuspend [-f]syntax errorsyntax error in conditional expressionsyntax error in conditional expression: unexpected token `%s'syntax error in expressionsyntax error near `%s'syntax error near unexpected token `%s'syntax error: `((%s))'syntax error: `;' unexpectedsyntax error: arithmetic expression requiredsyntax error: invalid arithmetic operatorsyntax error: operand expectedsyntax error: unexpected end of filesystem crash imminenttest [expr]time [-p] pipelinetoo many argumentstrap [-lp] [[arg] signal_spec ...]trap_handler: bad signal %dtype [-afptP] name [name ...]umask [-p] [-S] [mode]unalias [-a] name [name ...]unexpected EOF while looking for `]]'unexpected EOF while looking for matching `%c'unexpected EOF while looking for matching `)'unexpected argument `%s' to conditional binary operatorunexpected argument `%s' to conditional unary operatorunexpected argument to conditional binary operatorunexpected argument to conditional unary operatorunexpected token %d in conditional commandunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token `%s', conditional binary operator expectedunexpected token `%s', expected `)'unknownunknown command erroruntil COMMANDS; do COMMANDS; donevalue too great for basevariables - Names and meanings of some shell variableswait: pid %ld is not a child of this shellwait_for: No record of process %ldwait_for_job: job %d is stoppedwaitchld: turning on WNOHANG to avoid indefinite blockwarning: warning: %s: %swarning: -C option may not work as you expectwarning: -F option may not work as you expectwhile COMMANDS; do COMMANDS; donewrite error: %sxtrace fd (%d) != fileno xtrace fp (%d)xtrace_set: %d: invalid file descriptorxtrace_set: NULL file pointer{ COMMANDS ; }Project-Id-Version: bash 4.2
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2016-09-10 12:42-0400
PO-Revision-Date: 2012-02-23 14:38+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Language: gl
Plural-Forms: nplurals=2; plural=(n!=1);
expirou mentres agardaba algunha entrada: auto-logout
	-%s ou -o opción

malloc: %s:%d: aserción arruinada
  (dir agora: %s) («core» generado) liña $%s: non é posíbel asignar de esta forma%c%c: opción non válida%d: descritor de ficheiro non válido: %s%s pódese invocar a través de %s ten exportstr nulo%s é %s
%s é unha función
%s é unha orde interna do shell
%s é unha palabra chave do shell
%s é un alias de `%s'
%s está asociado (%s)
%s non está asignado a ningunha tecla.
%s fóra de rango%s%s%s: %s (o elemento de erro é "%s")%s: %s%s: %s fóra de rango%s: %s: intérprete erróneo%s: %s: non é posíbel abrir como FICHEIRO%s: %s: valor non válido para o descitor de ficheiro de rastreo%s: %s: se debe usar un subíndice ao asignar a unha matriz asociativa%s: %s:%d: non é posíbel asignar %lu bytes%s: %s:%d: non é posíbel asignar %lu bytes (%lu bytes asignados)%s: especificación de traballo ambigüa%s: redireccionamento ambigüo%s: os argumentos deben ser procesos ou IDs de traballos%s: especificación de ruta de rede errónea%s: substitución errónea%s: agardábase un operador binario%s: non é posíbel asignar %lu bytes%s: non é posíbel asignar %lu bytes (%lu bytes asignados)%s: non é posíbel asignar o gd á variábel%s: no é posíbel asignar unha lista a un membro da matriz%s: non é posíbel asignar a un índice que non é numérico%s: non é posíbel converter unha matriz asociativa a indizada%s: non é posíbel converter a matriz de indizada a asociativa%s: non foi posíbel crear: %s%s: non foi posíbel eliminar: %s%s: non é posíbel destruír variábeis de matriz desta forma%s: non é posíbel executar o ficheiro binario%s: non foi posíbel executar: %s%s: non é posíbel obter o límite: %s%s: non é posíbel modificar o límite: %s%s: non é posíbel abrir o ficheiro temporal: %s%s: non foi posíbel abrir: %s%s: non se pode sobreescribir un fichero existente%s: non se pode leer: %s%s: non é posíbel borrar%s: non é posíbel borrar: %s é de só lectura%s: non se atopou a orde%s: erro ao obtener o directorio actual: %s: %s
%s: erro de expresión
%s: o ficheiro é demasiado grande%s: non se atopou o ficheiro%s: o primeiro carácter que non é espazo en branco non é `"'%s: táboa de asociación baleira
%s: fallou a expansión do historial%s: anfitrión descoñecido%s: opción ilegal -- %c
%s: fallou inlib%s: agardábase unha expresión enteira%s: nome de acción non válido%s: orixe de matriz non válido%s: índice de matriz asociativa non válido%s: quantum de chamada non válido%s: especificación de descritor de ficheiro non válida%s: límite de argumento non válido%s: conta de liñas non válida%s: opción non válida%s: nome de opción non válido%s: servizo non válido%s: nome de opción do shell non válido%s: especificación de sinal non válida%s: especificación de tempo de expiración non válida%s: é un directorio%s: o trabajo %d xa está en segundo plano%s: o traballo rematou%s: liña %d: %s: falta un `:' separador%s: non hai completado de especificación%s: no hai control de traballos%s: non existe ese traballo%s: non é unha función%s: non é un ficheiro regular%s: no é una orde interna do shell%s: non é unha variábel de matriz%s: non é unha matriz indizada%s: non foi cargado dinamicamente%s: non se atopou%s: requírese un argumento numérico%s: a opción require un argumento%s: a opción require un argumento -- %c
%s: parámetro nulo ou non estabelecido%s: función de só lectura%s: variábel de só lectura%s: restrinxido%s: restrinxido: no se pode redirixir a saída%s: restrinxido: non se pode especificar `/' en nomes de ordes%s: expresión de subcadea < 0%s: agardábase un operador unario%s: variable sen asignar%s: uso: (( expresión ))(«core» xerado) (dir agora: %s)
. ficheiro [argumentos]non se admite /dev/(tcp|udp)/anfitrion/porto sen rede/tmp debe ser un nome de directorio válido<non hai directorio actual>instrución ABORTAbortando…Engade un directorio ao tope da rima de directorios, ou rota
    a pila, facendo que o novo tope da rima sexa o
    directorio de trabajo actual.  Sen argumentos, intercambia
    os dous directorios do tope.
    
    Argumentos:
    +N	Rota a pila para que o N-ésimo directorio (contando
    	da izquierda da lista mostrada por `dirs',
    	comezando desde cero) estea no tope.
    -N	Rota a pila para que o N-ésimo directorio (contando
    	da derecha da lista mostrada por `dirs',
    	comezando desde cero) estea no tope.
    
     dir	agrega DIR á rima de directorios no tope,
    	facéndoo o novo directorio de traballo actual.
    
    A orde interna `dirs' mostra a rima de directorios.Alarma (contorno)Alarma (virtual)TemporizadorAritmética para un ciclo.
    
    Equivalente a
    	(( EXP1 ))
    	while (( EXP2 )); do
    		ORDES
    		(( EXP3 ))
    	done
    EXP1, EXP2, e EXP3 son expresións aritméticas.  Se se omite
    calquera expresión, compórtase como se se evaluara a 1.
    
    Estado de saída:
    Devolve o estado da última orde executada.BPT rastreo/capturaChamada ao sistema erróneaSinal ambigüaTubería rotaErro no busLímite de CPUO proceso fillo morreu ou está paradoContinúaMostra os posíbeis completados dependendo das opcións.
    
    Serve para usarse desde unha función de shell que xere completados
    posíbeis.  Se se fornece o argumento opcional PALABRA, xéranse
    as coincidencias contra PALABRA.
    
    Estado de Saída:
    Devolve con éxito a menos que se forneza unha opción non válida o
    se produza un erro.Mostra os tempos de proceso.
    
    Mostra os tempos de usuario e sistema acumulados polo shell e todos
    os seus procesos fillos.
    
    Estado de saída:
    Sempre con éxito.Mostra a lista de directorios actualmente gravados.  Os directorios
    gárdanse na lista coa orde `pushd'; pode ir saíndo da
    lista coa orde `popd'.
    
    Opcións:
      -c	limpa a pila de directorios, eliminando todos os elementos
      -l	non mostra as versións con prefixo de til dos directorios
    	relativos ao seu directorio inicial
      -p	mostra a pila de directorios cunha entrada por liña
      -v	muestra a pila de directorios cunha entrada por liña coa
    	súa posición na pila como prefixo
    
    Argumentos:
      +N	Mostra a N-ésima entrada contando desde a esquerda da
    	lista mostrada por dirs cando se chama sen opcións,
    	comezando desde cero.
    
      -N	Mostra a N-ésima entrada contando desde a dereita da
	lista mostrada por dirs cando se chama sen opcións,
	comezando desde cero.FeitoFeito(%d)instrución EMTAvalí unha expresión aritmética.
    
    Avalíase a EXPRESIÓN de acordo ás regras de evaluación
    aritmética.  Equivalente a "let EXPRESIÓN".
    
    Estado de Saída:
    Devolve 1 se a EXPRESIÓN avalía a 0; devovle 0 de outra maneira.Evalúa unha expresión condicional.
    
    Este é un sinónimo para a orde interna "test", pero o último
    argumento debe ser un `]' literal, que coincida co `[' inicial.Executa argumentos como unha orde de shell.
    
    Combina os ARGumentos nunha soa cadena, usa o resultado como entrada
    para o shell, e executa as órdenes resultantes.
    
    Estado de saída:
    Devolve o estado de saida da orde ou éxito se a orde é nula.Executa ordes mentres unha proba non teña éxito.
    
    Expande e executa ORDES mentres a orde final nas ORDES
    `until' teña un estado de saída que non sexa cero.
    
    Estado de Saída:
    Devolve o estado da última orde executada.Ejecuta ordes mentres unha proba teña éxito.
    
    Expande e executa ORDES mentres a orde final nas ÓRDENES
    `while' teña un estado de saída de cero.
    
    Estado de Saída:
    Devolve o estado da última orde executada.Executa ordes en base á coincidencia de patróns.
    
    Executa ÓRDENES selectivamente baseado en coincidencias da PALABRA
    co PATRÓN. Emprégase `|' para separar patróns múltiples.
    
    Estado de Saída:
    Devolve o estado da última orde executada.Executa ordes por cada membro nunha lista.
    
    O ciclo `for' executa unha secuencia de ordes para cada membro nunha
    lista de elementos.  Se `in PALABRAS ...;' non está presente,
    entón asúmese `in "$@"'.  Para cada elemento en PALABRAS,
    defínese NOME como ese elemento, e execútanse as ÓRDENES.
    
    Estado de Saída:
    Devuelve o estado da última orden executada.Executa ordes internas do shell
    
    Executa a ORDEN-INTERNA-SHELL cos argumentos ARGs sen realizar
    a busca interna de ordes.  Isto é útil cando desexa reimplementar
    unha orde interna do shell como unha función de shell, pero necesita
    executar a orde interna dentro da función.
    
    Estado de Saída:
    Devolve o estado de saída da ORDE-INTERNA-SHELL, ou falso se a
    ORDE-INTERNA-SHELL non é unha orde interna de shell.Saída %dTermina un shell de entrada.
    
    Termina un shell de entrada cun estado de saída de N. Devolve un
    erro se non se executa nunha shell de entrada.Termina ciclos for, while o until.
    
    Termina un ciclo FOR, WHILE o UNTIL.  Se se especifica N, remata
    N ciclos anidados.
    
    Estado de saída:
    O estado de saída é 0 a menos que N non sexa maior ou igual a 1.Remata a shell.
    
    Termina o shell cun estado de N.  Se se omite N, o estado de saída
    é o mismo da última orde executada.Límite de ficheirosExcepción de coma flotanteGNU bash, versión %s (%s)
GNU bash, versión %s-(%s)
Opcións GNU longas:
Agrupa ordes como unha unidade.
    
    Executa un conxunto de ordes nun grupo.  Esta é unha forma de
    redirixir un conxunto completo de ordes.
    
    Estado de Saída:
    Devolve o estado da última orde executada.entrada de datos HFT pendenteo modo monitor HFT foi concedidoo modo monitor HTF foi retiradoa secuencia de son HFT foi completadaHOME non está definidoColgarNon teño nome!E/S listasInstrución ilegalSolicitude de informaciónInterromperMatadoLicenza GPLv3+: GPL de GNU versión 3 ou posterior <http://gnu.org/licenses/gpl.html>
Move o trabañño ao primeiro plano.
    
    Localiza o traballo identificado con IDTRABALLO no primeiro plano, e
    faino o traballo actual.  Se IDTRABALLO non está presente, úsase
    a noción do shell do traballo actual.
    
    Estado de Saída:
    O estado da orde localizada en primeiro plano, ou falla se sucede un erro.Orde nula.
    
    Sen efecto; a orde non fai nada.
    
    Estado de Saída:
    Sempre con éxito.OLDPWD non está definidoSaírLee liñas dun fichero nunha variábel de matriz.
    
    Un sinónimo de `mapfile'.Bloqueo de gravaciónBorra entradas da pila de directorios.  Sen argumentos, borra
    directorio do tope da pila, e cambia ao novo directorio tope.
    
    Opcións:
      -n	suprime o cambio normal de directorio cando se borra
    	directorios da pila, así só se manipula a pila.
    
    Argumentos:
      +N	Borra a N-ésima entrada contando da esquerda da
    	lista mostrada por `dirs', comenzando desde cero.
    	Por exemplo: `popd +0' borra o primeiro directorio, `popd +1'
    	o segundo.
    
      -N	Borra a N-ésima entrada contando da derecha da
    	lista mostrada por `dirs', comezando desde cero.
    	Por exemplo: `popd -0' borra o último directorio, `popd -1'
    	o penúltimo.
    
    A orde interna `dirs' mostra a pila de directorios.Continúa iteracións for, while o until
    
    Continúa a seguinte iteración do ciclo FOR, WHILE ou UNTIL
    circundante.  Se se especifica N, retoma no N-ésimo ciclo circundante.
    
    Estado de Saída:
    O estado de salida é 0 a menos que N non sexa maior ou igual a 1.Devolve un resultado con éxito.
    
    Estado de salida:
    Sempre con éxito.Devolve un resultado sen éxito.
    
    Estado de saída:
    Sempre falla.Devolve o contexto da chamada a subrutina actual.
    
    Sen EXPR, devolve "$liña $nomeficheiro".  Con EXPR, devolve
    "$liña $subrutina $nomeficheiro"; esta información adicional
    pódese usar para fornecer un volcado de pila.
    
    O valor de EXPR indica cantos marcos de chamada se debe retroceder
    antes do actual; o marco inicial é o marco 0.
    
    Estado de Saída:
    Devolve 0 a menos que o shell non estea executando unha función de shell
    ou EXPR sexa non válida.Devolve o contexto da chamada a subrutina actual.
    
    Sen EXPR, devovle En execuciónViolación de segmentoActiva e desactiva opcións de shell.
    
    Cambia a configuración de cada opción de shell NOME_OPCIÓN. Sen
    algunha opción como argumento, mostra todas as opcións de shell cunha
    indicación se está activa ou non.
    
    Opcións:
      -o	restrinxe NOME_OPCIÓN a aqueles definidos con `set -o'
      -p	mostra cada opción de shell cun indicador do seu estado
      -q	suprime a saída
      -s	activa (estabelece) cada NOME_OPCIÓN
      -u	desactiva (borra) cada NOME_OPCIÓN
    
    Estado de Saída:
    Devolve con éxito se se activa NOME_OPCIÓN; falla se se fornece
    unha opción non válida ou NOME_OPCIÓN está desactivado.Orde do shell que coincide coa palabra `Orde do shell que coincide coas palabras `Opcións do shell:
Sinal %dDetidoDetido (sinal)Detido (entrada pola terminal)Detido (saída pola terminal)Detido(%s)Suspende a execución do shell.
    
    Suspende a execución deste shell até que recibe un sinal SIGCONT.
    Os shells de entrada non se poden suspender, a menos que sexan forzados.
    
    Opcións:
      -f	forza a suspensión, aínda se o shell é un shell de entrada
    
    Estado de Saída:
    Devolve con éxito a menos que non estea activo o control de traballos o
    se produza un erro.TIMEFORMAT: `%c': carácter de formato non válidoRematadoO correo en %s foi lido
Hay traballos en execución.
Hai traballos pendentes.
Estas ordes do shell están definidas internamente.  Teclee `help' para
ver esta lista.
Teclee `help nome' para saber máis sobre a función `nome'.
Use `info bash' para saber máis sobre o shell en xeral.
Use `man -k' o `info' para saber máis sobre as órdenes que non están nesta lista.

Un asterisco (*) xunto a un nome significa que a orde está desactivada.

Escriba `%s -c "help set"' para máis información sobre as opcións do shell.
Escriba `%s -c help' para máis información sobre as ordes internas do shell.
Sinal descoñecido #Sinal descoñecido #%dErro descoñecidoEstado descoñecidoCondicón de E/s urxenteUso:	%s [opción GNU longa] [opción] ...
	%s [opción GNU longa] [opción] guión-do-shell
Use «%s» para deixar o shell.
Use a orden `bashbug' para reportar erros.
Sinal de usuario 1Sinal de usuario 2Xanela cambiadaTen mensaxes en $_Ten unha nova mensaxe en $_[ arg... ][[ expresión ]]`%c': orde errónea`%c': carácter de formato non válido`%c': carácter de modo simbólico non válido`%c': operador de modo simbólico non válido`%c': especificación de formato de tempo non válida%s: non se pode borrar a asignación`%s': nome de alias non válido`%s': nome de combinación de teclas non válido`%s': falta o carácter de formato`%s': no é un pid ou unha especificación válida de traballo`%s': non é un identificador válido`%s': nome de función descoñecidoagardábase `)'`)' agardábase, atopouse %sagardábase `:' para a expresión condicionaladd_process: pid %5ld (%s) márcase como vivo aíndaadd_process: o proceso %5ld (%s) en the_pipelinealias [-p] [nome[=valor] ... ]all_local_variables: non hai contexto de función no ámbito actualargumentoagardábase un argumentorequírese a compatibilidade de variábel de matriztentouse asignar a algo que non é unha variábelsubíndice de matriz incorrectotipo de orde erróneoconector erróneosalto erróneosubstitución errónea: non hai unha "`" que peche en %ssusbtitución errónea: non hai un `%s' que peche en %sbash_execute_unix_command: non foi posíbel atopar a combinación de teclas para a ordebg [id_traballo ...]break [n]erro: elemento de asignación de expresión erróneobuiltin [orde-interna-shell [arg ...]]caller [expresión]só se pode usar «return» nunha función ou guión lido con «source»só se pode usar dentro dunha funciónnon é posíbel asignar un novo descritor de ficheiros para a entrada de bash desde o fd %dnon se pode crear un fichero temporal para o documento-aquí: %sno se pode duplicar o df %d ao df %dnon é posíbel duplicar a tubería chamada %s como df %dnon é posíbel atopar %s no obxecto compartido %s: %snon é posíbel crear un proceso fillo para a substitución da ordenon é posíbel crear un proceso fillo para a substitución do procesonon é posíble crear a tubería para a substitución da ordenon é posíbel crear a tubería para a sustitución do procesonon é posíbel abrir a tubería chamada %s para lecturanon é posíbel abrir a tubería chamada %s para escrituranon é posíbel abrir o obxecto compartido %s: %snon é posíbel redirixir a saída estándar desde /dev/null: %snon é posíbel restabelecer o modo nodelay para o df %dnon é posíbel activar e desactivar opcións do shell simultaneamentenon é posíbel estabelecer o grupo de procesos de terminal (%d)non é posíbel borrar ao mesmo tempo unha función e unha variábelnon é posíbel suspendernon é posíbel suspender un shell de entradanon se pode use `-f' para facer funciónsnon foi posíbel usar máis dun de -anrwcase PALABRA in [PATRÓN [| PATRÓN]...) ORDES ;;]... esacsetpgid fillo (%ld a %ld)command [-pVv] orde [arg ...]command_substitute: non é posíbel duplicar a tubería como fd 1complete [-abcdefgjksuv] [-pr] [-DE] [-o opción] [-A acción] [-G patglob] [-W listapalabras] [-F función] [-C orde] [-X patfiltro] [-P prefixo] [-S sufixo] [nome ...]completion: non se atopa a función `%s'compopt [-o|+o opción] [-DE] [nome ...]agardábase un operador binario condicionalcontinue [n]coproc [NOME] orden [redireccións]non é posíbel atopar /tmp, por favor creeo!cprintf: `%c': carácter de formato non válidoactualborrando o trabajo detido %d con grupo de proceso %lddescribe_pid: %ld: non existe tal pida pila de directorios está baleiraíndice da pila de directoriosdirs [-clpv] [+N] [-N]división entre 0a carga dinámica non está dispoñíbelecho [-n] [arg ...]echo [-neE] [arg ...]nome de variábel de matriz baleiroenable [-a] [-dnps] [-f nomeficheiro] [nome ...]erro ao obtener os atributos da terminal: %serro ao importar a definición da función para «%s»erro ao estabelecer os atributos da terminal: %seval [arg ...]exec [-cl] [-a ome] [orde [argumentos ...]] [redirección ...]exit [n]agardábase `)'expoñente menor que 0export [-fn] [nome[=valor] ...] ou export -pagardábase unha expresiónexcedeuse o nivel de recursión da expresiónfc [-e nome_e] [-lnr] [primeiro] [último] ou fc -s [pat=rep] [orde]fg [id_traballo]descritor de ficheiro fóra de rangorequírese un argumento de nome de ficheirofor (( exp1; exp2; exp3 )); do ORDES; donefor NOME [in PALABRAS ... ] ; do ORDES; doneo pid `forked' %d aparece no traballo en execución %dfree: chamouse cun argumento de bloque previamente liberadofree: chamouse cun argumento de bloque sen asignarfree: os tamaños dos anacos de inicio e fin son diferentesfree: detectouse un desbordamento por embaixo; mh_nbytes fóra de rangofunction nome { ORDES ; } ou nome () { ORDES ; }versiones futuras do intérprete obligarán a evaluación como unha substitución aritméticagetcwd: non é posíbel acceder aos directorios paigetopts cadena_opcións nome [arg]hash [-lr] [-p ruta] [-dt] [nome ...]asociación desactivadahelp [-dms] [patrón ...]o documento-aquí na liña %d está delimitado por fin-de-fichero (agardábase `%s')history [-c] [-d desprazamento] [n] ou history -anrw [ficheiro] ou history -ps arg [arg...]posición no historialespecificación de historialcoinc	orde
agardábase un identificador despois do pre-incremento ou pre-decrementoif ORDES; then ORDES; [ elif ORDES; then ORDES; ]...[ else ORDES; ] fiinitialize_jobs_control: fallou getpgrpinitialize_jobs_control: disciplina de liñainitialize_jobs_control: setpgidbase aritmética non válidabase non válidacarácter non válido %d en exportsrt para %snúmero hexadecimal non válidonúmero non válidonúmero octal non válidonúmero de sinal non válidoo traballo %d iniciou sen control de traballojob_spec [&]jobs [-lnprs] [idtraballo ...] ou jobs -x orde [args]kill [-s id_sinal | -n num_sinal | -id_sinal] pid | id_traballo ... ou kill -l [id_sinal]última orde: %s
let arg [arg ...]límiteliña %d: no se activó a edición de liñalocal [option] nome[=valor] ...logout
logout [n]contía de ciclomake_here_document: tipo de instrución %d erróneomake_local_variable: non hai contexto de función no ámbito actualmake_redirection: a instrucción de redirección `%d' está fóra de rangomalloc: bloque na lista libre sobreescritomalloc: fallou a aserción: %s
migrando o proceso a outra CPUfalta un `)'falta un «]»falta o díxito hexadecimal para \xfalta o díxito unicode para \%cnon hai compatibilidade para operacións de redenon hai «=» en exportstr para %sno hai un `%c' que peche en %snon foi posíbel atopar a ordenon hai temas de axuda que coincidan con «%s». Probe «help help» ou «man -k %s» ou «info %s»no ha control de traballosnon hai control de trabalos nesta shellnon hai concidencia: %snon hai outro directorionon se permiten outras opcións con «-x»non se está executando a función de completadonon é un shell de entrada: use `exit'número octalsó ten significado nun ciclo `for', `while' ou `until'erro de canalizaciónpop_scope: a cabeza de shell_variables non é un ámbito de ambiente temporalpop_var_context: a cabezak de shell_variables non é un contexto de funciónpop_var_context: non é un contexto global_variables popd [-n] [+N | -N]fallo de enerxía inminenteprint_command: conector erróneo `%d'printf [-v var] formato [argumentos]progcomp_insert: %s: COMPSPEC nuloerro de programaciónpushd [-n] [+N | -N | dir]pwd [-LP]read [-ers] [-a matriz] [-d delim] [-i texto] [-n ncars] [-N ncars] [-p prompt] [-t timeout] [-u fd] [nome ...]erro de lectura: %d: %sreadarray [-n conta] [-O orixe] [-s conta] [-t] [-u df] [-C chamada] [-c quantum] [matriz]readonly [-aAf] [nome[=valor] ...] ou readonly -prealloc: chamouse cun argumento de bloque sen asignarrealloc: os tamaños dos anacos de inicio e fin son diferentesrealloc: detectouse un desbordamento por embaixo; mh_nbytes fóra de rangodesbordamento da base da pila de recursiónerro de redirección: non é posíbel duplicar o fdregister_alloc: %p xa está na táboa como asignado?
register_alloc: a táboa alloc está chea con FIND_ALLOC?
register_free: %p xa está na táboa como libre?
restrinxidoreturn [n]run_pending_traps: valor erróneo en trap_list[%d]: %prun_pending_traps: o manexador de sinal é SIG_DFL, reenviando %d (%s) a sí mesmosave_bash_input: o almacenamento intermedio xa existe para o novo fd %dselect NOME [in PALABRAS ... ;] do ORDES; doneset [-abefhkmnptuvxBCHP] [-o nome-opción] [--] [arg ...]setlocale: %s: non se pode cambiar a configuración rexional (%s)setlocale: %s: non se pode cambiar a configuración rexional (%s): %ssetlocale: LC_ALL non se pode cambiar a configuración rexional (%s)setlocale: LC_ALL: non se pode cambiar a configuración rexional (%s): %so nivel de shell (%d) é demasiado alto, restabelécese a 1shift [n]conta de shiftshopt [-pqsu] [-o] [nome_opción ...]sigprocmask: %d: operación non válidasource ficheiro [arguments]start_pipeline: tubería de pgrpsuspend [-f]erro de sintaxeerror sintáctico na expresión condicionalerror de sintaxe na expresión condicional: elemento inesperado `%s'erro de sintaxe na expresiónerro de sintaxe cerca de «%s»error de sintaxe perto do elemento inesperado `%s'erro de sintaxe: `((%s))'error sintáctico: `;' non esperadoerror de sintaxe: requírese unha expresión aritméticaerro de sintaxe: operador aritmético non válidoerro de sintaxe: agardábase un operandoerror de sintaxe: non se agardaba o final do ficherocaída do sistema inminentetest [expresión]time [-p] pipelinedemasiados argumentostrap [-lp] [[arg] id_sinal ...]trap_handler: sinal errónea %dtype [-afptP] nome [nome ...]umask [-p] [-S] [modo]unalias [-a] nome [nome ...]EOF inesperado mentres se buscaba `]]'EOF inesperado mentres se buscaba un `%c' coincidenteEOF non agardado mentres se buscaba un «)» coincidenteargumento inesperado `%s' para o operador binario condicionalargumento inesperado `%s' para o operador unario condicionalargumento inesperado para o operador binario condicionalargumento inesperado para o operador unario condicionalelemento inesperado %d na orde condicionalelemento inesperado `%c' na orde condicionalelemento inesperado `%s' na orde condicionalelemento inesperado `%s', agardábase un operador binario condicionalelemento inesperado `%s', agardábase `)'descoñecidoerro de orde descoñecidountil ORDES; do ORDES; donevalor demasiado grande para a basevariables - Nomes e significados de algunhas variábeis de shellwait: pid %ld non é un proceso fillo desta shellwait_for: Non hai un rexistro do proceso %ldwait_for_job: o traballo %d está detidowaitchld: actívase WNOHANG para evitar o bloque indefinidoaviso: aviso: %s: %saviso: é posíbel que a opción -C non funcione como se esperaaviso: é posíbel que a opción -F non funcione como se esperawhile ORDES; do ORDES; doneerro de escritura: %sxtrace fd (%d) != numfich xtrace fp (%d)xtrace_set: %d: descriptor de fichero non válidoxtrace_set: punteiro a ficheiro NULL{ ORDES ; }PK�m�\��ϡ
�
�LC_MESSAGES/iso_639-3.monu�[�����/���&��n�n�n	�n�n�n�n�n�no
oooo%o+o7o?oDoIoOoVo^oeo	noxo�o�o�o�o�o�o�o�o�o�o�o�o�o�o�o�o�o�oppp"p1p7p>pDpIpapgpopwp~p�p�p	�p
�p�p�p�p�p�p�p�p�p�p�p�p�pq	qqq%q
+q9q?qDqJqQqUqZq_qsq�q
�q�q�q�q�q
�q�qr
#r.r5r>r	Dr	NrXr_rdrlrqrxr~r�r�r�r�r�r�r�r�r�r�r�r�r
�r�rsss*s0s6sMsPsTs\scslsus~s�s�s	�s�s�s�s�s�s�s�s�s�s�s�s�s�s�s�sttttt"t'tGtXt`tftmtrt{t�t	�t�t�t�t�t�t�t�t�t�t
uu%u	:uDuHuQuWu_udujuyu�u�u�u
�u�u�u�u�u
�u�u�u�u
vvv"v'v>vUv\vev
kvvv~v
�v�v�v�v�v�v�v�v�v�v
�v�v
www"w(w?wGwKwPw_wcwhwqwvww�w�w�w
�w�w�w�w�w�w�w�w�w
xxxx!x'x	/x9xBx
GxRx	Zxdx
jxux�x�x�x�x�x�x�x�x�x�x�x
�x�x�x�x�xyyyy!y&y,y2y?yFyKyQy
cy
qyy�y	�y�y�y�y�y�y�y�y�y
�y�yz
zz%z>zQzazqz�z�z�z�z�z�z�z{{5{L{a{p{�{
�{�{�{
�{
�{�{||!|9|J|[|q|�|�|	�|�|�|,�|�|
}*}=}E}N}^}f}m}u}
}}�}�}�}�}�}�}�}�}�}�}�}�}�}�}~
~	~	~"~3~;~D~L~S~X~_~d~l~u~�~�~
�~�~�~�~�~�~�~
2H
\jmuz�
���������/�>�K�[�`�i�	o�y���
����������̀݀�����	��	��"�	*�4�:�C�O�^�k�r�u�{�������#����ԁ����	������$�+�
3�A�M�d�q�	z���������������������Ă̂҂؂܂��
�
���
��(�4�:�C�I�`�f�l�s�����
������ŃՃ�
����$�7�<�A�F�M�V�[�c�k�x���������������Єׄ܄���������(�.�4�	@�J�V�c�k�s�������������������	��ʅ΅
ۅ��������
)�7�=�C�U�g�p�������	����������Æ̆	ӆ݆
���
��#�?�N�W�\�m������
������ć	ˇՇ܇�����

���#�)�@�E�L�^�r�����
����Lj
Ԉ
����
��	���!�	)�3�9�@�
I�	T�^�e�l�
s�~�����
����	��������ljω։މ���	�
���
&�
4�B�Q�X�]�d�
k�v�|�����������������
Њۊ��	�������+�3�<�A�G�
X�f�
r�}���
����������Nj׋���������� �&�/�
6�A�G�N�T�\�d�j�q�v�}���������������������ɌҌٌ�
�	����'�3�;�J�P�_�o�x�~���������������č͍Ս܍��
��
���%�+�1�7�>�D�J�P�W�
\�g�}�
��������
��������ȎЎ֎ߎ��������� �(�-�6�C�S�i���������������������Ǐ͏ݏ
���	��!�&�	/�9�?�F�K�Q�X�^�d�i�o�v�����	����������ɐѐِ�
���� �'�.�3�B�T�\�c�i�o�
~���������������‘Ǒˑґؑޑ����	���"�(�	4�>�T�]�d�s������������
������
����%�#2�V�_�f�l�q�y�	~���������������œ͓֓ܓ�����������!�'�0�8�?�F�N�T�Z�`�h�q�x���������ϔ֔۔��������#�+�4�<�
D�O�W�^�
e�s�������������ѕ֕ܕ����	��%�-�6�?�]�j�w�~�����
������������
��̖іؖߖ����������%�.�6�>�D�K�	R�\�t�|���	������̗Зח��������
���"�/�>�J�W�]�
b�m�s�z�����������
����̘ۘ�������&�	,�6�<�
D�O�V�^�c�i�p�v��������
����������ʙۙ��
���
���#�)�/�7�<�
M�[�j�q�	v���	������	������!��ٚ
�	�������%�-�=�	D�N�V�	_�i�r�{���	������
��
����
țӛۛ�
��
��(�0�	6�@�I�P�W�_�k�s�	w�����������������ɜМ֜
ߜ
�	����	� �	(�2�	;�
E�P�Y�`�f���������ѝ
��	��
�
���)�
9�D�	M�W�_�g�o�v������������
��
ĞϞ؞	����	�
�+�	1�;�Q�	Z�d�
l�
w���
��
������
Ÿ
͟؟����
��"�.�;�C�X�n���������Ϡ����*�;�U�]�s���������ġ֡�����/�<�M�Y�h�u�}���	����
����
��â
Т	ޢ����������0�H�Y�n�
t��������������ģɣϣ֣ݣ
������	����(�0�6�=�F�W�^�
j�u�
{�����������ǤϤ
֤�����
��(�	1�
;�F�V�f�x���������������̥ѥ٥������"�*�/�;�O�\�p�}���������Ԧ#��$�@�Z�s�������ק�
� )�J�e�������Ѩ���6�L�c�|�����ȩة���#�(�1�5�H�N�T�h�z�
������������	����Ǫͪժ۪�
��	�����%�,�3�8�J�Y�j�p�x�~�����������
����˫׫ݫ�	��������#�)�0�9�=�D�
J�U�n���
������Ȭڬ߬�����	����&�	+�5�<�L�R�V�e�j�q�x�~���������
����������ǭЭ������
�� 
�+�3�:�?�E�K�Q�b�q�x��������	��������î̮Ӯڮ�������
���&�6�>�C�I�N�R�_�g�l�s�{�����������ϯ������ �'�-�	2�<�E�
K�V�\�k�w����	��������������°ư˰
Ӱ��
��#�
3�A�N�`�q���������Ʊױޱ����$�0�7�=�A�I�P�V�n�t�y�����������	��	��òʲѲݲ��������
����!�&�,�3�:�@�E�K�P�c�j�o�v�|�������������
������Ƴͳٳ
������
6�A�	Y�c�i�o�u�{�	������������������ȴϴش�
��������$�*�0�7�>�W�`�	h�r�z�����������������ŵ̵еֵ�������"�)�/�3�8�?�K�S�[�a�g�l�r�x����������������ζݶ
���	��	��� �#�2�
7�
E�S�X�`�h�p�������÷Ƿ߷���	���	����	&�0�5�B�G�M�S�X�\�
e�p�	w�����������¸˸Ѹ
ָ���
��,�5�;�A�F�
M�X�\�c�p�u�|�����������������Źι޹�������'�:�>�C�L�U�Z�a�g�n�u���������
ʺغ���������	 �*�1�6�:�B�H�N�V�	[�e�n�u�
������һ������"�4�F�V�v���������üǼμҼ׼������������"�'�-�D�Q�a�x��������������Ͻսܽ������������%�,�5�>�C�
K�V�	\�f�
k�v�{�����
����������������	žϾ���������%�+�>�S�Y�n�
}����������������� ��
ݿ���
��
*�8�
>�I�	Q�[�
m�x�	��
��
��	��	����
������������
�
�%�2�7�;�A�H�
Q�_�d�i�p�����#�����
�'�.�	:�D�T�d�	{�������	����
������������������
�����
�#�;�A�I�Q�Z�a�i�q�w��
��
��������	�����������������������
����.�7�?�E�
V�a�e�m�	s�}�������
��������
�����������
��-�=�Q�j�}���������������
����	������
���)�1�L�\�q���
������	��������
������
���
��&�<�E�N�U�u���	��������������������	������	����
��
��	��&�
.�<�D�L�T�\�a�q�w����������	������������	���������������������"�2�B�J�a�h���������������
����������������������'�.�5�;�C�J�Q�Z�b�
h�s�y��������������������������������"�(�/�6�=�F�K�P�W�_�h�
n�	y���������������	������
�����"�.�3�:�?�	E�	O�	Y�
c�n�������������	��
��������������0�5�:�?�E�K�P�U�^�g�l�	q�{���������������������#�(�	0�:�J�Y�j�s�x���������	��������	���������������!�)�/�3�	8�B�H�N�S�\�c�g�n�s�z�������������	����
����������������
�!�'�+�
;�I�Y�h�m�s�y�~�	����������������������������������� �'�+�	3�=�E�N�T�\�a�h�p�w�	�������
�������������'�/�
6�A�I�N�:Z�������	����������&�,�2�8�?�B�H�P�V�]�d�j�~�������������	������
�����
���,�4�H�_�g�}�������������
�������������
���2�:�?�D�P�U�]�b�h�n�r�x�}�����������������������	����	�"�(�1�
H�	V�`�g�l�r����������������������������������%�-�2�7�>�D�J�Z�i�
n�|�������������
��	�������������	���%�2�
A�
O�	]�g�s�z�������������������������������	���
���#�*�2�?�E�M�T�d�l�
s�����������������������	�����������	$�.�4�<�B�H�T�`�
l�w��������
������������������������
�
�!�	-�7�@�H�P�_�e�l�u�~�����������������������0�B�Z�	b�l�~�������	���������������������������	�
� �)�2�:�C�L�[�k�p�w�|�����
��	�����������������������������2�9�
@�K�\�d�m�v�}�����	�����������������������
#�1�
A�O�^�e�i�p�t�	z�����������	�����������.�@�	P�Z�b�i�
q�|�
������	��������������������
�(�4�@�M�^�j�v���������
����
������	��	�
!�
/�:�	A�K�W�^�d�
k�y�����
������������	���������������
��%�+�0�8�>�C�
I�
W�e�	k�u�����������������������	��	����������
�(�
5�C�V�
f�t���	����������	���������������������������#�0�H�#P�t�����������	�������������������������
4�B�W�_�
e�p�|�����������������������
����	����
��
��	�#�*�1�@�H�^�k�x���������������������������������	�
���!�(�7�G�L�T�[�
m�	x�������������������������������������
�
���"�
)�4�	H�	R�\�b�k�{���������������������	�����������(�,�	1�;�A�F�U�e�m�s�y���%��������
����������
����%�+�0�5�<�C�K�P�V�^�c�i�p�x�~���������
����������	�����������	��/�4�I�^�f�
r�������������������������
��#��"�/�6�>�J�R�X�
^�i�q�w���������
������
����.�7�?�E�K�R�[�c�i�q�
~������������� ����	��"�(�>�V�e�n�w�~���������������������������������#�)�.�5�<�M�R�Y�^�f�m�s�x��������������������������	���
���$�*�@�F�L�S�
\�j�v�����������������������������	�����������*�2�6�>�E�
K�V�b�n�
z���������������������������1�7�C�	L�V�^�e�m�s�{�����
������	����
��������
����	����!�'�+�0�5�	;�E�I�P�X�`�q�������	����������������������&�
5�C�L�S�[�a�r�w������������
������	����������������"�)�1�7�=�D�M�T�]�d�j�p�v�{������������������������������
����#�)�.�3�<�B�O�W�]�d�q�x�~���������������������������"�)�	.�	8�B�H�Y�
h�
v���	�������������������������*�6�	;�E�M�T�	[�e�
k�y���)����������������#�(�1�:�@�	E�O�U�Z�c�k�������������
������
�
�
�������!�(�-�
9�G�M�V�	]�g�m�t�z�#��
�������
�������"�)�1�7�=�E�K�
S�^�d�k�s�z�������
����������
�������	��
�!�(�	0�:�O�U�]�f�y������������������������	���	��	��� �'�
0�>�Q�V�g�n�s�������
�������������
����!�'�/�7�C�P�W�]�b�i�n�t�y�~���������	������
���$	*4:>CHN
Uchnrw~����
�������������	� &	+5;DKZsx�����
�������
")09MU]!a�������������		
"-AI	U_hmt|�������������&-:AIRXafov�
����������$+28@
LZ`fnv~����������+:R[j }�� ���!	5?GTajp
x	��������%4IVc
|��
��
����			!	+	4	;	S	c	{	�	
�	�	�	�	�	�	�		�	�	�	�	�		


%
)
.
	4
>
F
M
T
[
m
~
�
�
�
	�
�
�
�
�
�
�

�
�
�

�

'/BIU\dlt}����
�
����	�	����	"(09@GPbt����
��
����

$
4
G
Z
f

�
�
�
�
	�
�
�
�
�
�
�
�
�
!
(39EJR[cjr
z�������������	
 
.
<
JXq��
������	���	��
	'-4E	V`lx����������	
#3@MYix�
�����	��������&.6>EKckw�����	�
��������%6N_r����������$6<BGKPX
lz��"�������������
%05<CJQW_lsz���	��������
�	 0I^fmu	{���������������$-3:AW]cjrx}������3
:EK[dltz��������	��	���
�	!(/	5?FMV]djqu
z����
���
�

+?Rgx������!9L`y������(B[l}���� ?Te w�����$7M_{�������������
,2:?HNV\dkrx
��������������� 
   # * 1 8 N W ^ c i 	p z  � � � � � � � � � � 	� � !!&!8!	N!X!]!#m!�!
�!�!�!
�!
�!�!�!�!�!�!"$"6"="D"M"	V"
`"k"r"{"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"	�"#
#	&#0#6#:#A#	G#Q#X#]#a#f#n#u#z##�#�#�#�#
�#�#
�#�#�#�#�#�#	$
$$$$#$,$4$<$D$
K$V$^$f$n$v$|$�$�$	�$�$�$�$�$�$�$�$
%%%%,%9%H%Q%W%]%d%j%
p%{%�%�%�%�%�%�%�%�%�%�%�%�%�%	�%�%�%�%&
& &0&6&=&F&O&X&`&e&i&l&r&z&&�&	�&	�&�&�&�&�&�&�&�&�&�&�&�&''!'.'A'N'
['i'x'�'�'�'	�'�'�'
�'�'�'�'(
(
&(
1(?(L(
Y(
g(u(
�(�(
�(
�(�(�(�(
�(	�(�(�())$)+)2)C)])u)�)�)�)�)�)�)*,*E*Y*j*�*�*�*�*�*�*+!+8+L+a+*{+�+�+�+�+�+�+�+�+�+�+�+�+�+�+�+,,$,0,F,L,S,Y,`,w,},	�,�,�,�,�,�,�,�,�,	�,�,�,�,�,�,�,-
----
(-3-9-B-H-Q-Y-
f-q-y-�-�-�-�-�-�-�-�-�-�-
�-�-�-�-�-�-�-	�-.
... .&.+.2.8.	=.
G.U.d.s.	z.
�.�.�.�.�.�.�.�.�.�.�.�.�.�.�.�.�.�.
	///
&/4/J/R/X/\/d/i/n/s/x/|/�/�/�/�/�/�/�/000
70E0	J0
T0b0i0y0�0�0�0�0�0�0�0�0�0�0�0�0!�0%�0	$1.161	B1	L1V1]1f1k1q1�1�1�1�1�1�1�1�1�1�1�1�1�1222	22%2,22292>2E2!N2%p2�2�2�2�2�2�2�2�2�2�2�2�2�2�2�233333'3,3E3U3i3~3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3�3	44444&4+434;4
H4V4e4t4	�4�4�4�4�4�4�4�4�4�4�4�4	�4�4�455555#5(5>5E5M5V5\5b5i5r5
y5�5�5�5�5�5�5�5�5
�5�5	�5�5�56 656;6A6J6\6c6g6n6s6z6�6
�6
�6�6�6�6�6�6�6�6�6�6�67
777#7
=7H7P7U7^7n7
v7�7�7�7�7�7	�7�7�7�7�7�7�78888 8'8	48>8G8O8W8	^8	h8r8z8�8�8�8�8�8�8�8�8�8�8�8�8�8�89"9+92989>9D9J9S9Z9b9	k9u9}9�9�9�9
�9�9�9	�9�9	�9�9�9�9�9�9:::::":&:,:2:;:G:L:]:n:}:�:�:�:�:�:�:�:�:�:�:
;	;&;,;3;	:;D;\;t;};�;�;�;�;�;�;�;�;�;�;�;�;�;�;�;
�;�;�;
<
<
%<3<:<><C<U<[<	_<i<r<y<�<�<�<�<�<
�<�<�<�<�<�<�<�<�<�<�<�<==== =8=G=[=b=h=n=s=y==�=�=�=�=�=�=�=�=�=�=�=>>,>;>
M>[>a>h>n>t>y>~>�>�>�>�>�>�>�>�>�>�>	�>�>�>�>
�>�>�>�>
�>??)?	.?8?@?M?T?[?l?s?|?�?�?�?�?�?�?�?�?
�?�?@@
-@8@=@F@N@T@Z@a@h@l@
s@�@�@�@�@�@�@�@�@�@AAA%A,A
4ABA
HASA\AcAlArAyA�A
�A
�A�A�A�A�A	�A�A�A�A�A�A
�A	BBBB"B	;BEB
MB	XBbBiBqByB�B�B�B�B�B
�B�B�B�B�B�B�B�B�BCCC&C/C7C?CHCQCXC_ChCkCpCuC~C�C�C�C�C�C�C�C�C�C�C�C�C�C	�CD
DDD-D>DYDyD�D�D
�D�D�D�D�D�D�D�D�D�D
�DE
EEE
*E
5ECEOEXEaEgEoEuE|E�E�E�E�E�E
�E�E�E�E�E
�E
�E�E�EFF
(F
6FAFGFLFRFZF	aFkF
rF�F�F�F�F�F�F�F�F�F
�F	�F�F�F
�F�FGGG(G4G8GDG`GmGuGzG�G�G	�G�G�G�G�G�G�G�G�G�G�G�G
�G
HH&H5HHHWH]H	cHmHtH�H�H�H �H �HI+I;ILIaIhI	pI	zI
�I	�I
�I�I
�I
�I�I�I�I	�I�I�I
J$J-JFJbJvJ}J�J�J�J�J�J�J�J�J
�J�J�J�J�JK
KK(K5KAK
MKXK^KcKhKpKwK	~K�K�K�K�K	�K�K�K�K�K�K�K�K�KLLL
L"L	(L2L8L@LGL
OLZLaLgL
pL{L�L�L�L�L�L�L�L�L�LMM,MJM_MpM�M�M�M�M�M(�M#N;NRNgN${N�N�N�N"�NOO
1O?O TOuO�O"�O�O�O�OPPP4PMPjP�P�P�P�P�PQ
QQQ&Q,Q1Q8Q
AQ	LQVQ[QbQuQ}Q�Q	�Q�Q�Q�Q�Q�Q�Q�Q�Q�Q�Q�Q�Q�Q�Q�QRRRRR%R+R	0R:R?RFRKR
PR[RcRhRnRtR}R�R�R
�R�R�R�R�R	�R�R�R
�R�R
SSS	S(S0S	6S@SFSUSfSwS|S�S�S�S�S�S�S�S
�S�S�S
TT#T:TJT\TnT{T�T�T�T�T�T�T�T�T�T�T�T�T�T�T�T�T�TUUUUU U&U,U3U:UBUXUeUkUqUwU}U�U�U�U�U�U�U�U�U�U�U�U�U�U�U�U�U�U�UV	VVV V&V-V5V:V?VHVQV]VfVlVsV
xV�V	�V�V�V�V�V�V�V�V�V�V�V�VWW!W
&W4WEW	TW
^WiWqW
wW�W�W	�W�W�W�W�W
�W�W�W
�W�WX	X	 X*X/X
;XFXUX
\XgXnXvX|X�X	�X�X$�X�X�X�X�X	�X�X	�XYY
Y)Y:Y?Y
EYSYYYbYjYrYzYY�Y�Y�Y�Y�Y	�Y�Y�Y
�Y�Y�Y	�Y�Y
ZZ5ZJZSZYZ_ZgZmZtZ{Z�Z
�Z�Z
�Z�Z
�Z�Z�Z�Z�Z�Z�Z[[[[[
'[2[?[D[J[^[g[l[	}[�[�[�[�[�[�[�[�[�[�[�[�[�[�[�[�[�[\\\&\2\:\Q\X\`\f\n\u\|\	�\�\	�\
�\�\�\�\�\�\�\�\�\�\�\]
]]]]%].]?]P]a]q]�]�]�]�]�]�]�]�]�]^^^&^5^:^@^E^L^R^Z^_^e^
t^^�^�^�^�^�^�^�^�^�^�^
�^�^�^�^	�^_
_	__#_*_0_5_=_A_
H_	S_]_c_j_q_w_
_�_�_�_�_�_�_�_�_�_�_	�_�_�_`````!`'`	/`9`A`I`V`\`c`j`o`u`{`�`�`�`�`�`�`�`�`�`�`�`�`�`	�`�`	aaaaa'a0a@aGaOaVa]acaiaqayaa�a�a�a�a	�a�a�a�a�a�a�a	�a�abbbbb#b*b/b7b@bIbObabrbzb�b�b�b�b�b�b�b�b�b
�b
�b�b�b	c	c!c;c@cFcKcScWc[cbcicncuc{cc
�c�c�c�c�c�c�c�c�c�c	ddd)d/d5d=dFdJdNdVd[djd
yd�d�d�d�d	�d�d�d�d�deee#e9eQe^efeoe|e
�e
�e�e�e�e�e�e�e�e�e�e
ff2fCfJfSfZfcfifnfvfzff�f�f�f�f�f�f�f�f�f�f�f�f�f	�f�f�f�f	�fg
g	g
g%g.g5g<g
LgZg_gggngug{g�g�g�g�g�g�g�g�gh'hChKhRhdhlhxh�h�h�h�h
�h
�h�h�h
�h�h�h�hi	i	ii
$i/i8i=iBi	KiUi
]ihiqi�i�i�i�i�i�i�i�i	�i�i�i�i�i�i�ij
j	jj&j,j3j:j@jOj^jfjlj�j�j�j	�j�j	�j�j�j�j�j�j�j�j�j�j
�j�j�jkkkk k,k	<kFkYknk~k�k�k�k�k�k�k�k�kl l4lHlOl	Wlalfl
llwl}l�l	�l
�l�l
�l
�l�l
�l�l�l�l�l�lm
mmm"m	)m3m	EmOm\mmm�m�m�m	�m�m�m�m�m�mn#n2n9nAnInOn
Vndn
knvn	~n�n�n�n�n�n�n�n�n�n�n�n�n�n�n�n�no	oo!o2o:oBo	JoToYobo
ho	so}o�o�o�o�o�o�o�o	�o�o�o
�o�o
�o�o		pp	p	)p3p@pHpOpSpcpspzpp�p�p�p�p�p�p�p�p�p�p�p�p�p�p�pq'q>qUqZqaqgqnqvqq�q�q�q
�q�q	�q�q�q�q�q
�q�q
�q�q�q�qrr	#r-r@rOr^rfrnrsr{r�r�r�r�r�r�r�r�r�r�r�r�rssss!s's-s
5sCsVses	rs|s�s�s�s�s�s�s�s�s�s	�s�s�s�s�s�s�s�s�sttttt$t)t1t6t<t@tEtTtcthtotxt�t	�t�t�t�t�t�t�t�t�t�t�t�t�t�t�t�t	u	uuu$u0u
<uJuNuUu^ueuju	su}u�u�u�u�u
�u�u�u�u�u�u	�u�u
�u	vvv
v,v2v8v=vFv
MvXv`vfvmvrvyv"�v�v�v�v�v�vw*w<wCwHw_wxw�w�w�w	�w�w�w�w!�w
�w�wxx,xIxOxVx
]xhxpx	xx	�x�x�x�x�x�x�x�x	�x�x�x�x�x�x�x�x�x�xyyyy#y	&y0y6y=yCyIyQyayqy�y�y�y�y�y�y�y�y�y�y
�y�y�y�y�y
�y
zzz,z@zPz`zfzmzvz|z�z�z�z�z�z�z
�z	�z�z�z�z�z	�z�z�z{{"{9{F{c{k{r{z{	�{�{�{�{�{�{�{�{�{�{�{	�{�{�{|	|||| |	)|3|;|C|
H|S|\|c|p|r|{|�|�|�|�|�|�|�|�|�|�|�|�|�|�|�|�|�|�|�|	}}}}"}
'}
5}	@}J}b}	g}q}v}
�}�}�}�}�}	�}�}�}
�}	�}
�}�}
�}�}	~	~~	~(~.~3~<~
C~Q~U~[~m~z~�~�~�~�~
�~�~�~�~�~�~�~�~�~�~

0;?	NXd
ky��������	��	������	!�+�1�A�Q�X�e�k�����������������ƀ̀Ԁـ�����������%�,�2�9�E�K�T�\�u�
{�����	������
��������ʁЁفށ��������!�'�.�4�;�@�G�M�P�W�]�f�l�p�u�	|���	��������������Ă̂тׂ������	���)�0�7�<�D�I�R�X�^�f�k�q�~�������	����
����ȃу׃߃���	�������%�+�3�	<�F�M�T�Z�
q�|�������������������	DŽфׄ�������$�	,�6�<�B�
J�U�[�	h�r�	{�����	������	������ą
Ʌׅ߅��
����	�
� �-�:�@�G�N�S�
[�f�n�u�}�������������
��
����Ć̆؆��
�����!�8�N�
V�a�n�z���������������	ć·ׇ߇��	��������%�.�4�:�
I�W�n�s�y��
��������������Ljψֈ߈�����
�
��	�&�,�3�@�M�
Y�	g�q�z���������������������ȉԉډ�����������!�(�.�6�?�F�M�m�#z�	����������ŠȊ	͊
׊	��
�����!�3�;�A�G�N�V�^�d�	i�s�	y���
��������������ȋ΋
׋
�
���	�	��"�*�.�6�=�E�K�Q�Z�a�h�m�t���������������ˌԌ���	��������$�+�1�7�?�D�L�T�]�d�m�y������	��������čՍ��������� �	%�
/�:�>�C�I�P�U�\�a�e�k�t�y�����������������ǎΎҎێ���
��&�9�>�D�L�Q�`�
x�������������Ə͏Տ܏���	���	5�?�G�O�a�s�������Đِ���%�7�S�d�u�������ȑܑ���$�8�H�]�z�����Ȓ�"�%� C�d�!}�����ؓ���'�;�P�f�v���������̔ޔ�����	$�.�5�9�H�M�S�X�_�	e�o�u�|�������������ĕЕ���
��,�<�I�V�e�r�������������ŖΖԖ������	���'�9�
P�^�m�q�~����������������������{���	��������������
����™əϙՙ���������	�"�2�B�G�L�R�V�[�a�f�m�u�z�����������������ȚΚޚ������� �(�/�5�<�	@�
J�X�`�f�n�u�z���������������
��ʛқڛ
��������
���%�=�
S�a�q�~���
����Ü
ל���	��	���� �%�,�2�:�A�I�P�V�]�c�j�
w�������
������ǝӝ�����
���"�+�4�<�E�	J�T�]�e�i�o�t�y�~�������������������žǞϞ֞%۞��� �'�,�5�=�	D�N�T�]�s���������	��
��Ɵ�	���	����!�'�6�C�S�e�
k�v�|�����
��������ʠѠڠ������'�
-�8�@�
U�c�r���������������
����ѡסߡ��	����)�-�2�;�@�I�Z�j���
����������������Ţ
ۢ͢����	����
��	$�.�
4�?�L�S�`�l�t�z�����������
��������ǣͣ٣ߣ�������	����
-�
;�I�f�	w�����������������
��ȤФؤߤ���-�=�O�_����������ӥ���
1�?�U�
g�u���
��
��ɦ٦���� �1�G�V�g�	v�����*��§ۧ��
���.�6�=�E�M�\�m�t�}���������������èʨҨبި	�	������ �'�,�3�8�@�H�b�t�
|�����������ʩϩ֩ܩ����
3�A�D�L�Q�V�]�
f�q�������ªݪ���� �0�5�=�	C�M�	Y�
c�q���������������ǫΫ	֫�	����	��	���$�3�@�G�J�P�V�[�c�*k�����άӬج������	�
��
�*�6�O�\�	e�o�v�{���������������������íǭ̭ҭ
׭
��
���	��#�,�2�K�Q�W�_�p���
����������Ю
߮�����&�+�0�5�<�E�J�R�Z�j�y���������������ǯ̯ԯݯ���������$�	0�:�F�S�[�c�p�v�}�������������	������
˰ְݰ����
�$�*�0�A�T�]�
m�{���	��������������	��˱
Ա�����	��%�.�3�E�Y�m�s�
y�������	������Dzв߲�
�������)�.�5�G�Y�l�~�
��������
ųӳٳ
������	���#�
,�	7�A�H�O�
V�a�h�p�
x���	����������������ȴѴ״	�
����
	�
�%�4�;�@�G�
N�Y�_�g�t�{�����������
����˵ѵ	׵�������
���#�)�
:�H�
T�_�p�
��������������ʶ϶Զڶ���������
�"�(�/�5�=�E�K�R�W�^�e�k�s�|���������������������
ͷ	ط�
��
���-�3�B�R�[�a�g�m�r�x�������������ŸʸҸ����
����%�,�2�8�>�E�
J�U�l�
s�~�����
������������Źι۹�������	����%�2�B�X�r�y���������������������̺
ٺ������	�)�/�6�;�A�H�N�T�Y�_�f�u���	������������û˻�
������ �'�,�;�K�S�Z�`�f�
u�������������������¼ɼϼռڼ��	�����	.�8�P�Y�`�o���������!��۽
�����������,�9�B�I�O�T�\�a�j�p�v�~�������������¾ƾ˾Ӿ۾�������
���%�,�4�:�@�F�N�W�^�n�~�
������������˿пֿ�����	���
!�,�4�;�
B�P�`�r������������������	�����!�
?�M�]�d�g�k�
q����������
�����������������������$�*�1�8�A�[�c�p�	���������������������������������'�3�@�F�
K�V�\�c�k�r�������
����
����������������	�!�'�
/�:�A�I�N�T�[�a�j�o�u�{�
������������������
����
���������!�
2�@�O�V�	[�e�	n�x�~�	����������
��	������������� �	'�1�9�	B�L�U�^�c�	l�v��
������	��������
��������	�'�0�7�>�
F�Q�X�	\�f�l�s�����������������
��
��	������	���	
��	 �
*�5�>�E�K�c�s�#������
����	��
��������
&�1�	:�D�L�T�\�c�l�u�{�������
��
������	������	�

��	!�+�D�	M�W�
_�
j�u�
��
������
��
����������
��	��!�.�6�K�a�s���������������.�H�P�
g�r������������������
�!�	0�:�
G�R�a�p�	x���
����
����
��
��������������������-�B�
H�S�f�y�������������������
��������	�����������
���+�2�
>�I�
O�]�e�m��������
���������������	
�
��0�@�R�f�l�p�u�{�
�����������������������$�3�E�R�^�d�|�����"�����"�=�W�n�����������!�6�S�q�����������8�O�h��������������*�1�6�?�C�[�a�g�{���
������������	�������������

�	�"�'�/�4�:�A�H�M�\�k�{�����������������
������������������'�4�:�A�J�N�U�
[�f�~���
�����������������
��%�-�2�:�	?�I�P�`�f�j�y�~���������������
���������������������
�
�!�@�H�O�T�Z�`�f�w�������������	������������������������"�'�.�;�K�S�X�^�c�g�t�|�������������������������� �'�-�	2�<�E�
K�V�\�k�w����	��������������������
������
��#�
3�A�N�`�q�������������������� �,�3�9�=�E�L�R�n�t�y�����
������	��	��������������������������"�(�/�6�<�A�G�L�_�f�k�r�x�}�����������
������������
����	���$�D�V�	n�x�~�������	��������������������������
��
���#�;�A�G�N�U�r�{�	������������������������������
��"�*�1�9�@�G�M�Q�V�]�i�q�y������������������������������
	��	�&�.�7�=�@�O�
T�
b�p�u�}������������������	#�-�	2�<�B�F�	M�W�\�i�n�t�z����
����	������������������
��
	��/�7�G�V�^�d�j�o�
v�����
����������������
������������� �&�,�5�=�L�[�_�d�m�v�{�����������!����������
���!�(�7�<�	@�J�Q�V�Z�b�h�n�v�	{���������!������%�5�	F�P�V�h�z���������������������)�/�3�9�>�C�F�L�S�W�\�b�y�������������������������!�'�0�5�;�?�G�P�W�^�f�m�v�{�
����	����
����������
����������������	����(�1�:�F�K�Q�W�]�b�q�������
������������������!��� �0�B�R�
_�m�
s�~�	����
����	��
��
��	��	����
���"�%�*�2�8�=�B�G�T�
d�r�w�{���	����������������)��&�)A�k�������	��������	�������	���&�-�5�=�F�L�R�Z�
a�l�s�z�����������������������
��

��"�.�	5�?�D�K�R�W�^�f�m�r�w�������������������
��������	�������
�
�"�)�/�
5�@�I�c�i�}�
��������������� �&�,�5�A�E�	M�W�	^�h�w�����������������
�
� �>�	E�O�W�\�
a�l�s�
��������������� ����	��%�*�3�:�A�J�P�T�	Z�d�j�	q�{�
��
����	������
�����������������
����#�	'�1�=�F�L�R�	X�b�h�m�p�u�}�����������������������!����!�'�.�:�@�
F�Q�W�]�i�p�t�z�����������������������
������4�N�U�Z�c�h�q�u�|���������������������������
�	��"�.�
>�L�T�k�	r�|�������������������	�	�	�
�����%!�G�P�V�	^�
h�s�z����������������������	�	���"�%�1�:�C�K�R�m���������	���������&�-�	3�=�C�H�P�Y�s��������������������	����������
����#�,�3�9�=�	D�N�
i�t�{���������������
������
�����
����	$�.�2�8�=�A�Y�a�j�w�z�~������������������	��������
���	$�.�6�M�	]�g��������������
�����+�.�:�Q�	W�a�|�������������������	��)�D�_�t�z�����	������
�����������&@GOU[`m
}����������� %+15;@FOW[cksz���	���	����	)05;JOXau���������������(7
<JW]bgkp
�	����������
�!	-7CJagpv~����������	������� '7?
FTZ`fm������	��������	�&2
>IQZpw
�������������
��	�	"17>GPX^gy���������
"	*4FV]c	jtx�����������	�
����			#	3	8	?	D	K	S	
Y		d	n	v	}	�	�	�	�	�	�	�	�	�	�	�	�	



'
/
8
A
H
P
b
	h
r
�
�
�
�
�
�
�
�
�
�
�

�
�

(/3:>	DN]dmu	{ �������
	'/6
>I
P[b	jtz���� ����
��


.
:
F
W
k

�

�
�

�
�
�
	�
�
	�

�

	)06
=K[a
gry���
������������

*8	>HZbgmt|�����	�	������
��
'
7ER	Zdkry	��������������(� '(Pjqv|�	�������������#�
)BJ
P[gmrx�������
��	��
�
��	+3JWd}���������������	��
&5:BI[	gqx}���������������
��
#	:	DNT]m����������	������	$.49ET\bho)~���
�������
#*19>DLQW^fl~���
�����	������� %
6DL
Xfu~���������
�'�
!)5=C
IT\bv���
���
��"*06=FNT\
iw�����$�"�	
#:Tclu|����������	�
���#).5<MRY^fmsx������������
� %+AGMT
]kw��������������	����+37?F
LWco
{�����������
	17C	LV^ems{��
���	��
����
��	    ! ' + 0 5 	= G K R Z ` o ~ � � 	� � � � � � � � � � � !!+!:!C!J!R!X!l!q!y!�!�!�!�!�!
�!�!�!	�!�!�!�!�!�!�!�!�!�!�!�!""""*"0"6"="F"M"V"]"c"i"o"t"{"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"�"######"#'#	,#6#
<#J#R#j#q#~#�#�#�#�#�#�#�#�#�#�#�#�#�#�#	$$$$#$)$2$9$	>$	H$R$X$i$x$�$�$	�$�$�$�$�$�$�$�$�$�$�$�$%%%"%)%1%=%I%	N%X%`%g%	n%x%~%�%
�%(�%�%�%�%�%�%&&&#&(&8&=&D&I&R&[&a&
f&q&x&}&�&�&�&�&�&�&�&�&�&�&�&�&
�&
''''0'9'A'E'J'Q'V'
b'p'v''	�'�'�'�'�'�'
�'�'�'�'�'�'((($(,(5(<(D(J(P(X(^(
f(q(w(~(�(�(�(�(�(
�(�(�(�(�(�(
�(�(�(	))))")
*)5)<)	D)N)e)k)	s)})�)�)�)�)�)�)�)�)�)�)�)�)�)�)*
**	*%*+*4*<*C*
L*Z*m*r*�*�*�*�*�*�*�*�*�*�*�*�*�*+
++
+)+/+5+:+@+H+P+\+i+p+v+{+�+�+�+�+�+�+�+�+�+	�+�+�+�+�+,
,,!,*,1,8,@,	F,P,V,Z,_,d,j,
q,,�,�,�,
�,�,�,�,�,�,
�,�,�,�,�,�,�,�,�,----	-&-3-:-@-F-	K-U-[-d-k-z-�-
�-�-�-�-�-�-	�-�-�-�-�-..
.+.2.8.>.E.L.U.o.w..%�.�.�.�.�.�.�.�.�.�.�.///%/	*/	4/>/	G/Q/d/l/	x/�/�/�/�/�/�/�/�/�/�/�/�/00	000#0*090H0O0V0c0j0r0{0�0�0�0�0�0�0
�0�0�0�0�0�0�0111'1B1J1Q1X1^1f1
r1�1�1�1�1�1�1�1�1�1�1�1
�122!2*22292B2H2L2X2g2�2�2�2%�2�2�2"�23,3=3L3	`3j3r33�3�3�3
�3	�3�3�3�3�344)4
64
D4R4b4v4
�4�4
�4�4�4
�4�455
 5.5@5
Y5d5m5t5�5�5�5�5
�5�5�5�5�5�56	666#6+6	D6N6T6c6g6l6	r6|6�6�6�6�6�6�6�6�6�6	�6�6�6�6777
7"7*7
<7J7
[7f7o7�7�7�7�7�7�7�7�7�7�7�7�7
�7
�78
88	8	$8.858>8G8P8	X8b8h8p8y8�8�8�8�8�8�8�8�8�899
9%9,9;9G9X9j9z9�9�9�9�9�9�9�9:	
:::!:9:?:G:O:U:\:c:h:o:u:~:
�:�:�:�:�:�:�:�:�:�:
�:�:�:�:;;
;;;#;+;
:;E;K;k;�;
�;
�;
�;�;�;�;�;
�;<	<<<*<	1<;<B<	I<S<
n<y<�<	�<�<�<�<�<	�<�<
�<�<%�<==&=3=8=@=P=d=l=t=z=�=
�=�=�=
�=�=�=�=�=�=
�=>>>>	&>0>6>=>E>L>U>j>�>�>�>�>�>�>�>�>�>�>�>�>�>????	?
'?2?D?M?T?Y?`?i?z?�?�?�?�?�?�?@ @:@O@S@Y@b@j@s@z@�@�@�@�@�@�@�@�@�@�@
�@�@�@A&A9A>ADAJAQAYA_AeAjAqAwA~A�A�A�A�A
�A�A�A�A�A�A�A�A�A�A�A�AB
BB	B B&B,B3B:BKB^B
wB	�B�B�B�B�B�B�B�B�B�B�B	�BCCC(C7C?CCCLCRCXC_C	fCpCuC}C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�CD!	D+DCDZDjD�D�D�D�D
�D�D�D�DEEEE#E(E.E4E;EKEXE`E	lEvE	E�E�E
�E�E�E�E�E�E�E	�E�E�E�E�E�EF
FFFF'FBFTF`FtF�F�F
�F
�F�F�F�F�FG!G8GKG^GuG�G�G�G�G�G�GHH/HAHTHgH{H�H�H�H�H�H�HI-I?IZIuI�I�I �I�IJJ/JBJaJwJ�J�J�J�J�J�JKK-KJK_KqK�K�K�K�K�K�K�K�K�K�K�K�K�K�KLL
LLL$L*L2L9L@L
FL
TL_LgLmLtL{L�L�L�L�L�L�L�L�L�L�L�L�L�L�L�LMM!M*M1M6M<M	CMMMRMYM`MgMnMrM~M�M�M�M�M�M�M�M�M�MN	N N%N'5N]N
rN�N�N
�N
�N�N�N�N�N�N�N�NOOOO	%O
/O:OAOJOOOjOsOyO�O�O�O�O�O�O�O�O�O�O�O	�O�O�O	�O	PPPP	 P*P1P6P:P?PGPNPSPXP_PfPlPtP
�P�P
�P�P�P�P�P�P	�P�P�P�P�P�PQQQ Q
'Q2Q:QBQJQRQXQ^QeQ	kQuQ�Q�Q�Q�Q�Q�Q
�Q�Q�Q�Q
RR)R2R8R>RERKR
QR\RaRhRnR{R�R�R�R�R	�R�R�R�R�R	�R�R�R�R�R
�R�RSSS%S.S7S?SDSHSKSQSYS^SdS	iS	sS}S�S�S�S�S�S�S�S�S�S�S�S�ST
T T-T
:THTWThTtT�T	�T�T�T
�T�T�T�T�T
�T
U
UU+U
8U
FUTU
lUwU
�U
�U�U�U�U
�U	�U�U�U�UVVVV+VEV]VoV�V�V�V�V�V�VW$W8WIWbW{W�W�W�W�W�W�WX)X?X*[X�X�X�X�X�X�X�X�X�X�X�X�X�X�X�X�XYYY(Y.Y5Y;YBY[YaY	fYpY�Y�Y�Y�Y�Y�Y�Y	�Y�Y�Y�Y�Y�Y�Y�Y�Y�Y�Y�Y
ZZZ&Z,Z5Z=Z
JZUZ]ZeZlZuZ}Z�Z�Z�Z�Z�Z�Z
�Z�Z�Z�Z�Z�Z�Z	�Z�Z�Z�Z�Z[[[[[	"[
,[:[K[Z[	a[
k[v[|[�[�[�[�[�[�[�[�[�[�[�[�[�[�[�[�[�[\
\\2\:\@\D\L\Q\V\[\`\d\i\p\x\�\�\�\�\�\�\] ]']	,]
6]D]K]\]h]o]u]{]�]�]�]�]�]�]�]�]"�])�]	^^^	*^	4^>^E^N^S^Y^n^u^|^�^�^�^�^�^�^�^�^�^�^�^�^�^	�^_
____#_*_!3_)U__�_�_�_�_�_�_�_�_�_�_�_�_�_�_�_�_�_�_```3`C`W`i`q`�`�`�`�`�`�`�`�`�`�`�`�`�`�`�`	�`�`aaaaa"a*a7aFaZafa	za�a�a�a�a�a�a�a�a�a�a�a	�a�a�a�a�abbbbb5b<bDbMbSbYb`bib
pb~b�b�b�b�b�b�b�b�b�b
�b�b�bcc.c4c:cCcUc\c`cgclcsczc�c
�c�c�c�c�c�c�c�c�c�c�c�cdddd
9dDdLdQdZdid
qd|d
�d�d�d�d	�d�d�d�d�d�d�d�deeeee	+e5e>eFeNe	Ue	_eieqeye�e�e�e�e�e�e�e�e�e�e�e�e�eff f'f-f3f9f?fHfOfWf	`fjfrfyff�f
�f�f�f	�f�f	�f�f�f�f�f�f�fg
gggg#g)g/g8gDgIg
Ygggvg}g�g�g�g�g�g�g�g�g�gh	hh!h(h	/h9hMhchlhphwh{h�h�h�h�h�h�h�h�h�h�h�h�h
�h�h�h
�hi
ii%i)i.iEiKi	OiYibiiiui}i�i�i�i
�i�i�i�i�i�i�i�i�i�i�i�i�i�ij
jj/j>jSjZj`jfjkjqjwj}j�j�j�j�j�j�j�j�j�j�j
kk+k:k
LkZk`kgkmkskxk}k�k�k�k�k�k�k�k�k�k�k	�k�k�k�k�k�k�k�k
�kll)l	.l8l@lMlTl[lklrl{l�l�l�l�l�l�l�l�l
�l�lm"m
5m@mEmNmVm\mbmimpmtm
{m
�m�m�m�m�m�m�m �m�mnn#n,n3n
;nIn
OnZncnjnsnyn�n�n
�n
�n�n�n�n�n	�n�n�n�n�n�n
o	
ooo%o-o	HoRo
Zo	eooovo~o�o�o�o�o�o�o
�o�o�o�o�o
�o�o�op
p!p'p/p8p@pHpQpZpaphpqptpyp~p�p�p�p�p�p�p�p�p�p�p�p�p�pq	
qqq"q(q
?qMqlq�q�q�q
�q�q�q�q�q�q�q�q�qrrr
!r,r2r
?r
JrXrdrmrvr|r�r�r�r�r�r�r�r�r
�r�r�r�r�r
�r
�r�rss&s
8s
FsQsWs\sbsjs
qs|s
�s�s�s�s�s�s�s�s�s�s
�s	�s�s�s
ttt%t*t9tEtIt(Ut~t�t�t	�t�t�t	�t�t�t�t�t�t�t�t�tuuu
u
'u
5u
Cu
Qu_ukuqu	wu�u�u�u�u�u �u v,vCvSvdvyv�v	�v	�v�v	�v
�v�v
�v
�v�v�vw		www'wGwPwiw�w�w�w�w�w�w�w�w�w�w�w
�wx
	xx#x,x
2x=xLxYxex
qx|x�x�x�x�x�x	�x$�x�x�x�x	�x�x�xyy
yyy(y/y7y>y
CyQy	Wyaygyoyvy
~y�y�y�y
�y�y�y�y�y�y�y�yz	zz9zKz^z|z�z�z�z�z�z�z{(,{U{m{�{�{$�{�{�{|#$|H|Z|
r|�| �|�|�| �|}}8}H}O}U}m}�}�}�}�}�}~"~<~E~N~V~^~d~j~q~
z~	�~�~�~�~�~�~�~	�~�~�~�~�~�~�~�~�~%,5=EKRW^d	isx�
���������
����	�	���
(�6�F�O�U�	Z�d�l�	r�|�����
��������€ˀр���
�%�7�D�S�\�t�������
��
ŁЁف������������#�+�3�;�C�J�O�U�Z�_�h�n�u�|�����������������‚ȂςՂ�������	����#�/�5�B�G�L�U�^�d�k�s�x�}�������������
����	ƃЃփ܃������*�3�<�D�b�f�
k�y���
��
������
��ńՄ	ۄ����
��
$�
2�=�I�	U�	_�i�n�
z�
��������������Å	˅Յ(݅���%�	,�6�	?�I�O�`�o�����
����
��������†džΆՆ܆��	����
��(�1�7�I�Z�m�~�����������������
��LJ
և!�
���&�,�2�7�@�F�M�R�Y�
a�o������������	��ʈЈ؈��������
���'�.�6�<�I�X�]�i�u�}�������������ʼn	ԉމ	�
���	����'�.�3�@�G�L�S�Y�a�h�n�w���������͊݊���"�(�0�9�J�d�i�p�}�����������������
��Nj̋ԋً��������
�(�0�9�	>�H�
O�Z�i�p�w�}�������
��	����������Č
̌׌ތ��������&�	.�8�>�M�R�[�`�h�n�t�	|�����������������ȍэ׍܍�	������ �)�/�5�:�	C�M�	U�_�g�n�s�{�����������������Ď̎Ҏَ���	������6�	>�	H�R�[�b�f�l�x�}���������������̏ԏ܏����������%�5�A�J�d�	m�&w���������������Ɛ͐Ґِߐ�
��������3�J�`�	f�p�y�������������������ڑ
�����#�	5�?�L�P�m�|���������Œ֒ޒ��
�
 �.�;�B�H�P�U�Z�g�x���������Ɠϓ֓ߓ���������
��� �&�+�4�:�B�I�Q�	W�a�h�m�	q�{�
��	��
����������
ǔՔڔ���������5�D�L�R�i�����ȕЕו�����!�5�9�>�O�`�g�
n�y��������	����
����–ǖ̖	Ֆߖ
����
��%�,�3�	9�C�K�	O�Y�a�h�q�}�������	����������ėʗٗ������	!�+�	3�=�C�I�O�W�[�`�g�o�
w�����������������	˘՘���
��/�8�I�b�s���������řٙ�	������
���	!�
+�6�>�O�`�
h�s�z�����������������	š̚	ޚ�����%�+�	4�>�R�j�~�������ʛћٛ���������&�5�<�E�L�S�Z�b�j�p�y�����������������Ҝڜ�	�����
�	��#�)�C�J�N�U�\�	b�l�x�
����
����	����	ŝ	ϝٝ��������"�'�.�3�:�@�G�O�X�_�e�l�q�v��������Ξ������	���!�(�.�6�
>�I�	N�X�]�d�k�
q�|�
������������	˟՟
��������-�=�N�]�i�q�y�}����������������� ȠΠנ���	�	�$�+�2�8�>�D�J�S�W�]�	e�o�v�{�������������������š̡ѡ١ޡ��
����
���%�	(�2�:�?�K�S�Z�a�h�q�v�|���������	��	������ɢբ
������
��	�"�+�3�:�A�
I�W�k�z�����	����
����������Σԣܣ��
����
����".�Q�f�x�������פ����
�)�;�K�Q�	Y�c�j�s�%y�
������Хߥ���	�
��#�	+�	5�?�F�K�Q�Z�c�l�	u����������������������	ƦЦ٦	ܦ���������#�8�K�P�V�_�k�p�w����
����������
����ǧϧ������&�/�5�<�V�^�d�j�r�
z�	����������	��������ƨݨ����"�)�1�	8�B�T�d�k�r�y���������	����������éʩϩԩ	ݩ����
�����$�&�/�6�;�D�J�N�S�Y�]�a�g�n�s�x�
����������
��Ū˪Ъ֪ު
�
���� �	%�/�4�
G�R�	W�a�i�	r�|���
��	��
����
����	��	˫ի	ݫ���������4�C�J�'P�x�}�
����������Ŭͬ֬۬��������
�!�%�	4�>�J�
Q�!_���������������í	ȭҭ	׭������
�	���
/�=�D�Q�W�n�u�|���������������ĮɮҮڮ���������"�)�5�	;�E�M�i�
o�z��	������
����������įͯүد߯����
����"�(�/�4�;�A�D�K�Q�Z�`�d�i�	p�z�	������������������Ű˰ذ��������
��$�+�0�8�=�F�L�R�Z�_�e�
q������	����
������ıʱұٱ��	������	����&�	/�9�@�G�M�
d�o�{�����������������	��IJʲֲ۲������	�'�-�3�
;�F�L�	Y�c�	l�v�~�	������	��������
��ȳгֳݳ
�������
�(�.�5�<�A�
I�T�\�c�k�p�v�|�������
��
��������ʴҴش
޴������-�C�
K�V�c�o�{�������������	��õ̵Եٵߵ	�������
���#�)�/�
?�M�f�k�q�w�
~���������������Ƕζ׶߶���
����	��$�+�
8�C�
R�	`�j�s�|���������������������ȷη׷��������
���"�*�3�:�!A�c�'p�	������������¸	Ǹ
Ѹ	ܸ�
������9�A�G�M�T�\�d�j�	o�y�	���
������������ƹιԹ
ݹ
�
���	�	�"�(�0�4�<�C�K�Q�W�`�g�n�s�z�����������źʺֺߺ����	�����#�(�/�6�<�B�J�O�W�_�h�o�x���������	������ǻϻ����������*�	/�
9�D�H�M�S�Z�_�f�k�o�u�~�����������������μԼۼ߼���!�'�9�I�N�T�\�a�p�
��������Ľͽӽ۽��������$�-�4�	N�X�`�i�|�������Ѿ����%�8�J�]�z�������ǿ���
� �0�C�V�k�|���������#=�a�!����"������%�5�I�_�t���������������
� �3�D�W�^�c�
i�t�{������������	��������������������
��2�A�Q�b�s�������������������������7�=�B�I�U�[�b�s���
���������������������������	�
C�e��
-�W��
\3�Vz�
�$�UO�S.�X�	- �|�w]��U�
T�����
m/@dWeb���Bt�x
X[qv�jY��	 �m��
����
�>��^%�s�ksN�� 
������	�Ky�ya��-��2
-
�����M	d���	������		�PL��@�
��p.l��!s�^�~����
8�	 ��
������S
���(�iR���)`
�=�
5��	�
��Q�(
)
�7�_�����	�[�=H��$��J��o*k�����G�2���	�����$
�K�;
y��X�3
���Hi�H\
R���E�W
���z����
�����-T���~��#>	�	[�aO&_�
��x	��p����	�p�'�t��	� �PD���8
u�A��7u�O�
AJ�	��	V�^?�_-j}q
/����s�0
ri�g	��
,m
��
�,E[f��
��E�I�	 M��L�Yb�		�,J�#�����O!q��@
#�V.z�;\�����|NDd	0�S5	�b'���8��y��	6��zZ��^HZ
�:��IP�~��8����w�4�
M(��FwR�NCZ.
[XY��~	���u
��d��h��1�
>
W�(��%N����r�zKs��������	���/	
=�Q�#��!
n�w��CE
@1�
>:���As�e���yo	�6�:q���{
���p�q�]�){��A��"�e`���	e���X�i��
�[��t��}
n&�	�
��
�\4����'V
��q"
�	N�>�~
�

�
3%
a�u�r+�2n�X^��t������
���(u����
�	a������
f+
�	��	�U���?����x1N
4,
gZE	��s�>b
]��
b:.
���'������
;��f	1�<����IYGw�M
�>
1	��+�K	m�Q=�����	&�#�P����
��-�6�	��
 �VC��q���
-�R>/T��D���p
[����\�=�n�"��:����1
>x�f�Y
���$	o�X@	
���	�	
�A��	�
 ��9�U��
]f�����	O
�X��d#�<��1�S]uW�J
�6
�G�m�����J
��NX
e9}�0�S��]������
^�S�
���W�V��7�!/rR
������^��Q�����m����{��
(o�
�R����<(n0�4P_����M�^q]p�]��3���Z����)�a�����*��D�Ddj�p	���x�����
5	��6	\*�L
-������
#}c�X6���g�Q��(�g����	6w����?TT�
�'
w	
�dJz���BY�<�6����b?�����k�W1�/��=Q��h��M�b�����6��t�����%)����:�^#s��qIN7�:�m��r-h	1B��~���	t
�v	��;�
����K
	
��
����z�F�)�
H���Y
l��d��]�
��
�.�M�����P�z9��E����4w�
�o�_��+��;�@f@
z�&
���!k��	�
P	C�����O�
k�����l��^�1
�h�7g(�Sl��I�
1	
{�6�
F4��&���	��6f�
Om�=2
��
{a4���UTJ���B|��>�"|���UV�A�%=�69Tg�
���
�
�G�hxUX����	�����
���
4t����uc��wFk��%��r�vb|7}&7�$����EE0t}
Lr����		�2���!h{�ol��dB	+�yx�"8H
��8k��	g���xI�E��v���
����Q�-���
"�Z^
=	��"	[I����1z1����6L��,��,~���~w��(��
9{2;�\�
aO�p�8GWD"P�
�Z	�����{�
�2���(
�M�A_�

��)���x��I��	+���
���
S�Y��
P�6_��s
� �l^oc��w�+I���Z�
#�P}�
��Y�'o*
�m~pSJ3\54
i�Hn�	��"x�o��F�
�	���=	��,
	bcR.5X���nT�	0���
F
�m9�e	��#[
���������/�U�����|jb�
��6���L���Y��6*
��.�
�+
��]�
,n���
kSr��_	<#��E		@�t� �
�\�M��
v�
�xvoq��s���:�	���;���
V�)�t|�F��	�%
Dp?��(7B����
������X8
�vW�
��
��=�Q��9
������]b��_$G���7	�j��m�{�
Xl
�
4*�
�G%y��
���RW	l�	�
U��gR��
"�	
	D
)

��B��
��[����A��t�
�������
[B�	�_~�	f�[hnk�h��{�c������?
2�
�n.]O��< ������5?��:�SJR�������4
��|4�:	����hO� ��
���C
3X����R	�D
z�w>�%D�}�Fo������
�����e'�~F�
 ���#
O���m<��}�N��=�S���RbX
5��	B�%QH��V`�
��b�	&�#�~}$�V)*
�	Zn_����
����rk2�J7�
�55	����`dU�h��Nsbx(�-
[	�0�{:�����c&M�i��
5�	3R:r�L�"
�E���V
�,GW1K�!

�
�d�4�ee@�	��	�	^��q ���N�V���"��
��x���Q
.���MuT�

��\���
L���m9
���O(j���M	-�
.�Q��
�s�i��Z��f�[�����u���8��	
���lO�o�$$%�}
N�qm��Sq�N������
&���f��
O�F�����@����	%���������
���
��,�5��t	�GR���o�=
�
�T�aA����Y	�hs�n�~C��<�i��/�	�4a3Zf	�A	�
}e�K
Y&U�����	7�(�Y&��J����"��)���o<�4�cr��;��X�)u	����I	��
b_�\~��
dna�K�;��>�
7��V:X
������T;��_0�F��a�!=�%� 
L����5��I��9g���+k������FA���	k��
|�f
�m�i1���Q;����+P
��1&C[
���t	���
��
:ET�_2�]��{7
�t��E��-	���q	�A6
����s8��	������P���D	�QT�4Bh��K|eMj	�L�`����#NU�{9<���!������CMf���bg���
�~{��xB2��g�^:����������X��4�5P�'�Yg -<������R
S"��	�
��\G
�'
�c/�MCl�
��

��;�v\	��E!u$Oi��������i�%�	����_��{�h�u/k:��
u�HB
���^
�
	�vy���lq
���/��������	n	�����2��
�����?�K�'�
���c�qT>J�R� p�!C!d"�ZG/�F
/���~���,��y���+sa((��*E)z���2.�HW����,�~�"���

GmU��/&���q�����]x�C,MN�@�)cKl
~
���?�@[�0�Lr�L	���70aj������0n�cn�
)~43��t^����
!�:
��	C��y�P������Z�&:
t�W
�����J���	
�=+��v��������	(	�P�y	
���I���I�Pj�1s

��]5
�YG�9
	��	���'i���
����g���7`��)��
���ySy�]	��?v�L]
8&N$�d��~z	�}K� 	%e7�
�c��S�A�_m
|���7�I	6d�?	B�XL�
�+O���5j
��f
{�������1�	}�^`U'C�
<E�=
d5���PN	�t:G���f
�=L�7"x-5���r�1<������2��f�
N�v�h
��V
F�	V		d�..$���	��CS�r	T�!�D��y�
��
]!�/����#J�
"F%m�`�	�
��
�>�x����\�����	gt����
����
Q�-�H�X		���
��
 �ik_�
T
&�
��$=��l��Nw�i	��y�Q	-������+T����>J��	!
����?���
+���}	�k8I�n����s/��	�l�tv�Py�8z�����&x�	~�'�
������a,�J���y�L�L��
NI�W���X����	>�M�8����

�+��0
���p�D%�
��*Z��0���:�W��	F�F�rgZJD��
2L��J	�T69#
�&	��I)u�
0�	s���n
P�	����	��T���u��>�<G���!"�:>�x��RW
*D��3
�*���
��M�	;����@hi����V4��h����?��,Q�
	�tm�
�tKH�l�w$�.�n�
�rPV
O
�[W���M�	gY�>��
����~�
n����t�
����
�F@$�	z�
J��5
�	�
o|���|���0���	�=0i���u��2�
	���L3�z���jPO�V��
�9�39�
�
��%�y��5��	�w�3n�/tG"�M��W��e"+�d	�	r
-����M!�.���(���
?Z����B�Q^Y_��	�.���K������
E��&���7��=�	R	��C�l��P;�
�3�
g
/�p�c�
�s:�
���
k�����%���ng01�h��N�	��	I�
�K�1@���y5k��(%^<8?��	7����P�
:G��eH�g9H"J���I
�V�
�
����u�*�	�>�3HsS�Q��'�1��	r
Y��`�&
��{��
���F�Sm�j��5����#�	��.jxs�pg��]
�Q�B�
q@+q
b�,k'�7�2A
$8,�
���L�
��}�'�	�
�
��I~�!	vo
=�j���I
0x���	�?3���"/�d�lK dG`q���Q-��0��
�91��>
�`����;a�O�/�J�V i=%	�+�[gg����6�GZ�
!(*�r�A��
����3����(m*`���W%?"����}T��/\������	a-'�2/	�/.	�%U�EQ�@�L�B2	�U
a
���\������U	�T	�m�
l��\3	;e.j�E
��qF	�*V���V���
�@*� �4	��po
��
<@OH?�n���r.8	~���H
"k�w�	[��'��A�U�F����qN�
�O*	C�e�
=
]�
#Z��i����
��f?���I���|	eEjg�NYP;	:�x�
_��c)��e
���
���?_|�\	c!��	��/
��i��������
��M7�����<	{l�
i
�jD��
��
:��	B[cp�����a3������-�4�j`z+4�����9	<�
}��?�\_�[��
6;
�
���IQ��n���-{Dm	8�#�6�O�pr�[P�J����/8;7@��	C<7��J�|�x�n	��	?�2z�(�N4R�Pw	\
�
�<
W��d���/
�Z�
�N���	_c��*

��(%��
����%c
�vi
(m	��'���a�q	*j�47�
$�D��A�J��b^C5�k
�M@Jv��
D�0X��%)e�-]M��0�L
��<
�v.I��K
��Z�D�����
��?
Y�kP
���5
��	����ow
���
��2�oL���D�	�R����>��oD�H����@wX�j'�3s}^���[@
��H��hI'��
o�f#�:���	1����
������\�#�a���E\�Y��{^
,�FO[�j[�dZW�\����
��{������cb4�HX���A�+0�c��	u�9L�_
Q
`
}}�tWB��H)���&qK���y��
�����uod
YwA��g
'	
<����<h
n��Qm��?*if��
����s!z���f�h	x�
�_t
;9:���\[y
8.�#	���
g��	�%hx��	��|5�V������^& �f�B�&@�|�_�	���'��\`rLaF�^�,,z
E����{
Xy
n
��#}��	G�+�B
���F�'�p���]
��fh�����
��|uWe��� ��
��
dU
	2�|a���
{Gs���l�F*z�
Bp��
��	b$
�|�H��k�|��s�u��	 w�/�	���,b
zO�99��d�oeBd
�
�w�
6�m�	+e��fT�
�{Y��9Uuc+�~
�X���wI8��/2bwH	��
�R��
���	B�8="��Ro��`��
7T�`2;�G��<>���!3�����$�Q	9�F�
�S	���i��
�)�t��#
���vn�0����1r�	
��
b	L;�
�N�(�����$7
�W3�
cj�eb�$;zQ*�����o��n��qv
�$��?����UwK��]�
����E'�
���,�
��ul$��i��:]��v��R?U�p����K��0P�e��z�	�D�`�&�{au�{	c��|!����h�3�j��(	h��
�#�.h�cv;��w
��0U,��������D��v�z+��p&&�Hh+�
2�r�	c
���	���M�x��`	�f��hA�
)�m
�l~��Z���
��w���Z�
*a-��|���
�K?
��
69�
&�N
=��!Kp
�
��_�	�B
C��C��`A<���
vW��3a	R@1��������u}Kdzo�u���-��96
�CB�w	S��A�.��Y@�y=�yV�0���U{e��Z?R]���'�B�u
`�;��+�Jj
���A
		2eH�
`?���<J�<�
�)�JZ
2F�
C����	9�F������H���
MT]����U5
�!K����b��
9�����>�Wk��
�T8�`�
������
Q�������C
��,�8����f����0�I�
���)	~�C��	 �>���h<�}l�B����qq�
	���%+�\�Z`|
��YjyA�v�	�0	���v��������S	����*�=�������#�p��O	����
��4v
����;�t����@�|�
��D�}&��J��s}��!��#��H'��	��
���
x�`��������[��
�
`���ia
DE�������Li]%
�
��
����	���k
8�
��	���)o3,��
�WV�A��i(2��\p��!��~8�
]���+	}���'Q)��1�q_�O�
V�
A`�
�
^k	��
3�M��$>g���
�A
�
�� #�
�G��"�~�M��\�WR���.��
����3)�H"Z6��1dC���`��7&2�S�	�-'���
����p�lj������	�\,��E4p�@rE��
�
Y���
k�������6��
�L_k|Vb
b��H��
�X�(�����)vP���
��%$saVf�����D$N��	/
r����G	b���*�T���
4�G�
,���
UB���V.�Q5

5�	���l�
�$]KS
N�>�	�
��K��	��$� ��.�7�;�j[`�3����u�4c"���}�1������r�K��&8�S
�c��
r�
�	�
��rSG
�	�D6AT=�FZ�p��g��
�
B��=8�b��fSI�	��:�C�c���
"�K^��kR���5�>��	��
Y�m����
|
�'
	�����
���!�G-
�� �	8;����^����d
�s	�����	^(�	!UE��
��
*)���/�GA������*
���
�
��W�����f���	���y|�O�������y���
�������
����.�
C	��+�����{�uZ�	s�SE�oSO�;La���o�*�h
����T
��0���z6��Y�	�����U�9�,�
Y����3pOz�D��	G�����	�X�j@R��
�
��	�l#,��j[g�k�}��
t5c	_
x
�
q���	�mR*�l��
f�	��v�v�y$��
��l#w
>���g^	l	�t{��9Ce<�ii�������U-��������������y
�x�z
�
�
e
T���
��	.��Ea-�� �����I�����*p�,	��K��
�$)����M
��
����!Xóõ'Are'are'Auhelawa//Ani//Gana//Xegwi/Gwi/Xam=/HuaA-PucikwarAariAasáxAbadiAbagaAbai SungaiAbanyomAbarAbauAbazaAbidjiAbinomnAbiponAbishiraAbkhazianAbnaki, EasternAbnaki, WesternAbomAbonAbronAbuAbuaAbuiAbunAbureAbureniAbéAchaguaAchangAcheAcheronAchiAchineseAchterhoeksAchuar-ShiwiarAchumawiAchéAcipa, EasternAcoliAcroáAdabeAdaiAdamorobe Sign LanguageAdangAdangbeAdangmeAdasenAdeleAdholaAdiAdioukrouAdnyamathanhaAdonaraAdugeAdygheAdzeraAekaAekyomAequianAerAfadeAfarAfghan Sign LanguageAfittiAfrihiliAfrikaansAgarabiAgariyaAgatuAgavotaguerraAghemAghuAghulAghwanAgiAgobAgoiAgta, Alabat IslandAgta, Casiguran DumagatAgta, Central CagayanAgta, DicamayAgta, DupaninanAgta, IsarogAgta, Mt. IrayaAgta, Mt. IrigaAgta, PahananAgta, Umiray DumagetAgta, Villa ViciosaAguacatecoAguanoAguarunaAgunaAgutaynenAgwagwuneAhantaAheuAhiraniAhomAhtenaAhwaiAi-ChamAighonAikanãAiklepAimaqAimeleAimolAinbaiAinu (China)Ainu (Japan)AiomeAiroranAitonAizi, AproumuAizi, MobumrinAizi, TiagbamrinAja (Benin)Aja (Sudan)AjawaAjiëAjyíninka ApurucayaliAkAkaAka-BeaAka-BoAka-CariAka-JeruAka-KedeAka-KolAka-KoraAkanAkar-BaleAkaselemAkawaioAkeAkebuAkeiAkeuAkhaAkhvakhAkkadianAklanonAkoletAkooseAkoyeAkpaAkpesAkrukayAkukuAkumAkuntsuAkurioAkwaAl-Sayyid Bedouin Sign LanguageAlaba-K’abeenaAlabamaAlagoAlagwaAlakAlamblakAlanganAlanicAlapmunteAlawaAlbanianAlbanian, ArbëreshëAlbanian, ArvanitikaAlbanian, GhegAlbanian, ToskAlegeAlekanoAleutAleut, MednyjAlgerian Sign LanguageAlgonquian, CarolinaAlgonquinAliAlladianAllarAlngithAlorAlseaAlta, NorthernAlta, SouthernAltai, NorthernAltai, SouthernAluguAlumu-TesuAluneAluoAlurAlutorAlviri-VidariAlyawarrAma (Papua New Guinea)Ama (Sudan)AmahaiAmahuacaAmaimonAmalAmami-Oshima, NorthernAmami-Oshima, SouthernAmanabAmanayéAmaraAmarakaeriAmarasiAmba (Solomon Islands)Amba (Uganda)Ambae, EastAmbae, WestAmbaiAmbakichAmbelauAmbeleAmblongAmboAmbrakAmbrym, NorthAmbrym, SoutheastAmbulAmbulasAmdangAmeleAmerican Sign LanguageAmharicAmiAmisAmis, NataoranAmoAmolAmpanangAmtoAmundavaAmuzgo, GuerreroAmuzgo, IpalapaAmuzgo, San Pedro AmuzgosAnaangAnakalanguAnalAnamAnambéAnamguraAnasiAndaiAndaquiAndarumAndegerebinhaAndhAndiAndioAndoaAndoqueAndra-HusAneityumAnemAneme WakeAnfilloAngaatahaAngalAngal EnenAngal HenengAngikaAnglo-NormanAngloromaniAngolarAngorAngoramAniiAnimereAnindilyakwaAnjamAnkaveAnmatyerreAnongAnorAnsermaAnsusAntakarinyaAnuakAnufoAnukiAnusAnutaAnyinAnyin MorofoAohengAoreAp MaApache, JicarillaApache, KiowaApache, LipanApache, Mescalero-ChiricahuaApache, WesternApalacheeApalaíApaliApataniApiakáApinayéApmaApurinãAputaiAquitanianArabanaArabelaArabicArabic, AlgerianArabic, Algerian SaharanArabic, AndalusianArabic, BaharnaArabic, ChadianArabic, CypriotArabic, DhofariArabic, Eastern Egyptian BedawiArabic, EgyptianArabic, GulfArabic, HadramiArabic, HijaziArabic, Judeo-IraqiArabic, Judeo-MoroccanArabic, Judeo-TripolitanianArabic, Judeo-TunisianArabic, Judeo-YemeniArabic, LibyanArabic, MesopotamianArabic, MoroccanArabic, NajdiArabic, North LevantineArabic, North MesopotamianArabic, OmaniArabic, SaidiArabic, SanaaniArabic, ShihhiArabic, SiculoArabic, South LevantineArabic, StandardArabic, SudaneseArabic, Ta'izzi-AdeniArabic, TajikiArabic, TunisianArabic, UzbekiAragoneseArakiAralle-TabulahanAramaic, Jewish Babylonian (ca. 200-1200 CE)Aramaic, Jewish PalestinianAramaic, Official (700-300 BCE)Aramaic, SamaritanArammbaAranadanAranama-TamiqueArandaiAraonaArapahoArapasoArapesh, Abu'Arapesh, BumbitaArawakArawetéArawumArboreArchiAreArebaAremArgentine Sign LanguageArgobbaArguniArhuacoArhâArhöAriAribwatsaAribwaungArifama-MiniafiaArigidiArikapúArikaraArikemArinAringaArmaArmazicArmenianArmenian Sign LanguageArmenian, ClassicalArmenian, MiddleArop-LokepArop-SissanoArosiArpitanArrarnta, WesternArrernte, EasternArtaAruamuAruekAruopArutaniAruá (Amazonas State)Aruá (Rodonia State)Arára, Mato GrossoArára, ParáAsAsaro'oAsasAsheAshkunAshtianiAsháninkaAshéninka PajonalAshéninka PerenéAshéninka, PichisAshéninka, South UcayaliAshéninka, Ucayali-YurúaAsiluluAskopanAsmat, Casuarina CoastAsmat, CentralAsmat, NorthAsmat, YaosakorAsoaAssameseAssanAssangoriAssiniboineAsturianAsu (Nigeria)Asu (Tanzania)AsumboaAsuriAsurini, TocantinsAsuriní, XingúAtaAtakapaAtampayaAtayalAtembleAthpariyaAtiAtikamekwAtohwaimAtoradaAtsahuacaAtsamAtsugewiAtta, FaireAtta, PamplonaAtta, PudtolAttiéAuAuluaAuráAushiAushiriAustralAustralian Aborigines Sign LanguageAustralian Sign LanguageAustrian Sign LanguageAuweAuyeAuyokawaAvar, OldAvaricAvatimeAvauAvestanAvikamAvokayaAvá-CanoeiroAwa (China)Awa (Papua New Guinea)Awa-CuaiquerAwabakalAwad BingAwadhiAwakAwarAwaraAwbonoAweerAweraAwetíAwingAwiyaanaAwjilahAwngiAwtuwAwuAwunAwutuAwyiAwyu, AsueAwyu, CentralAwyu, EderaAwyu, JairAwyu, NorthAwyu, SouthAxambAyabadhuAyereAyi (Papua New Guinea)AyiwoAyiziAymaraAymara, CentralAymara, SouthernAyoreoAyta, AbellenAyta, AmbalaAyta, Mag-IndiAyta, Mag-antsiAyta, MagbukunAyta, SorsogonAyta, TayabasAyuAzerbaijaniAzerbaijani, NorthAzerbaijani, SouthAzhaAzheBaanBaangiBaatonumBabaBabangoBabankiBabar, NorthBabar, SoutheastBabatanaBabineBabuzaBacamaBactrianBada (Indonesia)Bada (Nigeria)BadagaBadeBadeshiBadimayaBaduiBadyaraBaegguBaeleleaBaetoraBafanjiBafaw-BalongBafiaBafutBaga KaloumBaga KogaBaga SitemuBaga SobanéBagheliBagirmiBago-KusuntuBagriBagupiBagusaBagvalalBahamBahauBahinemoBahingBahnarBahonsuaiBaiBai, CentralBai, SouthernBaibaiBaikenoBaimaBaimakBainouk-GunyaamoloBainouk-GunyuñoBainouk-SamikBaisoBajanBajau, IndonesianBajau, West CoastBajelaniBaka (Cameroon)Baka (Sudan)BakairíBakakaBakhtiariBakiBakokoBakoleBakpinkaBakumpaiBakwéBalaesangBalangaoBalanta-GanjaBalanta-KentoheBalantakBalauBaldemuBali (Democratic Republic of Congo)Bali (Nigeria)BalineseBaloBalochi, EasternBalochi, SouthernBalochi, WesternBaloiBaltiBaluan-PamBaluchiBamako Sign LanguageBamaliBambalangBambamBambaraBambassiBambili-BambuiBamenyamBamuBamukumbitBamunBamunkaBamweBan Khor Sign LanguageBanaBanaroBanda (Indonesia)Banda, Mid-SouthernBanda, South CentralBanda, Togbo-VaraBanda, West CentralBanda-BambariBanda-BandaBanda-MbrèsBanda-NdéléBanda-YangereBandiBandialBandjalangBangalaBanganduBangbaBanggaiBanggarlaBangiBangkaBangolanBangubanguBangwinjiBanivaBaniwaBanjarBankagoomaBankonBannoniBantawaBantayanonBantikBantoanonBaouléBaraamuBaraiBarakaiBaramaBarambuBaramuBarapasiBarasBarasana-EduriaBarbacoasBarbareñoBardiBareinBareli, PalyaBareli, PauriBareli, RathwiBargamBariBariaiBarijiBarikanchiBarokBarombiBarrow PointBarugaBaruyaBarweBaréBaríBasa (Cameroon)Basa (Nigeria)Basa-GumnaBasa-GurmanaBasapBasayBashkardiBashkirBasketoBasqueBassaBassa-KontagoraBassariBassossiBataBatakBatak Alas-KluetBatak AngkolaBatak DairiBatak KaroBatak MandailingBatak SimalungunBatak TobaBatangaBatekBateriBathariBati (Cameroon)Bati (Indonesia)BatsBatuBatuiBatuleyBauBauchiBaureBauriaBauwakiBauziBavarianBayaliBaybayanonBaygoBayonoBayotBayunguBazigarBeamiBeaverBebaBebeleBebeliBebilBedjondBedoanasBeekeBeeleBeembeBeezenBefangBejaBekati'BekwarraBekwelBelaitBelanda ViriBelarusianBelhariyaBeli (Papua New Guinea)Beli (Sudan)Bella CoolaBellariBemba (Zambia)BembeBena (Nigeria)Bena (Tanzania)BenabenaBenchBendeBendiBengBengaBengaliBenggoiBengkala Sign LanguageBentongBenyadu'BeothukBepourBeraBerakouBerawan, CentralBerawan, EastBerawan, WestBerikBerinomoBeromBertaBertiBesisiBesmeBesoaBetafBetawiBeteBete-BendiBeti (Côte d'Ivoire)BezhtaBhadrawahiBhalayBhariaBhatriBhattiyaliBhayaBheleBhil, SindhiBhilaliBhiliBhojpuriBhoti, SpitiBhoti, StodBhujelBhunjiaBiafadaBiageBiakBialiBiangaiBiaoBiao MonBidayuh, BauBidayuh, BiatahBidayuh, Bukar-SadungBidayuh, Tringgus-SembaanBidiyoBidyaraBidyogoBiemBiereboBieriaBieteBigaBijoriBikaruBikolBikol, Buhi'nonBikol, LibonBikol, MirayaBikol, RinconadaBikol, West AlbayBikyaBilaBilakuraBilaspuriBilbaBilbilBileBilinBiloxiBiluaBilurBimaBiminBimobaBina (Nigeria)Bina (Papua New Guinea)BinahariBinandereBineBiniBinjiBintaunaBintuluBinukidBinukidnon, NorthernBinukidnon, SouthernBinumarienBipiBiraleBiraoBirgitBirhorBiriBirifor, MalbaBirifor, SouthernBiritaiBirkedBirriBirwaBisaya, BruneiBisaya, SabahBiseniBishnupriyaBishuoBisisBislamaBisorioBissaBisuBitBitareBiturBiwatBiyoBiyomBlaan, KoronadalBlaan, SaranganiBlablangaBlafeBlagarBlangBlissymbolsBo (Laos)Bo (Papua New Guinea)Bo-RukulBo-UngBoano (Maluku)Boano (Sulawesi)Bobo Madaré, NorthernBobo Madaré, SouthernBobongkoBobotBodo (Central African Republic)Bodo (India)Bodo ParjaBofiBogaBogayaBoghomBoguruBoikinBokhaBoko (Benin)Boko (Democratic Republic of Congo)BokobaruBokotoBokyiBolaBolangoBoleBolgarianBolgoBoliaBolinaoBolivian Sign LanguageBoloBolokiBolonBolondoBolonganBolyuBomBomaBomboliBombomaBomitabaBomuBomwaliBon GulaBonanBondeiBondoBonerateBonerifBonggiBonggoBongiliBongoBonguBonjoBonkengBonkimanBontokBontok, CentralBontok, EasternBontok, NorthernBontok, SouthernBontok, SouthwesternBookanBoonBoorBor, BelandaBoraBoreiBoro (Ethiopia)Boro (Ghana)BorongBorucaBorôroBoselewaBosngunBosnianBote-MajhiBotlikhBouyeiBozabaBozo, JenaamaBozo, KɛlɛngaxoBozo, TiemacèwèBozo, TiéyaxoBragatBrahuiBrajBrazilian Sign LanguageBremBreriBretonBreton, MiddleBreton, OldBribriBrithenigBritish Sign LanguageBrokkatBrokpakeBrokskatBroome Pearling Lugger PidginBru, EasternBru, WesternBruneiBuBuaBuamuBuang, ManggaBuang, MaposBubeBubiBubiaBudibudBudong-BudongBuduBudukhBudumaBudzaBuganBugawacBughotuBugineseBuglereBugunBuhidBuhutuBukatBukharicBukitanBukiyipBuksaBukusuBukwenBulgarianBulgarian Sign LanguageBulgebiBuli (Ghana)Buli (Indonesia)Bullom SoBulu (Cameroon)Bulu (Papua New Guinea)BumBumajiBumthangkhaBunBunaBunabaBunakBunamaBundeliBungBungainBungkuBunguBunu, Bu-NaoBunu, JiongnaiBunu, WunaiBunu, YounuoBununBuolBura-PabirBurakBurakaBurarraBurateBurdekin, LowerBurdunaBureBuriatBuriat, ChinaBuriat, MongoliaBuriat, RussiaBurjiBurmbarBurmeseBurmese, OldBurmesoBuru (Indonesia)Buru (Nigeria)BuruiBurumakokBurunBurungeBurushaskiBurusuBuruwaiBusaBusamBusamiBushiBushoongBusoBusoaBussaBusuuButmas-TurButuanonBuwalBuyang, BahaBuyang, E'maBuyang, LangnianBuyuBwaBwaidokaBwamu, CwiBwamu, Láá LááBwanabwanaBwatooBwelaBwileBwisiByangsiByepBéte, GuiberouaBété, DaloaBété, GagnoaC'lelaCaacCabiyaríCabécarCacaoperaCacuaCaddoCahuaranoCahuillaCakaCakchiquel-Quiché Mixed LanguageCakfem-MushereCallawallaCaluyanunCalóCamlingCampalagianCamsáCamthoCamunicCandoshi-ShapraCanelaCanichanaCao LanCao MiaoCapanahuaCapiznonCaquinteCaraCarabayoCaramantaCarapanaCarianCarib, GalibiCarib, IslandCarijonaCarolinianCarrierCarrier, SouthernCashibo-CacataiboCashinahuaCatalanCatalan Sign LanguageCatawbaCaucaCavineñaCayubabaCayugaCayuseCebuanoCeltiberianCemuhîCenCentúúmCermaChachiChadian Sign LanguageChadongChagataiChaimaChakChakaliChakmaChalaChalikhaCham, EasternCham, WesternChamacocoChamalalChamariChambealiChambriChamicuroChamorroChangriwaChangthangChantyalChanéCharaChatino, Eastern HighlandChatino, NopalaChatino, TataltepecChatino, Western HighlandChatino, ZacatepecChatino, ZenzontepecChaudangsiChauraChavacanoChayahuitaCheChechenChehalis, LowerChehalis, UpperCheke HoloChemakumChenapianChenchuChenouaChepangChepyaChereponCherokeeChesuChetcoChetti, WayanadChewongCheyenneChhattisgarhiChhintangeChhulungChiangmai Sign LanguageChiapanecChibchaChichimeca-JonazChickasawChicomuceltecChigaChilcotinChilean Sign LanguageChilissoChimarikoChimilaChin, AshoChin, BawmChin, BualkhawChin, ChinbonChin, DaaiChin, FalamChin, KhumiChin, MaraChin, MünChin, NgawnChin, PaiteChin, SenthangChin, SiyinChin, TawrChin, TedimChin, ThadoChin, ZotungChinaliChinantec, ChiltepecChinantec, ComaltepecChinantec, LalanaChinantec, LealaoChinantec, OjitlánChinantec, OzumacínChinantec, PalantlaChinantec, QuiotepecChinantec, TepetotutlaChinantec, TepinapaChinantec, TlacoatzintepecChinantec, UsilaChinantec, Valle NacionalChineseChinese Sign LanguageChinese, GanChinese, HakkaChinese, HuizhouChinese, JinyuChinese, Late MiddleChinese, LiteraryChinese, MandarinChinese, Min BeiChinese, Min DongChinese, Min NanChinese, Min ZhongChinese, OldChinese, Pu-XianChinese, WuChinese, XiangChinese, YueChinookChinook jargonChipayaChipewyanChippewaChiquitanoChiruChitimachaChittagonianChocangacakhaChochotecChoctawChodriChokweCholCholónChongChoniChontal, Highland OaxacaChontal, Lowland OaxacaChontal, TabascoChonyi-Dzihana-KaumaChopiChorasmianChorote, Iyo'wujwaChorote, Iyojwa'jaChortíChrauChruChuaveChugChujChukaChukotChukwaChulymChumburungChurahiChutChuukeseChuvantsyChuvashChuwabuChácoboCia-CiaCibakCicipuCimbrianCinda-Regi-TiyalCineniCinta LargaCishinginiCitakCitak, TamnimCiwogaiClallamClassical SyriacCoahuiltecoCocama-CocamillaCochimiCocopaCoeur d'AleneCofánCoguiColColombian Sign LanguageColoradoColumbia-WenatchiComancheComecrudoComo KarimComorian, MaoreComorian, MwaliComorian, NdzwaniComorian, NgazidjaComoxConCoosCopticCoquilleCora, El NayarCora, Santa TeresaCoriCornishCornish, MiddleCornish, OldCorsicanCosta Rican Sign LanguageCotonameCowlitzCreeCree, MooseCree, Northern EastCree, PlainsCree, Southern EastCree, SwampyCree, WoodsCreekCreole Arabic, BabaliaCreole Arabic, SudaneseCreole Dutch, BerbiceCreole Dutch, SkepiCreole English, Antigua and BarbudaCreole English, BahamasCreole English, Fernando PoCreole English, GrenadianCreole English, GuyaneseCreole English, Hawai'iCreole English, IslanderCreole English, JamaicanCreole English, NicaraguaCreole English, Sea IslandCreole English, TobagonianCreole English, TrinidadianCreole English, Turks And CaicosCreole English, VincentianCreole English, Virgin IslandsCreole French, GuadeloupeanCreole French, GuianeseCreole French, KaripúnaCreole French, RéunionCreole French, Saint LucianCreole French, San MiguelCreole French, SeselwaCreole Hindi, AndamanCreole Malay, MalaccanCreole Malay, Sri LankanCreole Portuguese, KorlaiCreole Portuguese, MalaccanCreole, Afro-SeminoleCreole, CafundoCreole, Torres StraitCrioulo, Upper GuineaCroatia Sign LanguageCroatianCrowCruzeñoCuaCuba Sign LanguageCubeoCuibaCuicatec, TepeuxilaCuicatec, TeutilaCulinaCumanagotoCumbricCunCungCupeñoCuronianCurripacoCutchi-SwahiliCuvokCuyononCzechCzech Sign LanguageCôôngDaantanai'DaasanachDabaDabarreDabeDacianDadibiDadiyaDagaDagaare, SouthernDagaari DioulaDagara, NorthernDagbaDagbaniDagikDagomanDahaloDaho-DooDaiDairDaju, Dar DajuDaju, Dar FurDaju, Dar SilaDaka, SambaDakkaDakotaDakpakhaDalmatianDamaDamakawaDamalDamar, EastDamar, WestDambiDameliDampelasDanDanaruDanauDangaléatDani, Lower Grand ValleyDani, Mid Grand ValleyDani, Upper Grand ValleyDani, WesternDanishDanish Sign LanguageDanish, TravellerDanoDaoDaondaDaraiDargwaDari, ZoroastrianDarlongDarmiyaDassDatoogaDaurDavawenyoDawawaDawera-DaweloorDawroDayDayak, MalayicDayiDazagaDeccanDeduaDefakaDegDegaruDegemaDegenanDegexit'anDehuDehwariDekDela-OenaleDelawareDelaware, PidginDeloDemDemaDemisaDemtaDendi (Benin)Dendi (Central African Republic)DengeseDengkaDenoDenyaDeníDeoriDera (Indonesia)Dera (Nigeria)DesanoDesiyaDewoinDezfuliDghwedeDhaisoDhalandjiDhankiDhanwar (Nepal)DhaoDhargariDhatkiDhimalDhivehiDhodiaDhundariDhurgaDhuwalDiaDibiyasoDiboDiboleDida, LakotaDida, YocobouéDidingaDidoDieriDigoDiiDijim-BwilimDillingDimaDimasaDimbongDimeDimli (individual language)DingDinkaDinka, NortheasternDinka, NorthwesternDinka, South CentralDinka, SoutheasternDinka, SouthwesternDirariDirashaDiriDirikuDirimDisaDitammariDitidahtDiuweDixon ReefDizinDjambarrpuynguDjamindjungDjangunDjauanDjawiDjeebbanaDjinangDjinbaDjingiliDjiwarliDobelDobuDoeDogaDoghoroDogon, AmpariDogon, Ana TingaDogon, Bondum DomDogon, BunogeDogon, Dogul DomDogon, Donno SoDogon, JamsayDogon, MomboDogon, Nanga DamaDogon, Tebul UreDogon, Tene KanDogon, Tiranige DigaDogon, Tomo KanDogon, Toro SoDogon, Toro TeguDogon, Yanda DomDogosoDogoséDogri (individual language)Dogri (macrolanguage)DogribDokaDoko-UyangaDolganDolpoDomDomaakiDomariDombeDominican Sign LanguageDompoDomuDomungDondoDongDong, NorthernDong, SouthernDongoDongotonoDongxiangDoondoDori'oDoromu-KokiDororoDorzeDosoDoutaiDoyayoDrentsDrungDualaDuanoDuauDubliDubuDugunDuguriDugworDuhwaDukeDulbuDumaDumagat, RemontadoDumbeaDumiDumpasDumunDunaDunganDungmaliDungra BhilDunguDuraDuriDuriankereDurumaDuruwaDusnerDusun DeyahDusun MalangDusun WituDusun, SugutDutchDutch Sign LanguageDutch, Middle (ca. 1050-1350)Dutch, OldDutton World SpeedwordsDuungoomaDuupaDuvleDuwaiDuwetDwangDyaabugayDyaberdyaberDyanDyangadiDyirbalDyugunDyulaDzaDzalakhaDzandoDzao MinDzodinkaDzongkhaDzùùngooDâwEE'ñapa WoromaipuEastern Maroon CreoleEbiraEblanEbriéEbughuEcuadorian Sign LanguageEde CabeEde IcaEde IdacaEde IjeEde Nago, KuraEdoloEdomiteEdopiEfaiEfate, NorthEfate, SouthEfeEfikEfutopEgaEggonEgypt Sign LanguageEgyptian (Ancient)EhueunEipomekEitiepEjaghamEjamatEkajukEkariEkiEkitEkpeyeEl HugeiratEl MoloElamiteElemeElepiElipElkeiEloyiElsengEluElymianEmaeEmai-Iuleha-OraEmanEmbalohEmberá, NorthernEmberá-BaudóEmberá-CatíoEmberá-ChamíEmberá-TadóEmbuEmerillonEmilianEmplawasEmumuEnEnawené-NawéEndeEnets, ForestEnets, TundraEngaEngenniEngganoEnglishEnglish, LiberianEnglish, Middle (1100-1500)English, Old (ca. 450-1100)EnrekangEnuEnwan (Akwa Ibom State)Enwan (Edu State)EnyaEpenaEpi-OlmecEpieEravallanEraveEreEritaiErokwanasErreErromintxelaErsuEruwaErzyaEsanEseEse EjjaEshtehardiEsimbiEsperantoEsselenEstonianEstonian Sign LanguageEstonian, StandardEsumaEtcheminEtebiEtenEteocretanEteocypriotEthiopian Sign LanguageEtkywanEton (Cameroon)Eton (Vanuatu)EtruscanEtuloEvantEvenEvenkiEwage-NotuEweEwondoExtremaduranEyakFaganiFaitaFaiwolFalaFaliFali, BaissaFali, NorthFali, SouthFaliscanFamFanagaloFang (Cameroon)Fang (Equatorial Guinea)FaniaFantiFarefareFaroeseFars, NorthwesternFars, SouthwesternFasFasuFatalekaFatalukuFayuFe'fe'FembeFerogeFijianFijian, WesternFilipinoFinland-Swedish Sign LanguageFinnishFinnish Sign LanguageFinnish, KvenFinnish, TornedalenFinonganFipaFiranFiwagaFlinders IslandFoauFoiFoia FoiaFolopaFomaFonFongoroFoodoForakFordataForeFortsenalFrankishFrenchFrench Sign LanguageFrench, CajunFrench, Middle (ca. 1400-1600)French, Old (842-ca. 1400)Frisian, EasternFrisian, NorthernFrisian, OldFrisian, WesternFriulianFulahFulfulde, AdamawaFulfulde, BagirmiFulfulde, BorguFulfulde, Central-Eastern NigerFulfulde, MaasinaFulfulde, NigerianFulfulde, Western NigerFuliiruFulniôFumFungwaFurFuruFutuna, EastFutuna-AniwaFuyugFweFwâiFyamFyerGaGa'andaGa'dangGaaGaamGabriGabrielino-FernandeñoGadaba, BodoGadaba, MudhiliGadaba, Pottangi OllarGadangGaddangGaddiGadeGadjerawangGadsupGaelic, Hiberno-ScottishGaelic, ScottishGafatGagaduGagauzGaguGahriGaikundiGailGainaGalGalambuGalatianGalelaGaleyaGaliceGalicianGalindanGaloGamberaGamilaraayGamitGamkonoraGamoGamo-NingiGanaGanangGandaGaneGanggalidaGanglauGangteGanguluGantsGanzaGanziGaoGapapaiwaGarasia, AdiwasiGarasia, RajputGarhwaliGarifunaGarig-IlgarGaroGarreGarusGarzaGata'Gaulish, CisalpineGaulish, TransalpineGavarGavião Do JiparanáGavião, ParáGawar-BatiGawwadaGayilGayoGaziGbagyiGbanuGbanziriGbariGbaya (Central African Republic)Gbaya (Sudan)Gbaya, NorthwestGbaya, SouthwestGbaya-BossangoaGbaya-BozoumGbaya-MbodomoGbayiGbe, AyizoGbe, CiGbe, DefiGbe, Eastern XwlaGbe, GbesiGbe, KotafonGbe, MaxiGbe, SaxweGbe, TofinGbe, WaciGbe, WemeGbe, Western XwlaGbe, XwelaGbiiGbiri-NiraguGeGebeGedagedGedeoGeezGejiGelaGelao, GreenGelao, RedGelao, WhiteGemeGenGendeGengleGeorgianGeorgian, OldGepoGeraGermanGerman Sign LanguageGerman, Colonia TovarGerman, HutteriteGerman, Middle High (ca. 1050-1500)German, Middle LowGerman, Old High (ca. 750-1050)German, PennsylvaniaGerman, SwissGerumaGeser-GoromGhadamèsGhale, NorthernGhale, SouthernGhanaian Sign LanguageGhanonggaGhariGhayaviGheraGhodoberiGhomaraGhomálá'GhotuoGhulfanGianganGibanawaGidarGiiwoGikyodeGilakiGilberteseGilimaGilyakGimi (Eastern Highlands)Gimi (West New Britain)GimmeGimnimeGinumanGinyangaGirawaGiryamaGitongaGituaGitxsanGiyugGiziga, NorthGiziga, SouthGizrraGlaro-TwaboGlavdaGlio-OubiGnauGoariaGobasiGobuGodiéGodwariGoemaiGofaGogoGogodalaGokanaGolaGolinGondiGondi, NorthernGone DauGongdukGonjaGoodenough, WestGooniyandiGorGorakorGorapGorontaloGorovuGorowaGothicGoundoGourmanchémaGowlanGowliGowroGozarkhaniGrangaliGreat Andamanese, MixedGreboGrebo, BarclayvilleGrebo, CentralGrebo, GbolooGrebo, NorthernGrebo, SouthernGreek Sign LanguageGreek, Ancient (to 1453)Greek, CappadocianGreek, Modern (1453-)Greek, MycenaeanGresiGromaGroningsGros VentreGuaGuahiboGuajajáraGuajáGuambianoGuana (Brazil)Guana (Paraguay)GuananoGuancheGuanyinqiaoGuaraniGuaraní, Eastern BolivianGuaraní, MbyáGuaraní, ParaguayanGuaraní, Western BolivianGuarayuGuarequenaGuatemalan Sign LanguageGuatóGuayaberoGudanjiGudeGuduGuduf-GavaGugadjGugu BadhunGugu WarraGuguberaGuguyimidjirGuhu-SamaneGuinean Sign LanguageGuiqiongGujaratiGujariGula (Central African Republic)Gula (Chad)Gula IroGula'alaaGulayGuleGuliguliGumaluGumatjGumawanaGumuzGunGundiGungabulaGunguGuntaiGunwingguGunyaGupa-AbawaGupapuynguGuragoneGuramalumGuraniGurdjarGureng GurengGurgulaGuriasoGurinjiGurmanaGuroGuruntum-MbaaruGusiiGusilayGuwamuGuyaGuyaniGvokoGwaGwahatikeGwamhi-WuriGwandaraGwedaGwenoGwereGwichʼinGyeleGyemHaHabuHadiyyaHadothiHadramiHadzaHaekeHahonHai//omHaidaHaida, NorthernHaida, SouthernHaigwaiHaiphong Sign LanguageHaislaHaitian Vodoun Culture LanguageHajiHajongHaköHalangHalang DoanHalbiHaliaHalkomelemHamapHambaHamer-BannaHamtaiHanHangaHanga HundiHangazaHaniHanoHanoi Sign LanguageHanunooHaramiHarariHaroiHarsusiHaruaiHarukuHaryanviHarzaniHashaHassaniyyaHatamHatticHausaHausa Sign LanguageHavasupai-Walapai-YavapaiHavekeHavuHawaiianHayaHazaragiHdiHebrewHebrew, AncientHeheHeibanHeiltsukHelambu SherpaHelongHemaHembaHerdéHereroHermitHernicanHewaHeyoHibitoHidatsaHigaononHijukHiligaynonHimarimãHindiHindi, FijiHindko, NorthernHindko, SouthernHinduriHindustani, CaribbeanHinukhHiri MotuHittiteHittite, MiddleHittite, Neo-Hittite, OldHituHiwHixkaryánaHlaiHlersuHmarHmongHmong DawHmong DonHmong DôHmong NjuaHmong, Southwestern GuiyangHmwavekeHoHo Chi Minh City Sign LanguageHo-ChunkHoavaHobyótHoia HoiaHolikachukHoliyaHolmaHoloholoHoluHomaHonduras Sign LanguageHong Kong Sign LanguageHoniHopiHoroHoromHorpaHoteHotiHovonganHoyahoyaHozoHponHrangkholHreHrusoHuHuachipaeriHuambisaHuarijioHuastecHuauluHuave, San Dionisio Del MarHuave, San Francisco Del MarHuave, San Mateo Del MarHuave, Santa María Del MarHubaHuicholHuillicheHuitoto, MinicaHuitoto, MuruiHuitoto, NüpodeHukuminaHulaHulauláHuliHulungHumeneHumlaHun-SaareHundeHungHunganaHungarianHungarian Sign LanguageHungarian, OldHunjara-Kaina KeHunnicHunsrikHunzibHupaHupdëHuplaHurrianHwanaHyaHyamHértevinHõneI-WakIaaiIamaleleIatmulIauIbaloiIbanIbanagIbaniIbatanIberianIbibioIbinoIbuIbuoroIcelandicIcelandic Sign LanguageIceve-MaciIda'anIdakho-Isukha-TirikiIdatéIdereIdesaIdiIdoIdomaIdonIdu-MishmiIdunaIfoIfugao, AmganadIfugao, BatadIfugao, MayoyaoIfugao, TuwaliIfèIgalaIganaIgboIgedeIgnacianoIgoIgutaIgweIhaIha Based PidginIhievbeIja-ZubaIjo, SoutheastIkIkaIkizuIkoIkoma-Nata-IsenyeIkpengIkpeshiIkposoIku-Gora-AnkwaIkuluIkwereIlaIle ApeIli TurkiIli'uunIllyrianIlokoIlongotIlueIlwanaImbonguImondaImroingInabaknonInapangIndian Sign LanguageIndo-PortugueseIndonesianIndonesian Sign LanguageIndonesian, PeranakanIndriIndus Valley LanguageIneseñoIngaInga, JungleIngrianIngushInoke-YateInonhanInorInterglossaInterlingua (International Auxiliary Language Association)InterlingueInternational SignInthaInuktitutInuktitut, Eastern CanadianInupiaqInupiatun, North AlaskanInupiatun, Northwest AlaskaIowa-OtoIpikoIpiliIpuloIquitoIrIraqwIrarutuIrayaIresimIrigweIrishIrish Sign LanguageIrish, Middle (900-1200)Irish, Old (to 900)Irish, PrimitiveIrulaIrántxeIsabiIsanzuIsconahuaIsebeIsekiriIshkashimiIsinaiIsirawaIsnagIsokoIsraeli Sign LanguageIstriotIsu (Fako Division)Isu (Menchum Division)ItalianItalian Sign LanguageItawitItelmenIteneIteriItikItneg, BanaoItneg, BinonganItneg, InlaodItneg, MaengItneg, MasadiitItneg, MoyadanItoItonamaItu Mbon UzoItzáIvatanIvbie North-Okpela-ArheIwaidjaIwalIwamIwam, SepikIwurIxcatecIxilIyayuIyiveIyoIzereIzonIzoraIñapariJabutíJadJadgaliJah HutJahankaJakatiJakunJalkunanJamaican Country Sign LanguageJamaican Sign LanguageJamamadíJandavraJangkangJangshungJanjiJapaneseJapanese Sign LanguageJapanese, OldJapreríaJaqaruJaraJaraiJarawa (India)JaruJaunsariJavaneseJavanese, CaribbeanJavanese, New CaledonianJavindoJaweJayaJeberoJehJehaiJemezJengJereJeri KuoJerungJhankot Sign LanguageJiamaoJiarongJibaJibuJiidduJilbeJilimJimi (Cameroon)Jimi (Nigeria)JinaJinuo, BuyuanJinuo, YouleJirelJiruJitaJjuJobaJofotek-BromnyaJola-FonyiJola-KasaJonkor BourmataguilJordanian Sign LanguageJortoJoráJowuluJuJu/'hoanJuangJudeo-ArabicJudeo-BerberJudeo-GeorgianJudeo-ItalianJudeo-PersianJudeo-TatJukun TakumJumjumJumla Sign LanguageJumliJur ModoJurayJurchenJurúnaJutishJuwalJwira-PepesaJúmaK'iche'KaambaKaanKaansaKabaKabalaiKabardianKabateiKabiyèKabolaKabrasKaburiKabutraKabuverdianuKabwaKabwariKabyleKachama-GanjuleKachariKachinKacipo-BalesiKaco'KadaiKadarKadaruKadazan, Klias RiverKadazan, Labuk-KinabatanganKadiwéuKaduoKafaKafoaKagateKagayanenKagomaKagoroKaguluKaheKahuaKaianKaiboboKaidipangKaiepKaikadiKaikeKaikuKaili, Da'aKaili, LedoKaili, UndeKaimbulawaKaimbéKaingangKaingáng, São PauloKairakKairiruKairui-MidikiKaisKaiviKaiwáKaiyKajakseKajaliKajamanKakabaiKakabeKakandaKaki AeKakoKakwaKala Lagaw YaKalaallisutKalabakanKalabariKalabraKalaganKalagan, KaganKalamKalamiKalamséKalanadiKalangaKalaoKalapuyaKalapuya, NorthernKalapuya, SouthernKalarkoKalashaKalenjinKalinga, ButbutKalinga, LimosKalinga, LubuaganKalinga, Mabaka ValleyKalinga, MajukayangKalinga, SouthernKalispel-Pend d'OreilleKalkotiKalkutungKallahan, Keley-IKallahan, TinocKalmykKalouKaluliKalumpangKamKamakanKamangKamanoKamantanKamarKamaraKamarianKamaruKamasKamasaKamasauKamayoKamayuráKamba (Kenya)KambaataKambairaKamberaKamberauKambiwáKami (Nigeria)Kami (Tanzania)KamoKamoroKamuKamulaKamviriKamweKanakanabuKanamaríKanashiKanasiKanaujiKandasKandawoKandeKanembuKangKangaKangeanKanggapeKangjiaKango (Bas-Uélé District)Kango (Tshopo District)KangriKanietKanikkaranKaningdon-NindemKaningiKaningraKaninuwaKaniteKanjariKanjobal, WesternKanjuKankanaeyKankanay, NorthernKannadaKanoéKansaKantosiKanuKanufiKanum, BädiKanum, NgkâlmpwKanum, SmärkyKanum, SotaKanuriKanuri, BilmaKanuri, CentralKanuri, MangaKanuri, TumariKanyokKaoKaondeKapKapinKapinawáKapingamarangiKaporiKaprimanKaptiauKapyaKaqchikelKara (Central African Republic)Kara (Korea)Kara (Papua New Guinea)Kara (Tanzania)Kara-KalpakKaraboro, EasternKaraboro, WesternKarachay-BalkarKaradjeriKaragasKaraimKarajáKarakhanidKaramiKaramojongKarangKarangaKarankawaKaraoKarasKarataKarawaKarbiKarbi, AmriKare (Central African Republic)Kare (Papua New Guinea)KarekareKarelianKaren, BweKaren, GebaKaren, GekoKaren, LahtaKaren, ManumanawKaren, Pa'oKaren, PakuKaren, Phrae PwoKaren, Pwo EasternKaren, Pwo NorthernKaren, Pwo WesternKaren, S'gawKaren, YinbawKaren, YintaleKaren, ZayeinKareyKariKaringaniKaripunaKaripúnaKarirí-XocóKaritiânaKariyaKariyarraKarkar-YuriKarkinKarkoKarnaiKaro (Brazil)Karo (Ethiopia)KarokKaronKaron DoriKaroreKasangaKasemKashayaKashmiriKashubianKasiguraninKaskaKaskeanKasuaKataangKatabagaKatawixiKatbolKatcha-Kadugli-MiriKathuKatiKatkariKatlaKatoKatsoKatu, EasternKatu, WesternKatuaKatukínaKatukína, PanoanKaulongKaurKaureKaurnaKauweraKavalanKavetKawachaKawaiisuKaweKawiKaxararíKaxuiânaKayabíKayagarKayah, EasternKayah, WesternKayanKayan MahakamKayan, BaramKayan, BusangKayan, Kayan RiverKayan, MendalamKayan, RejangKayan, WahauKayapóKayardildKayeliKayongKayortKaytetyeKayupulauKazakhKazukuruKe'oKeakKeaparaKedangKederKehuKeiKeigaKeinKeiyoKekchíKela (Democratic Republic of Congo)Kela (Papua New Guinea)KelabitKele (Democratic Republic of Congo)Kele (Papua New Guinea)KelikoKeloKelonKemakKembayanKemberanoKembraKemiehuaKemtuikKenaboiKenatiKendayanKendejeKendemKengaKeninjalKensiuKenswei NseiKentish Sign Language, OldKenyah, WahauKenyan Sign LanguageKenyangKenyiKeoru-AhiaKepkiriwátKepo'KeraKerakKerehoKerekKeres, EasternKeres, WesternKereweKerewoKerinciKesawaiKetKetangalanKeteKetengbanKetumKewa, EastKewa, WestKeyaganaKgalagadiKhakasKhalajKhalaj, TurkicKhalingKham, Eastern ParbateKham, GamaleKham, SheshiKham, Western ParbateKhambaKhamtiKhamyangKhanaKhandesiKhantyKhaoKhariaKharia TharKhasiKhayoKhazarKheKhehekKhengkhaKhetraniKhinalughKhirwarKhisaKhlorKhlulaKhmer, CentralKhmer, NorthernKhmuKho'iniKholokKhorasani TurkishKhorezmianKhotaneseKhowarKhuaKhuenKhunsariKhvarshiKhángKhünKibetKibiriKickapooKikaiKikuyuKilivilaKiliwaKilmeriKimKim MunKimaamaKimaragangKimbuKimbunduKimkiKimréKinabalianKinabatangan, UpperKinalaknaKinaray-AKingaKinnauriKinnauri, BhotiKinnauri, ChitkuliKinnauri, HarijanKintaqKinukuKinyarwandaKiokoKiongKiorrKiowaKipsigisKiputKir-BalarKireKirghizKirikeKirikiriKirmanjki (individual language)KisKisaKisankasaKisarKisiKisi, SouthernKissi, NorthernKistaneKitanKitjaKitsaiKituba (Congo)Kituba (Democratic Republic of Congo)KiunumKiwai, NortheastKiwai, SouthernKlamath-ModocKlaoKlingonKnaanicKoKoalibKoasatiKobaKobianaKobolKobonKochKodaKodakuKodavaKodeohaKodiKodiaKoenoemKofaKofeiKofyarKoguryoKohinKohistani, IndusKohoKohumonoKoiKoiali, MountainKoiari, GrassKoibalKoirengKoitabuKoiwatKok BorokKokataKokeKokodaKokolaKokotaKol (Cameroon)Kol (Papua New Guinea)KolaKolami, NorthwesternKolami, SoutheasternKolbilaKoli, KachiKoli, ParkariKoli, WadiyaraKoluwawaKom (Cameroon)Kom (India)KomaKombaKombaiKombioKomeringKomiKomi-PermyakKomi-ZyrianKominimungKomo (Democratic Republic of Congo)Komo (Sudan)KomodoKompaneKomyandaretKon KeuKonaiKondaKonda-DoraKonerawKongoKongo, San SalvadorKonjo, CoastalKonjo, HighlandKonkani (individual language)Konkani (macrolanguage)Konkani, GoanKonkombaKonniKono (Guinea)Kono (Nigeria)Kono (Sierra Leone)KonomalaKonongoKonsoKonzoKoongoKoonzimeKooreteKoparKopkakaKorafe-YeghaKoraga, KorraKoraga, MuduKorakKoranaKorandjeKoreanKorean Sign LanguageKorean, Middle (10th-16th cent.)Korean, Old (3rd-9th cent.)KoreguajeKoresh-e RostamKorkuKoro (Côte d'Ivoire)Koro (Papua New Guinea)Koro (Vanuatu)KoromféKoromiraKoroniKoropKoropóKoroshiKorowaiKoruboKorupun-SelaKorwaKoryakKosadleKosenaKoshinKosraeanKota (Gabon)Kota (India)Kota Marudu TalantangKotavaKotiKottKouyaKovaiKoveKowakiKowiaiKoy Sanjaq SuratKoyaKoyagaKoyoKoyukonKpaguaKpalaKpanKpasamKpatiKpatiliKpelleKpelle, GuineaKpelle, LiberiaKpessiKplangKracheKrahn, EasternKrahn, WesternKrahôKraolKrenakKrevinianKreyeKrikati-TimbiraKrimKrioKriolKriol English, BelizeKrisaKrobuKrongoKru'ng 2Krumen, PlapoKrumen, PyeKrumen, TepoKrymchakKrytsKuaKuanKuanhuaKuanuaKuanyamaKubeKubiKuboKubuKucongKudiyaKudmaliKudu-CamoKugamaKugboKui (India)Kui (Indonesia)KuijauKuikúro-KalapáloKujargeKukKukatjaKukeleKuknaKuku-MangkKuku-Mu'inhKuku-MuminhKuku-UgbanhKuku-UwanhKuku-YalanjiKulaKulango, BondoukouKulango, BounaKulereKulfaKulisusuKulon-PazehKulung (Nepal)Kulung (Nigeria)KumaluKumamKuman (Russia)KumaoniKumarbhag PahariaKumbaKumbainggarKumbaranKumbewahaKumhaliKumiaiKumukioKumykKumzariKuna, BorderKuna, San BlasKunamaKunbarlangKundaKundal ShahiKunduvadiKungKung-EkokaKungarakanyKunggariKuniKuni-BoaziKunigamiKunimaipaKunjaKunjenKunyiKunzaKuoKuotKupaKupiaKupsabinyKurKuramaKurankoKurdishKurdish, CentralKurdish, NorthernKurdish, SouthernKuriKuriaKurichiyaKurmukarKurramaKurtiKurtokhaKuruduKurukhKurumba, AluKurumba, AttapadyKurumba, BettaKurumba, JennuKurumba, KannadaKurumba, MulluKurux, NepaliKuruáyaKusaalKusagheKushiKuskokwim, UpperKusuKusundaKutenaiKutepKuthantKuttoKutuKuturmiKuuku-Ya'uKuviKuwaaKuwaataayKuyKw'adzaKwaKwa'KwaamiKwadiKwaioKwajaKwakiutlKwakumKwalhioqua-TlatskanaiKwamaKwambiKwameraKwamiKwangKwangaKwangaliKwanjaKwara'aeKwasioKwayaKwazaKweguKwerKwerbaKwerba MamberamoKwereKwerisaKweseKwestenKwiniKwinsuKwintiKwomaKwomtariKxoeKyakKyakaKyeneleKyerungKâteKéléKölschLa'biLaalLaariLabaLabelLabirLaboLabuLacandonLachiLachi, WhiteLadakhiLadinLadinoLaeko-LibuatLafofaLaghuLaghuuLagwanLaha (Indonesia)Laha (Viet Nam)LahananLahndaLahuLahu ShiLaimbueLaiyoloLakLaka (Chad)Laka (Nigeria)LakaleiLakhaLakiLakkiaLakonLakondêLakotaLalaLala-BisaLala-RobaLaliaLalo, DongshanbaLalo, XishanbaLalu, EasternLalu, WesternLama (Togo)LamaholotLamaleraLamangLamatukaLambaLambadiLambichhongLamboyaLambyaLameLamenuLametLamja-Dengsa-TolaLamkangLammaLamnso'LamogaiLampung ApiLampung NyoLamuLamu-LamuLandomaLang'eLangamLangbasheLangiLango (Sudan)Lango (Uganda)LangobardicLangue des signes de Belgique FrancophoneLanohLaoLaomianLaopangLaos Sign LanguageLaragiaLardilLarevatLariLarike-WakasihuLaroLartehLaruLasalimuLasgerdiLashiLasiLatgalianLatinLatuLatundêLatvianLatvian Sign LanguageLatvian, StandardLauLauaLauanLaujeLauraLaurentianLavatbura-LamusongLaveLavenLavukaleveLawa, EasternLawa, WesternLawanganLawunuiaLayakhaLazLecoLeelauLefaLega-MwengaLega-ShabundaLegboLegenyemLehaliLehalurupLeharLeiponLelakLele (Chad)Lele (Democratic Republic of Congo)Lele (Guinea)Lele (Papua New Guinea)LelemiLelepaLembata, SouthLembata, WestLembenaLemerigLemioLemnianLemolangLemoroLenakelLencaLenduLengiluLengoLengolaLeningitijLenjeLenkauLenyimaLepchaLepkiLeponticLereLeseLesing-GelimiLetemboiLeti (Cameroon)Leti (Indonesia)LevukaLewoLewo ElengLewotobiLeyighaLezghianLhokpuLhomiLi'oLiabukuLiana-SetiLibidoLibinzaLiburnianLibyan Sign LanguageLigbiLigenzaLigurianLigurian (Ancient)LihirLijiliLikaLikiLikilaLikubaLikumLikwalaLilauLillooetLimassaLimba, EastLimba, West-CentralLimbuLimbumLimburganLimiLimilnganLinduLinear ALingalaLingaoLingarakLingua FrancaLingua Franca NovaLipoLisabata-NunialiLiselaLishLishana DeniLishanid NoshanLishán DidánLisuLithuanianLithuanian Sign LanguageLitzlitzLivLivviLo-TogaLoarkiLobalaLobiLobu, LanasLobu, TampiasLodhiLogbaLogoLogolLogooliLogorikLohar, GadeLohar, LahulLojbanLokaaLokoLokoyaLolaLolakLoleLoloLolodaLolopoLolopo, SouthernLoma (Côte d'Ivoire)Loma (Liberia)LomaivitiLomavrenLombardLombiLomboLomweLomwe, MalawiLoncongLong WatLongguLongtoLongudaLoniuLonwolwolLonzoLooLopaLopiLopitLorangLorediakarkarLoteLotudLouLounLoup ALoup BLoziLua'LuangLuba-KatangaLuba-LuluaLubilaLubuLuchaziLucumiLudianLufuLugbaraLuguruLuiLuimbiLuisenoLukpaLule SamiLumba-YakkhaLumbeeLumbuLumunLunaLunanakhaLundaLundayehLunggaLuo (Cameroon)Luo (Kenya and Tanzania)LuriLuri, NorthernLuri, SouthernLusengoLushaiLushootseedLusiLusitanianLutosLuvaleLuwatiLuwian, CuneiformLuwian, HieroglyphicLuwoLuxembourgishLuyanaLuyiaLwaluLycianLydianLyngngamLyons Sign LanguageLyéléLáadanLüMa (Democratic Republic of Congo)Ma (Papua New Guinea)Ma'anyanMa'diMa'di, SouthernMa'yaMaaMaakaMaayMaba (Chad)Maba (Indonesia)MabaaleMabaanMabireMacaMacaguajeMacaguánMacaneseMacedonianMacedonian, AncientMachameMachiguengaMachinereMachingaMacoMacunaMacushiMada (Cameroon)Mada (Nigeria)Madagascar Sign LanguageMadakMadenMadiMadngeleMadureseMaeMaekMaewo, CentralMafaMafeaMagahiMagar, EasternMagar, WesternMagomaMagoriMaguindanaonMahaliMahicanMahongweMahouMai BratMaiaMaiadomuMaianiMaidu, NortheastMaidu, NorthwestMaidu, ValleyMaiiMailuMaindoMainfränkischMainstream KenyahMairasiMaisinMaithiliMaiwa (Indonesia)Maiwa (Papua New Guinea)MaiwalaMajangMajeraMajhiMajhwarMak (China)Mak (Nigeria)MakaaMakahMakasaeMakasarMakayamMakhuwaMakhuwa-MarrevoneMakhuwa-MeettoMakhuwa-MonigaMakhuwa-SakaMakhuwa-ShirimaMakian, EastMakian, WestMaklewMakolkolMakondeMaku'aMakurápMakweMalMal PahariaMala (Nigeria)Mala (Papua New Guinea)MalagasyMalagasy, BaraMalagasy, MasikoroMalagasy, Northern BetsimisarakaMalagasy, PlateauMalagasy, SakalavaMalagasy, Southern BetsimisarakaMalagasy, Tandroy-MahafalyMalagasy, TanosyMalagasy, TesakaMalagasy, TsimihetyMalalamaiMalangoMalankuravanMalapandaramMalaryanMalasMalasarMalasar, MalaMalavedanMalay (individual language)Malay (macrolanguage)Malay, AmboneseMalay, BabaMalay, BacaneseMalay, BalineseMalay, BandaMalay, BerauMalay, BukitMalay, CentralMalay, Cocos IslandsMalay, JambiMalay, KedahMalay, Kota Bangun KutaiMalay, KupangMalay, LarantukaMalay, MakassarMalay, ManadoMalay, North MoluccanMalay, PapuanMalay, PattaniMalay, SabahMalay, StandardMalay, Tenggarong KutaiMalayalamMalaynonMalayoMalaysian Sign LanguageMale (Ethiopia)Male (Papua New Guinea)Malecite-PassamaquoddyMalengMaleu-KilengeMalfaxalMalganaMalgbeMaliMalilaMalimbaMalimpungMaloMalolMalteseMaltese Sign LanguageMalua BayMalviMaléku JaíkaMamMamaMamaaMamaindéMamanwaMamasaMambaeMambaiMambila, CameroonMambila, NigeriaMamboruMambwe-LunguMampruliMamujuMamuliqueMamusiMamvuMan MetManamManambuManangbaManangkariManchuManda (Australia)Manda (India)Manda (Tanzania)MandahuacaMandaicMandaic, ClassicalMandanMandandanyiMandarMandaraMandariMandayaMandealiManderMandingoMandinkaMandjakMandobo AtasMandobo BawahManduri, BagaManemMangMangalaMangarayiMangarevaMangasMangayatMangbetuMangbutuMangerrManggaraiMangoMangoleMangsengMangueManideManikionManinka, KonyankaManinka, SankaranManinkakan, EasternManinkakan, KitaManinkakan, WesternManipaManipuriManipuri, OldMankanyaManna-DoraMannanManobo, AgusanManobo, AtaManobo, CotabatoManobo, DibabawonManobo, IlianenManobo, KinamigingManobo, MatigsalugManobo, OboManobo, Rajah KabunsuwanManobo, SaranganiManobo, Western BukidnonManombaiMansakaMansiMansoankaMantaMantsiManxManyaManyawaManyikaManzaMaonanMaoriMapeMapenaMapiaMapidianMapoyoMapudungunMapunMaquiritariMaraMarachiMaragheiMaragusMaramaMarambaMaranaoMaranungguMararitMarathiMarathi, OldMarauMarbaMaremgiMarenjeMarfaMarganyMarghi CentralMarghi SouthMarguMari (East Sepik Province)Mari (Madang Province)Mari (Russia)Mari, EasternMari, WesternMaria (India)Maria (Papua New Guinea)Maria, DandamiMaricopaMaridanMaridjabinMarikMarimanindjiMarindMarind, BianMaringMaringarrMarinoMaririMarithielMaritime Sign LanguageMaritsauáMariyediMarkaMarkweetaMarmaMarovoMarquesan, NorthMarquesan, SouthMarriammuMarrucinianMarshalleseMarsianMartha's Vineyard Sign LanguageMarti KeMartu WangkaMartuyhuniraMaruMarwariMarwari (India)Marwari (Pakistan)MarúboMasaabaMasaiMasalitMasanaMasbatenyoMasela, CentralMasela, EastMasela, WestMashco PiroMashi (Nigeria)Mashi (Zambia)MasimasiMasiwangMaskelynesMaslamMasmajeMassalatMassepMatagalpaMatalMatbatMatengoMatepiMatipuhyMatlatzinca, AtzingoMatlatzinca, San FranciscoMatoMatorMatsésMattoleMatukarMatumbiMatísMaungMauritian Sign LanguageMauwakeMawa (Chad)Mawa (Nigeria)MawakMawanMawayanaMawchiMawesMaxakalíMayagudunaMayan, EpigraphicMayangnaMayekaMayoMayogoMazagwayMazahua, CentralMazahua, MichoacánMazanderaniMazatec, AyautlaMazatec, ChiquihuitlánMazatec, HuautlaMazatec, IxcatlánMazatec, Jalapa De DíazMazatec, MazatlánMazatec, San Jerónimo TecóatlMazatec, SoyaltepecMbaMbalaMbalanhuMbandjaMbangalaMbangiMbangweMbara (Australia)Mbara (Chad)Mbariman-GudhinmaMbatiMbatoMbayMbeMbe'MbelimeMbembe, Cross RiverMbembe, TigonMbereMbesaMbo (Cameroon)Mbo (Democratic Republic of Congo)MboiMbokoMboleMbongaMbongnoMbosiMboweMbreMbudumMbuguMbugweMbukoMbukushuMbulaMbula-BwazzaMbuleMbulungishMbumMbundaMbungaMburkuMbwelaMe'enMedeburMedia LenguaMediakMedianMedumbaMefeleMegamMehekMehinákuMehriMekeoMekmekMekweiMelanau, CentralMelanau, Daro-MatuMelanau, Kanowit-TanjongMelanau, SibuMele-FilaMeloMelpaMemoniMendankwe-NkwenMende (Papua New Guinea)Mende (Sierra Leone)MengakaMengenMengisaMenkaMenomineeMentawaiMenyaMeohang, EasternMeohang, WesternMeoswarMerMerameraMereiMereyMeriamMerlavMeroiticMeruMerwariMesakaMeseMeskwakiMesmeMesmesMesqanMessapicMeta'MewariMewatiMexican Sign LanguageMeyahMfinuMfumteMi'kmaqMiamiMianMianiMiao, Chuanqiandian ClusterMiao, Eastern QiandongMiao, Eastern XiangxiMiao, HornedMiao, Northern QiandongMiao, Small FloweryMiao, Southern QiandongMiao, Western XiangxiMichifMichigameaMidobMien, Biao-JiaoMien, IuMigaamaMigabacMigumMikasukiMiliMiltuMilukMilyanMina (Cameroon)Mina (India)MinaeanMinangkabauMinanibaiMinavehaMindericoMindiriMingang DosoMingrelianMinidienMinoanMinokokMinriqMintilMiqieMirandeseMirganMiritiMiriwungMishipMisingMittuMitukuMiuMiwaMiwok, BayMiwok, Central SierraMiwok, CoastMiwok, LakeMiwok, Northern SierraMiwok, PlainsMiwok, Southern SierraMixe, CoatlánMixe, IsthmusMixe, JuquilaMixe, MazatlánMixe, North CentralMixe, QuetzaltepecMixe, TlahuitoltepecMixe, TotontepecMixtec, AlacatlatzalaMixtec, AlcozaucaMixtec, AmoltepecMixtec, Apasco-ApoalaMixtec, AtatláhucaMixtec, AyutlaMixtec, CacaloxtepecMixtec, ChayucoMixtec, ChazumbaMixtec, ChigmecatitlánMixtec, CoatzospanMixtec, CuyamecalcoMixtec, Diuxi-TilantongoMixtec, HuitepecMixtec, ItundujiaMixtec, IxtayutlaMixtec, JamiltepecMixtec, JuxtlahuacaMixtec, Magdalena PeñascoMixtec, MetlatónocMixtec, MitlatongoMixtec, MixtepecMixtec, Northern TlaxiacoMixtec, Northwest OaxacaMixtec, OcotepecMixtec, PeñolesMixtec, Pinotepa NacionalMixtec, San Juan ColoradoMixtec, San Juan TeitaMixtec, San Miguel El GrandeMixtec, San Miguel PiedrasMixtec, Santa Lucía MonteverdeMixtec, Santa María ZacatepecMixtec, SilacayoapanMixtec, SindihuiMixtec, SinicahuaMixtec, Southeastern NochixtlánMixtec, Southern PueblaMixtec, Southwestern TlaxiacoMixtec, SoyaltepecMixtec, TacahuaMixtec, TamazolaMixtec, TezoatlánMixtec, TidaáMixtec, TijaltepecMixtec, TlazoyaltepecMixtec, TututepecMixtec, Western JuxtlahuacaMixtec, YoloxochitlMixtec, YosondúaMixtec, YucuañeMixtec, YutanduchiMiyaMiyakoMiyobeMlabriMlahsöMlapMlompMmaalaMmenMnong, CentralMnong, EasternMnong, SouthernMo'daMoabiteMobaMobilianMochiMochicaMochoMocovíModangModoleMoereMofu, NorthMofu-GudurMogholiMogumMohaveMohawkMohegan-PequotMoi (Congo)Moi (Indonesia)MoikodiMoingiMojiMokMokenMokerangMokileseMoklenMokoleMokpweMokselaMokshaMolaleMolbogMoldova Sign LanguageMolengueMolimaMoloMolofMolokoMom JangoMomaMomareMombumMominaMomunaMonMon, OldMonastic Sign LanguageMondropolonMondéMongoMongolMongolianMongolian Sign LanguageMongolian, ClassicalMongolian, HalhMongolian, MiddleMongolian, PeripheralMongondowMoniMono (Cameroon)Mono (Democratic Republic of Congo)Mono (Solomon Islands)Mono (USA)MonomMonpa, KalaktangMonpa, TawangMontagnaisMontolMonumboMonzomboMooMopán MayaMor (Bomberai Peninsula)Mor (Mor Islands)MoraidMorawaMorerebiMoresadaMori AtasMori BawahMorigiMorisyenMoroMoroccan Sign LanguageMorokodoMoromMoroneneMororiMorouasMortlockeseMoruMosimoMosiroMoskonaMossiMotaMotlavMotuMouk-AriaMovimaMozambican Sign LanguageMozarabicMpadeMpiMpiemoMpotoMpotovoroMpuonoMpurMruMserMualangMubamiMubiMudaMudugaMufianMugomMuinaneMuji, NorthernMuji, QilaMuji, SouthernMukha-DoraMukuluMulahaMulamMullukmullukMultiple languagesMuluridyiMumMumuyeMunaMundaMundabliMundangMundaniMundariMundatMundurukúMungakaMungguiMungkipMunicheMunitMunjiMunseeMuongMuratayakMuria, EasternMuria, Far WesternMuria, WesternMurik (Malaysia)Murik (Papua New Guinea)MurkimMurleMurrinh-PathaMursiMurupiMurut, KeningauMurut, TagalMurut, TimugonMuruwariMusakMusarMusasaMuseyMusguMushunguluMusiMuskumMusomMussau-EmiraMuthuvanMutuMuyaMuyangMuyu, NorthMuyu, SouthMuyuwMuziMvanipMvubaMwaghavulMwanMwaniMwatebuMwera (Chimwera)Mwera (Nyasa)Mwimbi-MuthambiMyeneMysianMághdìMískitoMóchenoMündüN'KoN/uNaNaabaNaasioiNabaNabakNabiNacheringNadruvianNadëbNafaanraNafiNafriNafusiNaga PidginNaga, AngamiNaga, AoNaga, ChangNaga, ChokriNaga, ChotheNaga, InpuiNaga, KharamNaga, KhezhaNaga, KhiamniunganNaga, KhoibuNaga, KonyakNaga, LeinongNaga, LiangmaiNaga, Long PhuriNaga, LothaNaga, MakuriNaga, MakyanNaga, MaoNaga, MaramNaga, MaringNaga, MonsangNaga, MoyonNaga, MziemeNaga, NocteNaga, Northern RengmaNaga, ParaNaga, PhomNaga, PochuriNaga, PoumeiNaga, PuimeiNaga, RongmeiNaga, SangtamNaga, Southern RengmaNaga, SumiNaga, TaraoNaga, TaseNaga, ThangalNaga, TutsaNaga, WanchoNaga, YimchungruNaga, ZemeNagarchalNageNago, NorthernNago, SouthernNagumiNahaliNahariNahuatl, CentralNahuatl, Central HuastecaNahuatl, Central PueblaNahuatl, ClassicalNahuatl, CoatepecNahuatl, Eastern HuastecaNahuatl, GuerreroNahuatl, Highland PueblaNahuatl, HuaxcalecaNahuatl, Isthmus-CosoleacaqueNahuatl, Isthmus-MecayapanNahuatl, Isthmus-PajapanNahuatl, MichoacánNahuatl, MorelosNahuatl, Northern OaxacaNahuatl, Northern PueblaNahuatl, OmetepecNahuatl, OrizabaNahuatl, Santa María La AltaNahuatl, Sierra NegraNahuatl, Southeastern PueblaNahuatl, TabascoNahuatl, TemascaltepecNahuatl, TetelcingoNahuatl, TlamacazapaNahuatl, Western HuastecaNahuatl, Zacatlán-Ahuacatlán-TepetzintlaNaiNaka'elaNakaiNakameNakanaiNakaraNakeNakiNakwiNalcaNaliNalikNaluNalögoNama (Papua New Guinea)NamakuraNamatNambas, BigNambikuára, SouthernNamboNambyaNamiaNamiaeNamibian Sign LanguageNamlaNamoNamonuitoNamosi-Naitasiri-SeruaNamuyiNanaiNancereNandeNandiNankinaNantiNanticokeNanubaeNapuNar PhuNaraNarakNarangoNarauNarimNaroNaromNarragansettNarrinyeriNaruaNarunggaNasalNasarianNaskapiNasu, WumengNasu, WusaNatanziNatchezNateniNathemboNatioroNatüguNaueteNaunaNauruNavajoNavutNawaruNawathinehenaNawdmNawuriNaxiNayiNayiniNcaneNchumbuluNda'nda'NdaiNdakaNdaktupNdaliNdamNdambaNdasaNdauNde-GbiteNde-Nsele-NtaNdebele, NorthNdebele, SouthNdemliNdendeuleNdengerekoNdingNdoNdoboNdoeNdogoNdoloNdomNdombeNdonde HambaNdongaNdoolaNdugaNdumuNdundaNdungaNdutNdyuka-Trio PidginNeapolitanNedebangNefameseNegerhollandsNegeri Sembilan MalayNegidalNehanNekNekginiNekoNekuNemeNemiNenNendNenetsNengoneNeo-Aramaic, AssyrianNeo-Aramaic, Barzani JewishNeo-Aramaic, BohtanNeo-Aramaic, ChaldeanNeo-Aramaic, WesternNepalese Sign LanguageNeteNew Zealand Sign LanguageNewar, MiddleNeyoNez PerceNgaanyatjarraNgad'aNgad'a, EasternNgadjunmayaNgaingNgajuNgalaNgalakanNgalumNgamNgamamboNgambayNgaminiNgamoNganasanNgandiNgando (Central African Republic)Ngando (Democratic Republic of Congo)NgandyeraNgangamNganyaywanaNgarinmanNgarinyinNgarlaNgarlumaNgasNgasaNgatik Men's CreoleNgawunNgbakaNgbaka Ma'boNgbaka ManzaNgbandi, NorthernNgbandi, SouthernNgbeeNgbindaNgbunduNgelimaNgembaNgeqNgeteNggemNggwahyiNgieNgiemboonNgileNgindoNgitiNgizimNgomNgombaNgombaleNgombe (Central African Republic)Ngombe (Democratic Republic of Congo)NgongoNgoniNgoshieNgulNguluNguluwanNgumbiNgundiNgunduNgungwelNgurimiNgurmburNguônNgwabaNgweNgwoNgäbereNhandaNhengatuNhuwalaNiasNicaraguan Sign LanguageNicobarese, CarNicobarese, CentralNicobarese, SouthernNiellimNigerian Sign LanguageNihaliNiiNiksekNilaNilambaNimadiNimanburNimbariNimboranNimiNimoNimoaNinamNindiNingeraNinggerumNingilNingyeNinzoNipsanNisaNisenanNisga'aNisi (China)Nisu, EasternNisu, NorthernNisu, SouthernNisu, SouthwesternNiuafo'ouNiuatoputapuNiueanNivacléNjalgulguleNjebiNjenNjerepNjyemNkamiNkangalaNkariNkem-NkumNkhumbiNkonghoNkonyaNkorooNkoyaNkukoliNkutuNnamNo linguistic contentNobiinNobonobNocamánNogaiNoiriNokukuNomaandeNomaneNomatsiguengaNomuNonuyaNooksackNoonNooneNoricNornNorraNorse, OldNorth Arabian, AncientNorwegianNorwegian BokmålNorwegian NynorskNorwegian Sign LanguageNorwegian, TravellerNotreNotsiNottowayNottoway-MeherrinNovialNoyNsengaNshiNsongoNtchamNtombaNuaulu, NorthNuaulu, SouthNubacaNubiNubian, OldNubriNuerNugunu (Australia)Nugunu (Cameroon)NukNukak MakúNuknaNukuiniNukumanuNukuoroNukuriaNumana-Nunku-Gbantu-NumbuNumanggangNumbamiNumeNumidianNung (Viet Nam)NungaliNunggubuyuNunguNuni, NorthernNuni, SouthernNupbikhaNupe-Nupe-TakoNusa LautNusuNuu-chah-nulthNyabwaNyaheunNyahkurNyakyusa-NgondeNyala, EastNyaliNyamNyamalNyamboNyamusa-MoloNyamwangaNyamweziNyanekaNyang'iNyangaNyanga-liNyangatomNyangboNyanggaNyangumartaNyanjaNyankoleNyaturuNyawNyawaygiNyembaNyengoNyenkhaNyeuNyiginaNyiha (Malawi)Nyiha (Tanzania)Nyika (Malawi and Zambia)Nyika (Tanzania)NyindrouNyinduNyoleNyongNyoreNyoroNyulnyulNyungaNyungweNyâlayuNzakambayNzakaraNzanyiNzimaNá-MeoNêlêmwa-NixumwakO'chi'chi'O'duObanlikuObispeñoObloObokuitaiOboloObulomOcainaOccitan (post 1500)OdOdiaiOdoodeeOdualOdutOfayéOfoOgbahOgbiaOgbogoloOgbronuagumOgeaOhlone, NorthernOhlone, SouthernOirat, WrittenOirataOjibwaOjibwa, CentralOjibwa, EasternOjibwa, NorthwesternOjibwa, SevernOjibwa, WesternOkanaganOki-No-ErabuOkiekOkinawan, CentralOko-Eni-OsayenOko-JuwoiOkoboOkodiaOkolodOkpamheriOkpe (Northwestern Edo)Okpe (Southwestern Edo)OksapminOkuOlekhaOloOlomaOlratOlu'boOlulumo-IkomOmaguaOmaha-PoncaOmbambaOmboOmiOmokOmotikOmuranoOnaOne, InebuOne, KaboreOne, KwamtimOne, MolmoOne, NorthernOne, SouthernOneidaOngOninOnin Based PidginOnjobOnoOnobasuluOnondagaOntenuOntong JavaOorlamsOpaoOpataOpuuoOrang KanaqOrang SeletarOrejónOringOriya, AdivasiOrmaOrmuOrmuriOroOro WinOrochOrohaOrokOrokaivaOrokoOrokoloOromoOromo, Borana-Arsi-GujiOromo, EasternOromo, West CentralOroqenOroweOrumaOryaOsageOsatuOscanOsingOsosoOssetianOssetic, OldOt DanumOtankOtiOtomi, Eastern HighlandOtomi, Estado de MéxicoOtomi, IxtencoOtomi, MezquitalOtomi, QuerétaroOtomi, TemoayaOtomi, TenangoOtomi, TexcatepecOtomi, TilapaOtoroOttawaOtuhoOtukeOumaOuneOwaOweniaOwinigaOyOya'oyaOydaPa DiPa'aPa-HngPaamaPaasaalPacahuaraPacohPadoePaekchePaelignianPagiPagibetePaguPahari, KulluPahari, MahasuPahari-PotwariPahiPahlavaniPahlaviPai TavyteraPaicîPaipaiPaiute, NorthernPaiwanPak-TongPakanhaPakaásnovosPakistan Sign LanguagePakuPalPalaicPalauanPalaung, RuchingPalaung, RumaiPalaung, ShwePalawano, Brooke's PointPalawano, CentralPalawano, SouthwestPalenqueroPaliPalikúrPaliyanPalorPalpaPalu'ePaluanPamPambiaPame, CentralPame, NorthernPame, SouthernPamlicoPamonaPamosuPampangaPana (Burkina Faso)Pana (Central African Republic)Panamanian Sign LanguagePanamintPanaráPanasuanPanawaPancanaPanchparganiaPandePangasinanPangsengPangwaPangwaliPanimPaniyaPanjabiPanjabi, WesternPankararéPankararúPankhuPanneiPano, KulinaPanoboPanytyimaPapapanaPaparPapasenaPapelPapiPapiamentoPapitalaiPaporaPapumaParachiParaguayan Sign LanguageParakanãParananParanawátParaujanoParaukParawenPardhanPardhiPareParecísParengaParkwaParsiParsi-DariParthianParyaPashto, CentralPashto, NorthernPashto, SouthernPasiPatamonaPataniPataxó Hã-Ha-HãePatepPathiyaPatpatarPattaniPaulohiPaumaríPausernaPawaiaPawneePaynamarPePearPechPechenegPeerePeiPekalPelaPele-AtaPelendePemonPenan, EasternPenan, WesternPenang Sign LanguagePenchalPendauPengoPenrhynPentlatchPeraiPeroPersianPersian Sign LanguagePersian, IranianPersian, Manichaean MiddlePersian, Old (ca. 600-400 B.C.)Peruvian Sign LanguagePetatsPetjoPfaelzischPhaiPhakePhalaPhaluraPhana'PhangduwaliPhendePhilippine Sign LanguagePhimbiPhoenicianPholaPhola, AloPholoPhong-KniangPhowa, AniPhowa, HlephoPhowa, LaboPhrygianPhu ThaiPhuanPhudagiPhuiePhukhaPhumaPhunoiPhuongPhupaPhuphaPhuzaPiamatsinaPiamePiapocoPiaroaPicardPicene, NorthPicene, SouthPictishPidgin English, ChinesePidgin, CameroonPidgin, NigerianPidgin, TimorPiemontesePijaoPijePijinPilagáPileniPima BajoPimbwePinai-HagahaiPingelapesePiniPiniguraPinjiPintiiniPintupi-LuritjaPinyinPipilPirahãPiratapuyoPirlatapaPiroPisaboPiscatawayPisidianPitcairn-NorfolkPitiPitjantjatjaraPitta PittaPiuPiya-KwonciPlains Indian Sign LanguagePlautdietschPlayeroPnarPochutecPodenaPogoloPohnpeianPokangáPokePokomoPolabianPolariPolciPolishPolish Sign LanguagePolonombaukPomPomoPomo, CentralPomo, EasternPomo, NortheasternPomo, NorthernPomo, SoutheasternPomo, SouthernPonamPonguPonosakanPonticPopoloca, CoyotepecPopoloca, MezontlaPopoloca, San Felipe OtlaltepecPopoloca, San Juan AtzingoPopoloca, San Luís TemalacayucaPopoloca, Santa Inés AhuatempanPopoluca, HighlandPopoluca, OlutaPopoluca, SayulaPopoluca, TexistepecPopti'PoqomamPoqomchi'PorohanonPort SandwichPort VatoPortuguesePortuguese Sign LanguagePotawatomiPotiguáraPouyePowariPowhatanPoyanáwaPrasuniPrincipenseProvidencia Sign LanguagePrussianPrākrit, ArdhamāgadhīPrākrit, MāhārāṣṭriPrākrit, SauraseniPsikyePu KoPuarePuelchePuerto Rican Sign LanguagePuinavePukapukaPulaarPulabuPularPuluwatesePumaPumi, NorthernPumi, SouthernPumpokolPuméPunan AputPunan Bah-BiauPunan Batu 1Punan MerahPunan MerapPunan TubuPunicPunuPuocPuquinaPuragiPurariPurepechaPurepecha, Western HighlandPuriPurikPurisimeñoPuruboráPurumPushtoPutaiPutohPutukwamPuyoPuyo-PaekchePuyumaPwaameiPyapunPyenPyu (Myanmar)PáezPááfangPäriPémonoPévéPökootQ'anjob'alQabiaoQaqetQashqa'iQatabanianQawasqarQiang, NorthernQiang, SouthernQimantQuapawQuebec Sign LanguageQuechanQuechuaQuechua, Ambo-PascoQuechua, Arequipa-La UniónQuechua, AyacuchoQuechua, CajamarcaQuechua, Cajatambo North LimaQuechua, ChachapoyasQuechua, ChinchaQuechua, Chiquián AncashQuechua, ClassicalQuechua, Corongo AncashQuechua, CuscoQuechua, Eastern ApurímacQuechua, Huallaga HuánucoQuechua, Huamalíes-Dos de Mayo HuánucoQuechua, Huaylas AncashQuechua, Huaylla WancaQuechua, Jauja WancaQuechua, LambayequeQuechua, Margos-Yarowilca-LauricochaQuechua, Napo LowlandQuechua, North BolivianQuechua, North JunínQuechua, Northern Conchucos AncashQuechua, PacaraosQuechua, Panao HuánucoQuechua, PunoQuechua, San MartínQuechua, Santa Ana de Tusi PascoQuechua, Sihuas AncashQuechua, South BolivianQuechua, Southern Conchucos AncashQuechua, Southern PastazaQuechua, Yanahuanca PascoQuechua, YauyosQuenyaQueyuQuichua, Calderón HighlandQuichua, Cañar HighlandQuichua, Chimborazo HighlandQuichua, Imbabura HighlandQuichua, Loja HighlandQuichua, Northern PastazaQuichua, Salasaca HighlandQuichua, Santiago del EsteroQuichua, Tena LowlandQuileuteQuinaultQuinquiQuiripiRabhaRadeRaeticRahambuuRajasthaniRajbanshiRajiRajongRakahanga-ManihikiRakhineRalteRamaRamoaainaRamopaRampiRangRangkasRanglongRangpuriRaoRapaRapanuiRapoisiRaptingRara Bakati'RasawaRatagnonRatahanRathawiRauteRavulaRawaRawangRawatRawoRazajerdiReelRejangReliRemaRembarungaRembongRemoRempiRemunRendilleRengaoRennell-BellonaRennellese Sign LanguageRepanbitipRer BareRerauRerepResheResígaroRettaReyesanoRiang (India)Riang (Myanmar)RiantanaRibunRienRikbaktsaRinggouRirioRitarungoRiungRoglai, CacgiaRoglai, NorthernRoglai, SouthernRogoRohingyaRomaRomagnolRomamRomani, BalkanRomani, BalticRomani, CarpathianRomani, Kalo FinnishRomani, SinteRomani, TavringerRomani, VlaxRomani, WelshRomanianRomanian Sign LanguageRomanian, IstroRomanian, Macedo-Romanian, MeglenoRomano-GreekRomano-SerbianRomanovaRomanshRomanyRomblomanonRomboRomkunRonRongaRonggaRongpoRonjiRoonRoriaRotokasRotumanRovianaRudbariRufijiRugaRukaiRumaRumuRundiRungaRungusRungwaRussianRussian Sign LanguageRussian, OldRusynRutulRuuliRuundRwaSaSa'aSa'banSa'ochSaafi-SaafiSaamSaamiaSaaroaSabaSabaeanSabanêSabaotSabineSabuSabümSacapultecoSadriSadri, OraonSaekSaepSafalibaSafeyokaSafwaSagalaSagallaSahoSahuSaisiyatSajalongSajau BasapSakachepSakaoSakataSakeSakirabiáSalaSalampasuSalarSalasSalchuqSalemanSalibaSalinanSalish, Southern Puget SoundSalish, StraitsSallandsSalt-YuiSalumáSalvadoran Sign LanguageSamSamaSama, CentralSama, PangutaranSama, SouthernSamaritanSamarokenaSamataoSambaSamba LekoSambal, BotolanSambeSamberigiSamburuSameiSami, AkkalaSami, InariSami, KemiSami, KildinSami, NorthernSami, PiteSami, SkoltSami, SouthernSami, TerSami, UmeSamoSamo, MatyaSamo, MayaSamo, SouthernSamoanSamogitianSamosaSampangSamreSamtaoSamvediSanapanáSandaweSanga (Democratic Republic of Congo)Sanga (Nigeria)SanggauSangilSangirSangisariSangkongSanglechiSangoSango, RiverainSangu (Gabon)Sangu (Tanzania)SaniSanieSaniyo-HiyeweSansiSanskritSantaliSanumáSaparuaSapoSaponiSaposaSapuanSapéSarSaraSara KabaSara Kaba DemeSara Kaba NáàSaramaccanSarasiraSaravecaSardinianSardinian, CampidaneseSardinian, GallureseSardinian, LogudoreseSardinian, SassareseSarikoliSarliSarsiSartangSaruaSaruduSarugaSasakSasaruSatawaleseSaterfriesischSateré-MawéSaudi Arabian Sign LanguageSaurashtraSauriSauria PahariaSauseSausiSaviSavosavoSawaiSaweruSawiSawilaSawknahSaxon, OldSaxon, UpperSayaScotsScottish, TravellerScythianSebaSebat Bet GurageSeberuangSebopSebuyauSecheltSecoyaSedangSedoaSeekuSegaiSegejuSegetSehwiSeimatSeit-KaitetuSekaniSekapanSekarSeke (Nepal)Seke (Vanuatu)SekiSeko PadangSeko TengahSekpeleSelangor Sign LanguageSelaruSelayarSeleeSelepetSelianSelkupSelungai MurutSeluwasanSemaiSemandangSemaq BeriSembakung MurutSemelaiSemimiSemnamSemnaniSempanSenaSena, MalawiSenayaSeneSenecaSenedSengeleSenggiSengoSengsengSenhaja De SrairSenoufo, CebaaraSenoufo, DjiminiSenoufo, MamaraSenoufo, NyarafoloSenoufo, PalakaSenoufo, ShempireSenoufo, SupyireSenoufo, SyenaraSenoufo, TagwanaSensiSentaniSentinelSepa (Indonesia)Sepa (Papua New Guinea)SeraSerbianSerbo-CroatianSereSererSeriSeriliSeroaSerranoSeruSeruaSerudung MurutSerui-LautSetaSetamanSetiSettlaSewa BaySezeShaShabakShahmirzadiShahrudiShall-ZwallShama-SambugaShamangShambalaShanShanenawaShangaSharanahuaShark BaySharwaShastaShattShauShawneeSheShehriShekhawatiShekkachoShekoSheltaShenduSheniSherbroSherdukpenSherpaShiShikiShillukShinaShina, KohistaniShinaboShipibo-ConiboShixingSholagaShom PengShonaShoo-Minda-NyeShorShoshoniShuaShuaditShuarShubiShughniShumashtiShumchoShuswapShuwa-ZamaniShwaiSialumSiamouSianSianeSiangSiar-LakSiawiSibeSicanianSicelSicilianSidamoSideticSieSierra Leone Sign LanguageSighuSihanSikaSikaianaSikaritaiSikianaSikkimeseSiksikaSikuleSilaSileibiSilesianSilesian, LowerSilimoSiliputSilopiSilt'eSimaaSimbaSimbaliSimbariSimboSimekuSimeulueSimteSinagenSinasinaSinaugoroSindarinSindhiSingaSingapore Sign LanguageSingphoSinhalaSininkereSinsauruSinyarSioSionaSipacapenseSiraSirayaSiriSirianoSirionóSirmauriSiroiSisaala, TumulungSisaala, WesternSissalaSissanoSiuslawSivandiSiwaiSiwiSiwuSkagitSkalvianSkouSlave (Athapascan)Slavey, NorthSlavey, SouthSlovakSlovakian Sign LanguageSlovenianSnohomishSo (Democratic Republic of Congo)So'aSobeiSogaSogdianSoiSokSokoroSolanoSoliSolongSolosSomSomaliSomba-SiawariSomraiSomraySomyevSondeSongeSonghai, Koyraboro SenniSonghay, Humburi SenniSonghay, Koyra ChiiniSongoSongomenoSongooraSongway Kiini, TondiSonhaSoniaSoninkeSonsorolSooSopSoqotriSoraSorbian, LowerSorbian, UpperSori-HarenganSorkheiSorothapticSorsoganon, NorthernSorsoganon, SouthernSos KundiSotho, SouthernSouSouth African Sign LanguageSouth West BaySowaSowandaSpanishSpanish Sign LanguageSpanish, Loreto-UcayaliSpanish, OldSpokaneSquamishSranan TongoSri Lankan Sign LanguageStellingwerfsStieng, BudehStieng, BuloStoneySuaboSuarminSuauSubaSuba-SimbitiSubanen, CentralSubanen, NorthernSubanen, SouthernSubanon, KolibuganSubanon, WesternSubiyaSubtiabaSudestSudovianSuenaSugaSugangaSuiSukiSukuSukumaSukurSukurumSulaSulkaSulodSumaSumariupSumauSumbawaSumbwaSumerianSunamSundaneseSunwarSuoySurSurbakhalSuriSurigaononSurjapuriSursurungaSuruaháSurubuSuruíSuruí Do ParáSusquehannockSusuSusuamiSuundiSuwawaSuyáSvanSwabianSwahili (individual language)Swahili (macrolanguage)Swahili, CongoSwatiSwedishSwedish Sign LanguageSwiss-French Sign LanguageSwiss-German Sign LanguageSwiss-Italian Sign LanguageSylhetiSyriacSyriac, ClassicalSálibaSãotomenseSénoufo, NanerigéSénoufo, SenaraSénoufo, SìcìtéSôT'enTa'oih, LowerTa'oih, UpperTaabwaTabaruTabassaranTablaTaboTabriakTacanaTachawitTachelhitTachoniTadaksahakTadyawanTae'TafiTagabawaTagakauloTagalogTagargrentTagbanwaTagbanwa, CalamianTagbanwa, CentralTagbuTagdalTagishTagoiTahitianTahltanTaiTai DaengTai DamTai DoTai DónTai HongjinTai LoiTai LongTai NüaTai PaoTai ThanhTai YaTaiapTaikatTainaeTainoTairora, NorthTairora, SouthTairumaTaitaTaiwan Sign LanguageTajeTajikTajioTajuasohnTakelmaTakestaniTakiaTakuaTakuuTakwaneTalTalaTalaudTaliabuTaliengTalinga-BwisiTaliseTalodiTalokiTalondo'TaluTalyshTama (Chad)Tama (Colombia)TamagarioTamahaq, TahaggartTamajaq, TawallammatTamajeq, TayartTaman (Indonesia)Taman (Myanmar)TamanakuTamang, EasternTamang, Eastern GorkhaTamang, NorthwesternTamang, WesternTamashekTamasheqTamazight, Central AtlasTamazight, TemacineTamazight, TidikeltTambasTamboraTambotaloTamiTamilTamil, OldTamkiTampuanTampulmaTanacrossTanahmerahTanainaTanana, LowerTanana, UpperTanapagTandaganonTandiaTanemaTangaleTangchangyaTangguTangkoTanglangTangoaTanguatTangutTanimbiliTanimuca-RetuarãTanjijiliTanna, NorthTanna, SouthwestTanzanian Sign LanguageTapebaTapeiTapietéTapirapéTarahumara, CentralTarahumara, LowlandTarahumara, NorthernTarahumara, SoutheasternTarahumara, SouthwesternTarangan, EastTarangan, WestTarengTarianaTarifitTarokTarokoTaromi, UpperTarpiaTartessianTasawaqTasmanianTasmateTat, MuslimTatanaTatarTatuyoTauadeTaulilTaungyoTaupotaTauseTaushiroTausugTauyaTavetaTavoyanTawalaTawandêTawaraTawbuid, EasternTawbuid, WesternTawortaTawoyanTay BoiTay KhangTayoTaznatitTboliTchitchegeTchumbuliTe'unTeanuTebul Sign LanguageTedagaTeeTefaroTegaliTehitTehuelcheTeke, IbaliTeke-EboTeke-FuumuTeke-KukuyaTeke-LaaliTeke-NzikouTeke-TegeTeke-TsaayiTeke-TyeeTektitekoTela-MasbuarTelefolTeluguTemTembo (Kitembo)Tembo (Motembo)TembéTemeTemeinTemiTemiarTemoqTemuanTenggerTenharimTeninoTenisTennetTeopTeorTepecanoTepehua, HuehuetlaTepehua, PisafloresTepehua, TlachichilcoTepehuan, NorthernTepehuan, SoutheasternTepehuan, SouthwesternTeraTerebuTereiTerenoTeressaTerewengTeribeTerikTermanuTernateTernateñoTeseTeshenawaTesoTetelaTeteteTetumTetun DiliTewa (Indonesia)Tewa (USA)TeweThaThachanadanThaiThai Sign LanguageThai SongThai, NortheasternThai, NorthernThai, SouthernThakaliThangmiThaoTharakaTharu, ChitwaniaTharu, DangauraTharu, KathoriyaTharu, KochilaTharu, RanaThayoreThaypanThoThompsonThophoThracianThu LaoThudamThulungThurawalThuriTialeTiangTibeaTibetanTibetan, AmdoTibetan, ClassicalTibetan, KhamsTibetan, OldTichurongTicunaTidoreTieneTifalTigakTigreTigrinyaTiiTikarTikopiaTillamookTilungTimaTimbeTimneTimucuaTinaniTindiTingui-BotoTiniguaTinputzTipperaTiraTirahiTiriTirurayTitaTitanTivTiwaTiwa, NorthernTiwa, SouthernTiwiTiéfoTjurruruTlingitToTo'abaitaToaripiTobaToba-MaskoyTobangaTobatiTobeloTobianTobilungToboTochoTodaTodrahTofanmaTogoyoTohono O'odhamTojolabalTok PisinTokanoTokelauTokharian ATokharian BToku-No-ShimaTolTolakiTolomakoTolowaTomaTomadinoTombelalaTombonuoTombuluTominiTomoipTondanoTonga (Nyasa)Tonga (Tonga Islands)Tonga (Zambia)TongweTonjonTonkawaTonsawangTonseaTontemboanTooroTopoiyoToposaToraja-Sa'danToramTorauToroToromonoToronaTorricelliTorwaliToráTotelaTotoTotoliTotonac, CoyutlaTotonac, Filomena Mata-CoahuitlánTotonac, HighlandTotonac, PapantlaTotonac, TecpatlánTotonac, Upper NecaxaTotonac, WesternTotonac, Xicotepec De JuárezTotonac, YecuatlaTotoroTouoToura (Côte d'Ivoire)Toura (Papua New Guinea)Toussian, NorthernToussian, SouthernToweiTregamiTremembéTriengTrimurisTringTrinidad and Tobago Sign LanguageTrinitarioTripuri, EarlyTriqui, ChicahuaxtlaTriqui, CopalaTriqui, San Martín ItunyosoTrióTrukáTrumaiTs'ün-LaoTsaangiTsakhurTsakonianTsakwamboTsamaiTsatTsekuTsetsautTshanglaTsikimbaTsimanéTsimshianTsishinginiTsoTsoaTsogoTsongaTsotsoTsouTsumTsuvadiTsuvanTswaTswanaTswapongTuTuamotuanTubarTucanoTugenTugunTugutilTujia, NorthernTujia, SouthernTukang Besi NorthTukang Besi SouthTukiTukpaTukudedeTukumanfédTulaTulehuTulishiTuluTulu-BohuaiTuma-IrumuTumakTumbukaTumiTumleoTumshuqeseTumtumTumzabtTunebo, AngosturasTunebo, Barro NegroTunebo, CentralTunebo, WesternTunenTungagTunggareTuniaTunicaTunisian Sign LanguageTunjungTunniTunzuTuotombTuparíTupinambáTupinikinTupuriTupíTurakaTuriTuriwáraTurkaTurkanaTurkishTurkish Sign LanguageTurkish, Balkan GagauzTurkish, OldTurkish, Ottoman (1500-1928)TurkmenTuroyoTurumsaTurungTuscaroraTutchone, NorthernTutchone, SouthernTuteloTutongTutubaTututniTuvaluTuvinianTuwariTuwuliTuxináwaTuxáTuyucaTwanaTwendiTwentsTwiTyapTyaraityTz'utujilTzeltalTzotzilTàyTày Sa PaTày TacTéénTübatulabalUUab MetoUamuéUareUbagharaUbangUbiUbirUbykhUdaUdiUdiheUdmurtUdukUfimUgandan Sign LanguageUgariticUgheleUgongUhamiUighurUighur, OldUisaiUjirUkaanUkhwejoUkitUkpe-BayobiriUkpet-EhomUkrainianUkrainian Sign LanguageUkueUkurigumaUkwaUkwuani-Aboh-NdoniUlau-SuainUlchUlithianUllatanUlukwumiUlumanda'UlwaUmaUma' LasanUma' LungUmanakainaUmatillaUmbindhamuUmbrianUmbu-UnguUmbugarlaUmbunduUmbuygamuUmedaUmonUmotínaUmpilaUmpqua, UpperUnaUnamiUncoded languagesUndeterminedUneapaUnemeUnserdeutschUnuaUra (Papua New Guinea)Ura (Vanuatu)UradhiUrak Lawoi'UraliUrapminUrarinaUrartianUratUrduUrhoboUriUriginaUrimUrimoUripiv-Wala-Rano-AtchinUrninganggUruUru-Eu-Wau-WauUru-Pa-InUruangnirinUruavaUrubú-KaaporUrubú-Kaapor Sign LanguageUruguayan Sign LanguageUrumUrumiUsaghadeUsanUsarufaUshojoUskuUspantecoUsuiUtarmbungUte-Southern PaiuteUtuUvbieUvean, WestUyaUyajitayaUzbekUzbek, NorthernUzbek, SouthernUzekweVaagri BooliVafsiVaghat-Ya-Bijim-LegeriVaghriVaghuaVaglaVaiVaipheiValeValencian Sign LanguageValmanValpeiVamaleVameVandalicVangunuVanimoVanoVanumaVaoVarhadi-NagpuriVarisiVarliVasaviVeddahVehesVeluwsVemgo-MabasVendaVenetianVeneticVenezuelan Sign LanguageVengoVentureñoVepsVera'aVestinianVidundaViemoVietnameseVilelaViliVinmavisVinzaVishavanVitiVitouVlaamsVlaamse GebarentaalVolapükVolscianVonoVoroVoticVumbuVunapuVunjoVurësVuteVwanjiVõroWaWa'emaWaamaWaamwangWaataWabWaboWabodaWadaginamWaddarWadjiginyWadjiguWae RanaWaffaWagawagaWagayaWagdiWagemanWagiWahgiWahgi, NorthWaigaliWaigeoWailakiWailapaWaimaWaima'aWaimahaWaimiri-AtroariWaioliWaiwaiWajaWajarriWakaWakawakaWakdeWakhiWakonáWalaWalakWali (Ghana)Wali (Sudan)WalingWalioWalla WallaWallisianWalloonWalmajarriWalserWalunggeWamasWambayaWambonWambuleWameyWaminWampanoagWamparWampurWanWanambreWanapWandaWandalaWandamenWandarangWandjiWaneciWangaWangaaybuwan-NgiyambaaWanggamalaWangganguruWanggomWanmanWannuWanoWantoatWanukakaWanéWaoraniWapanWapishanaWappoWar-JaintiaWaraWaraoWarapuWaray (Australia)Waray (Philippines)WardamanWardujiWaremboriWaresWarisWaritaiWariyanggaWarjiWarkay-BipimWarlmanpaWarlpiriWarluwaraWarnangWaropenWarrgamayWarrwaWaruWarumunguWarunaWarunguWasaWasco-WishramWasemboWashoWaskiaWasuWatakatauiWatamWatiwaWatubelaWatut, MiddleWatut, NorthWatut, SouthWaubeWauráWauyaiWawaWawoniiWaxianghuaWayampiWayanaWayoróWayuWayuuWedauWehWejewaWelikiWelshWelsh, MiddleWelsh, OldWeriWersingWestphalienWetamutWewawWeytoWhitesandsWiarumusWichitaWichí Lhamtés GüisnayWichí Lhamtés NoctenWichí Lhamtés VejozWik-EpaWik-IiyanhWik-KeyanganWik-Me'anhaWik-MungkanWik-NgathanaWikalkanWikngencheraWilawilaWintuWinyéWipiWiradhuriWirafédWiranguWiruWiyotWocconWogamusinWogeoWoiWojenakaWolaneWolaniWolayttaWoleaianWolioWolofWolof, GambianWom (Nigeria)Wom (Papua New Guinea)WomoWongoWoriaWorimiWorodougouWotapuri-KatarqalaiWotuWoun MeuWuduWuliwuliWulnaWumbokoWumbvuWunambalWurruguWushiWusiWutungWutunhuaWuvulu-AuaWuzlamWyandotWymysorysWáraWãphaWè NorthernWè SouthernWè WesternXaasongaxangoXakriabáXamtangaXavánteXerénteXetáXhosaXibeXincaXipayaXiriXiriânaXoklengXukurúXârâcùùYaakuYabaranaYabaânaYabemYabenYabongYaceYaeyamaYafiYagariaYagnobiYagomiYaguaYagwoiaYahadianYahangYahunaYaka (Central African Republic)Yaka (Congo)Yaka (Democratic Republic of Congo)YakaikekeYakamaYakanYakhaYakomaYakutYalaYalahatanYalakaloreYalarnngaYaleYale, KosarekYalebaYali, AnggurukYali, NiniaYali, Pass ValleyYalunkaYamapYambaYambesYambetaYamdenaYameoYamiYaminahuaYamnaYamongeriYamphuYan-nhanguYanaYandruwandhaYanesha'YangbenYangkamYangmanYangoYangulamYangum DeyYangum GelYangum MonYankunytjatjaraYanomamöYanomámiYansiYanyuwaYaoYaouréYapeseYapundaYaqayYaquiYarawataYarebaYarsunYasaYassicYau (Morobe Province)Yau (Sandaun Province)YaulYaumaYaurYaviteroYawaYawalapitíYawanawaYawarawargaYaweyuhaYawiyoYawuruYazgulyamYeiYekheeYekoraYelaYeleYelmekYeloguYembaYemsaYendangYeniYenicheYerakaiYeretuarYerongYerukulaYessan-MayoYetfaYevanicYeyiYi, AxiYi, NaluoYi, SichuanYi, Wuding-LuquanYiddishYiddish, EasternYiddish, WesternYidghaYidinyYilYimasYinchiaYindjibarndiYindjilandjiYineYinggardaYir YorontYisYobaYogadYoidikYokeYokutsYolaYomYombeYonaguniYongYongkomYopnoYoraYoronYorubaYout WamYoyYucatec Maya Sign LanguageYuchiYucunaYugYugambalYugoslavian Sign LanguageYugur, EastYugur, WestYuhupYukaghir, NorthernYukaghir, SouthernYukiYukpaYukubenYuluYupik, CentralYupik, Central SiberianYupik, NaukanYupik, Pacific GulfYupik, SirenikYuquiYuracareYurokYurutíYuwanaYámanaZabanaZaghawaZaiwaZakhringZambian Sign LanguageZan GulaZanakiZande (individual language)ZangskariZangwalZapotecZapotec, AloápamZapotec, AmatlánZapotec, AncientZapotec, Asunción MixtepecZapotec, AyoquescoZapotec, CajonosZapotec, ChichicapanZapotec, ChoapanZapotec, Coatecas AltasZapotec, CoatlánZapotec, El AltoZapotec, ElotepecZapotec, Guevea De HumboldtZapotec, GüiláZapotec, IsthmusZapotec, LachiguiriZapotec, LachixíoZapotec, Lapaguía-GuiviniZapotec, LoxichaZapotec, MazaltepecZapotec, MiahuatlánZapotec, MitlaZapotec, MixtepecZapotec, OcotlánZapotec, OzolotepecZapotec, PetapaZapotec, QuiavicuzasZapotec, Quioquitani-QuieríZapotec, RincónZapotec, San Agustín MixtepecZapotec, San Baltazar LoxichaZapotec, San Pedro QuiatoniZapotec, San Vicente CoatlánZapotec, Santa Catarina AlbarradasZapotec, Santa Inés YatzechiZapotec, Santa María QuiegolaniZapotec, Santiago XanicaZapotec, Santo Domingo AlbarradasZapotec, Sierra de JuárezZapotec, Southeastern IxtlánZapotec, Southern RinconZapotec, TabaaZapotec, TejalapanZapotec, TexmelucanZapotec, TilquiapanZapotec, TlacolulitaZapotec, TotomachapanZapotec, XadaniZapotec, XanaguíaZapotec, YalálagZapotec, YareniZapotec, YateeZapotec, YatzachiZapotec, YautepecZapotec, ZaachilaZapotec, ZanizaZapotec, ZoogochoZaramoZariZarmaZarphaticZauzouZayZayse-ZergullaZazaZazaoZeemZeeuwsZembaZemgalianZenagZenagaZerenkelZhabaZhang-ZhungZhireZhoaZhuangZhuang, Central HongshuiheZhuang, DaiZhuang, Eastern HongshuiheZhuang, GuibeiZhuang, GuibianZhuang, LianshanZhuang, LiujiangZhuang, LiuqianZhuang, MinzZhuang, NongZhuang, QiubeiZhuang, YangZhuang, YongbeiZhuang, YongnanZhuang, YoujiangZhuang, ZuojiangZiaZialoZigulaZimakaniZimbaZimbabwe Sign LanguageZinzaZireZiriyaZizilivakanZo'éZokhuoZoque, ChimalapaZoque, CopainaláZoque, Francisco LeónZoque, RayónZoque, TabascoZouZulgo-GemzekZuluZumayaZumbunZuniZáparout-Ma'inÀhànÁncáÖmieÖngeProject-Id-Version: iso_639-3
Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues
POT-Creation-Date: 2018-01-17 22:10+0100
PO-Revision-Date: 2012-01-18 23:33+0100
Last-Translator: Francisco Diéguez <frandieguez@ubuntu.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n!=1);
!XóõAre are'Auhelawa//AniGandaXegwiGwiXamHuaA-PucikwarAariAasáxAbadiAbagaAbai SungaiAbaniomAbarAbauAbazaAbidxiAbinomnAbiponAbishiraAbjazianoAbnaki do LesteAbnaki do OesteAbomAbonAbronAbuAbuaAbuíAbunAburéAbureniAbéAchaguaAchangAcheAcheronAchiAchinésAchterhoeksAchuar-ShiwiarAchumawiAchéAcipa, do lesteAcolíAcroáAdabeAdaiLingua de signos  damorobeAdangAdangbeAdangmeAdasenAdeleAdholaAdiAdioukrouAdnyamathanhaAdonaraAdugeAdiguéAdzeraAekaAekyomAequianAerAfadeAfarLingua de signo afganaAfittiAfrihiliAfricánerAgarabiAgariyaAgatuAgavotaguerraAghemAghuAghulAghwanAgiAgobAgoiAgta, IslaAlabatAgta, Casiguran DumagatAgta, Central CagayanAgta, DicamayAgta, DupaninanAgta, IsarogAgta, Mt. IrayaAgta, Monte IrigaAgta, PahananAgta, Umiray DumagetAgta, Villa ViciosaAguacatecoAguanoAguarunaAgunaAgutaynenAgwagwuneAhantaAheuAhiraniAhomAhtenaAhwaiAi-ChamAighonAikanãAiklepAimaqAimeleAimolAinbaiAinu (China)Ainu (Xapón)AiomeAiroranAitonAizi, AproumuAizi, MobumrinAizi, TiagbamrinAja (Benin)Aja (Sudán)AjawaAjiëAjyíninka ApurucayaliAkAkaAka-BeaAka-BoAka-CariAka-JeruAka-KedeAka-KolAka-KoraAkanAkar-BaleAkaselemAkawaioAkeAkebuAkeiAkeuAkhaAkhvakhAcadioAklanonAkoletAkooseAkoyeAkpaAkpesAkrukayAkukuAkumAkuntsuAkurioAkwaLingua de signos de Al-Sayyid BedouinAlaba-K’abeenaAlabamaAlagoAlagwaAlakAlamblakAlanganAlanicAlapmunteAlawaAlbanésAlbanés, ArbëreshëAlbanés, ArvanitikaAlbanés, GhegAlbanésAlegeAlekanoAleutianoAleut, MednyjLingua de signos arxelinaAlgonquiano, CarolinaAlgonquinAliAlladianoAllarAlngithAlorAlseaAlta, do norteAlta, do surAltai, do norteAltai, meridionalAluguAlumu-TesuAluneAluoAlurAlutorAlviri-VidariAlyawarrAma (Papúa Nova Guinea)Ama (Sudán)AmahaiAmahuacaAmaimonAmalAmami-Oshima, do norteAmami-Oshima, MeridionalAmanabAmanayéAmaraAmarakaeriAimaráAmba (Islas Solomon)Amba (Uganda)Ambae do lesteAmbae do oesteAmbaiAmbakichAmbelauAmbeleAmblongAmboAmbrakAmbrym, NorthAmbrym, sudesteAmbulAmbulasAmdangAmeleLingua de signos americanaAmháricoAmiAmisAmis, NataoranAmoAmolAmpanangAmtoAmundavaAmuzgo, GuerreroAmuzgo, IpalapaAmuzgo, San Pedro AmuzgosAnaangAnakalanguAnalAnamAnambéAnamguraAnasiAndaiAndaquiAndarumAndegerebinhaAndhAndiAndioAndoaAndoqueAndra-HusAneityumAnemAneme WakeAnfilloAngaatahaAngalAngal EnenAngal HenengAngikaAnglo-NormanAngloromaniAngolarAngorAngoramAniiAnimereAnindilyakwaAnjamAnkaveAnmatyerreAnongAnorAnsermaAnsusAntakarinyaAnuakAnufoAnukiAnusAnutaAnyinAnyin MorofoAohengAoreAp MaApache, JicarillaApache, KiowaApache, LipanApache, Mescalero-ChiricahuaApache, do oesteApalacheeApalaíApaliApataniApiakáApinayéApmaApurináAputaiAquitanianArabanaArabelaÁrabeÁrabe, arxelinoÁrabe, arxelino saharianoÁrabe, andalusíÁrabe, BaharnaÁrabe chadianoÁrabe, chipriotaÁrabe, dhofariÁrabe, exipcio oriental bedawiÁrabe, exipcioÁrabe do golfoÁrabe, hadramiÁrabe, hixaziÁrabe Xudeu-iraquíÁrabe Xudeu-marroquíÁrabe, Xudeu-tripolitanoÁrabe, Xudeu-tunecinoÁrabe, Xudeu-yemeníÁrabe, libioÁrabe, mesopotámicoÁrabe, marroquíÁrabe, najdiÁrabe, levantino do norteÁrabe, norte de MesopotamiaÁrabe, omaniÁrabe, saidiÁrabe, sannaniÁrabe, shihhiÁrabe, siculoÁrabe, sur de levanteÁrabe, estándarÁrabe, sudanésÁrabe, Ta'izzi-AdeniÁrabe, TaxicoÁrabe, tunecinoÁrabe, uzbekoAragonésArakiAralle-TabulahanArameoc, Xudeu babilonio (ca. 200-1200 CE)Arameo, palestino judíoAramaico, Oficial (700-300 AC)Arameo, samaritanoArammbaAranadanAranama-TamiqueArandaiAraonaArapahoArapasoArapesh, AbuúArapesh, BumbitaArawakArawetéArawumArboreArchiAreArebaAremLingua de signos ArxentinaArgobbaArguniArhuacoArhâArhöAriAribwatsaAribwaungArifama-MiniafiaArigidiArikapúArikaraArikemArinAringaArmaArmazicArmenioLiengua de signos armeniaArmenio, clásicoArmenioArop-LokepArop-SissanoArosiArpitanArrarnta, occidentalArrernte, do lesteArtaAruamuAruekAruopArutaniAruá (Estado de Amazonas)Aruá (Estado de Rodonia)Arára, Mato GrossoArára, ParáAsAsaro'oAsasAsheAshkunAshtianiAsháninkaAshéninka PajonalAshéninka PerenéAshéninka, PichisAshéninka, Ucayali surAshéninka, Ucayali-YurúaAsiluluAskopanAsmat, costa CasuarinaAsmat, CentralAsmat, norteAsmat, YaosakorAsoaAsamésAssanAssangoriAssiniboineAsturianoAsu (Nixeria)Asu (Tanzania)AsumboaAsuriAsurini, TocantinsAsuriní, XingúAtaAtakapaAtampayaAtayalAtembleAthpariyaAtiAtikamekwAtohwaimAtoradaAtsahuacaAtsamAtsugewiAtta, FaireAtta, PamplonaAtta, PudtolAttiéAuAuluaAuráAuxiAushiriAustralLingua de signos dos aborixes australianosLingua de signos australianaLingua de signos austriacaAuweAuyeAuyokawaAvar antigoAváricoAvatimeAvauAvésticoAvikamAvokayaAvá-CanoeiroAwa (China)Awa (Papúa Nova Guinea)Awa-CuaiquerAwabakalAwad BingAwadhiAwakAwarAwaraAwbonoAweerAweraAwetíAwingAwiyaanaAwjilahAwngiAwtuwAwuAwunAwutuAwyiAwyu, AsueAwyu, CentralAwyu, EderaAwyu, JairAwyu, norteAwyu, SurAxambAyabadhuAyereAyi (Papúa Nova Guinea)AyiwoAyiziAimaráAimará, centralAimará, do surAyoreoAyta, AbellenAyta, AmbalaAyta, Mag-IndiAyta, Mag-antsiAyta, MagbukunAyta, SorsogonAyta, TayabasAyuAcerbaixanoAzerbayano, do norteAcerbaixano, do surAzhaAzheBaanBaangiBaatonumBabaBabangoBabankiBabar, do norteBabar, suresteBabatanaBabineBabuzaBacamaBactrianBada (Indonesia)Bada (Nixeria)BadagaBadeBadeshiBadimayaBaduiBadyaraBaegguBaeleleaBaetoraBafanjiBafaw-BalongBafiaBafutBaga KaloumBaga KogaBaga SitemuBaga SobanéBagheliBagirmiBago-KusuntuBagriBagupiBagusaBagvalalBahamBahauBahinemoBahingBahnarBahonsuaiBaiBai, centralBai do surBaibaiBaikenoBaimaBaimakBainouk-GunyaamoloBainouk-GunyuñoBainouk-SamikBaisoBajanBajau, IndonesiaBajau, Costa oesteBajelaniBaka (Camerún)Baka (Sudán)BakairíBakakaBakhtiariBakiBakokoBakoleBakpinkaBakumpaiBakwéBalaesangBalangaoBalanta-GanjaBalanta-KentoheBalantakBalauBaldemuBali (Congo)Bali (Nixeria)BalinésBaloBalochi, orientalBalochi, meridionalBalochi, occidentalBaloiBaltiBaluan-PamBaluchiLingua de signos de BamakoBamaliBambalangBambamBambaraBambassiBambili-BambuiBamenyamBamuBamukumbitBamunBamunkaBamweLingua de signos de Ban KhorBanaBanaroBanda (Indonesia)Banda, meridionalBanda, sur centralBanda, Togbo-VaraBanda, centro oesteBanda-BambariBanda-BandaBanda-MbrésBanda-NdeleBanda-YangereBandiBandialBandjalangBangalaBanganduBangbaBanggaiBanggarlaBangiBangkaBangolanBangubanguBangwinjiBanivaBaniwaBanjarBankagoomaBankonBannoniBantawaBantayanonBantikBantoanonBaouléBaraamuBaraiBarakaiBaramaBarambuBaramuBarapasiBarasBarasana-EduriaBarbacoasBarbareñoBardiBareinBareli, PalyaBareli, PauriBareli, RathwiBargamBariBariaiBarijiBarikanchiBarokBarombiBarrow PointBarugaBaruyaBarweBaréBaríBasa (Camerún)Basa (Nixeria)Basa-GumnaBasa-GurmanaBasapBasayBashkardiBashkirBasketoVascoBassaBassa-KontagoraBassariBassossiBataBatakBatak Alas-KluetBatak AngkolaBatak DairiBatak KaroBatak MandailingBatak SimalungunBatak TobaBatangaBatekBateriBathariBati (Camerún)Bati (Indonesia)BatsBatuBatuiBatuleyBauBauchiBaureBauriaBauwakiBauziBávaroBayaliBaybayanonBaygoBayonoBayotBayunguBazigarBeamiBeaverBebaBebeleBebeliBebilBedjondBedoanasBeekeBeeleBeembeBeezenBefangBejaBekatiBekwarraBekwelBelaitBelanda ViriBielorrusoBelhariyaBeli (Papúa Nova Guinea)Beli (Sudán)Bella CoolaBellariBemba (Zambia)BembaBena (Nixeria)Bena (Tanzania)BenabenaBenchBendeBendiBengBengaBengalíBenggoiLingua de signos de BengkalaBentongBenyaduBeothukBepourBeraBerakouBerawan, CentralBerawan, orientalBerawan, oesteBerikBerinomoBeromBertaBertiBesisiBesmeBesoaBetafBetawiBeteBete-BendiBeti (Costa de marfil)BezhtaBhadrawahiBhalayBihariBhatriBhattiyaliBhayaBheleBhil, SindhiBhilaliBhiliBhojpuriBhoti, SpitiBhoti, StodBhujelBhunjiaBiafadaBiageBiakBialiBiangaiBiaoBiao MonBidayuh, BauBidayuh, BiatahBidayuh, Bukar-SadungBidayuh, Tringgus-SembaanBidiyoBidyaraBidyogoBiemBiereboBieriaBieteBigaBijoriBikaruBikolBikol, Buhi'nonBikol, LibonBikol, MirayaBikol, RinconadaBikol, Albay oesteBikyaBilaBilakuraBilaspuriBilbaBilbilBileBilinBiloxiBiluaBilurBimaBiminBimobaBina (Nixeria)Bina (Papua Nueva Guinea)BinahariBinandereBineBiniBinjiBintaunaBintuluBinukidBinukidnon, septentrionalBinukidnon, meridionalBinumarienBipiBiraleBiraoBirgitBirhorBiriBirifor, MalbaBirifor, do surBiritaiBirkedBirriBirwaBisaya, BruneiBisaya, SabahBiseniBishnupriyaBishuoBisisBislamaBisorioBissaBisuBitBitareBiturBiwatBiyoBiyomBlaan, KoronadalBlaan, SaranganiBlablangaBlafeBlagarBlangSímbolos BlisBo (Laos)Bo (Papúa Nova Guinea)Bo-RukulBo-UngBoano (Maluku)Boano (Sulawesi)Bobo Madaré do norteBobo Madaré do surBobongkoBobotBodo (República centro-africana)Bodo (India)Bodo ParjaBofiBogaBogayaBoghomBoguruBoikinBokhaBoko (Benin)Boko (Congo)BokobaruBokotoBokyiBolaBolangoBoleBúlgaroBolgoBoliaBolinaoLingua de signos bolivianoBoloBolokiBolonBolondoBolonganBolyuBomBomaBomboliBombomaBomitabaBomuBomwaliBon GulaBonanBondeiBondoBonerateBonerifBonggiBonggoBongiliBongoBonguBonjoBonkengBonkimanBontokBontok, CentralBontok do lesteBontok do norteBontok do surBontok do suesteBookanBoonBoorBor, BelandaBoraBoreiBoro (Etiopía)Boro (Ghana)BorongBorucaBorôroBoselewaBosngunBosnioBote-MajhiBotlikhBouyeiBozabaBozo, JenaamaKelengazxo BozoBozo, TiemacèwèBozo, TiéyaxoBragatBrahuiBrajLingua de signos brasileiraBremBreriBretónBretónBreton, antigoBribriBrithenigLingua de signos británicaBrokkatBrokpakeBrokskatBroome Pearling Lugger PidginBru, OrientalBru, OccidentalBruneiBuBuaBuamuBuang, ManggaBuang, MaposBubeBubiBubiaBudibudBudong-BudongBuduBudukhBudumaBudzaBuganBugawacBughotuBuginésBuglereBugunBuhidBuhutuBukatBukharicBukitanBukiyipBuksaBukusuBukwenBúlgaroLingua de signos búlgaraBulgebiBuli (Ghana)Buli (Indonesia)Bullom SoBulu (Camerún)Bulu (Papúa Nova Guinea)BumBumajiBumthangkhaBunBunaBunabaBunakBunamaBundeliBungBungainBungkuBunguBunu, Bu-NaoBunu, JiongnaiBunu, WunaiBunu, YounuoBununBuolBura-PabirBurakBurakaBurarraBurateBurdekin, BaixoBurdunaBureBuriatBuriat, ChinaBuriat, MongoliaBuriat, RusiaBurjiBurmbarBirmanoBurmese, antigoBurmesoBuru (Indonesia)Buru (Nixeria)BuruiBurumakokBurunBurungeBurushaskiBurusuBuruwaiBusaBusamBusamiBushiBushoongBusoBusoaBussaBusuuButmas-TurButuanonBuwalBuyang, BahaBuyang, E'maBuyang, LangnianBuyuBwaBwaidokaBwamu, CwiBwamu, La laBwanabwanaBwatooBwelaBwileBwisiByangsiByepBéte, GuiberouaBété, DaloaBété, GagnoaC'lelaCaacCabiyaríCabécarCacaoperaCacuaCaddoCahuaranoCahuillaCakaCakchiquel-Quiché idioma mixtoCakfem-MushereCallawallaCaluyanunCalóCamlingCampalagianCamsáCamthoCamunicCandoshi-ShapraCanelaCanichanaCao LanCao MiaoCapanahuaCapiznonCaquinteCaraCarabayoCaramantaCarapanaCarianCarib, GalibiIslas caribeñasCarijonaCarolinioCarrierCarrire do SurCashibo-CacataiboCashinahuaCatalánLingua de signos catalánCatawbaCaucaCavineñaCayubabaCayugaCayuseCebuanoCeltíberoCemuhiCenCentúúmCermaChachiLingua de signos de ChadChadongChagataiChaimaChakChakaliChakmaChalaChalikhaCham, EsteCham do oesteChamacocoChamalalChamariChambealiChambriChamicuroChamorroChangriwaChangthangChantyalChanéCharaChatino, Altos do lesteChatino, NopalaChatino, TataltepecChatino, tierras altas occidentalesChatino, ZacatepecChatino, ZenzontepecChaudangsiChauraChavacanoChayahuitaCheChechenoChehalis, BaixoChehalis, AltoCheke HoloChemakumChenapianChenchuChenouaChepangChepyaChereponCherokeeChesuChetcoChetti, WayanadChewongCheyenneChhattisgarhiChhintangeChhulungLingua de signos ChiangmaiChiapanecChibchaChichimeca-JonazChickasawChicomuceltecChigaChilcotinLingua de signos chilenoChilissoChimarikoChimilaChin, AshoChin, BawmChin, BualkhawChin, ChinbonChin, DaaiChin, FalamChin, KhumiChin, MaraChin, MünChin, NgawnChin, PaiteChin, SenthangChin, SiyinChin, TawrChin, TedimChin, ThadoChin, ZotungChinaliChinantec, ChiltepecChinantec, ComaltepecChinantec, LalanaChinantec, LealaoChinantec, OjitlánChinantec, OzumacínChinantec, PalantlaChinantec, QuiotepecChinantec, TepetotutlaChinantec, TepinapaChinantec, TlacoatzintepecChinantec, UsilaChinantec, Valle NacionalChinésLingua de signos chinoChino, GanChinés, HakkaChino, HuizhouChino, JinyuChino. medio tardíoChino, literarioChino, MandarínChino, Min BeiChino, Min DongChino, Min NanChino, Min ZhongChino, antigoChino, Pu-XianChino, WuChino, XiangChino, YueChinook, jergaChinook, argotChipayaChipewyanChippewaChiquitanoChiruChitimachaChittagonianChocangacakhaChochotecoChoctawChodriChokweCholCholónChongChoniChontal, OaxacaChontal, OaxacaChontal, TabascoChonyi-Dzihana-KaumaChopiChorasmianChorote, Iyo'wujwaChorote, Iyojwa'jaChortíChrauChruChuaveChugChujChukaChukotChukwaChulymChumburungChurahiChutChuukeseChuvantsyChuvashChuwabuChácoboCia-CiaCibakCicipuCimbrianCinda-Regi-TiyalCineniCinta LargaCishinginiCitakCitak, TamnimCiwogaiClallamSiríaco clásicoCoahuiltecoCocama-CocamillaCochimiCocopaCoeur d'AleneCofánCoguiColLingua de signos colombianoColoradoColumbia-WenatchiComancheComecrudoComo KarimComoriano. MaoreComorian, MwaliComorian, NdzwaniComoriano, NgazidjaComoxConCoosCoptoCoquilleCora, O NayarCora, Santa TeresaCoriCórnicoCórnicoCórnico antigoCorsoLingua de signos costaricenseCotonameCowlitzCreeCree, MooseCree, nororientalCree, llanurasCree, surorientalCree, SwampyCree, WoodsCreekÁrabe crioulo, BabaliaÁrabe criollo, sudanésHolandés criollo, BerbiceHolandés criollo, skepiInglés crioulo, Antigua e BarbudaInglés crioulo, BahamasInglés criollo, Fernando PoInglés mestizo, granadinoInglés criollo, GuyaneseINglés criollo, HawaiInglés criollo sanandresanoInglés criollo, xamaicanoInglés criollo, NicaraguaInglés criollo, Sea IslandInglés criollo, tobagonianoInglés criollo, TrinidadInglés criollo (Turcos e Caicos)Inglés criollo, vincentianoInglés criollo, islas VirxesFrancés mestizo, guadalupanoFrancés criollo, GuianeseFrancésc criollo, KaripúnaFrancés criollo, ReuniónFrancés crioulo, Saint LucianFrancés criollo, San MiguelFrancés mestizo, seselwaHindi criollo, AndamanMalayo criollo, MalaccanMalayo criollo, Sri LankaPortugués criollo, KorlaiPortugués criollo, MalaccanCrioulo afro-semínolaCriollo, CafundoCriollo, Torres StraitCrioulo, Guinea superiorLingua de signos croataCroataCrowCruzeñoCuaLingua de signos cubanoCubeoCuibaCuicatec, TepeuxilaCuicatec, TeutilaCulinaCumanagotoCumbricCunCungCupeñoCuronianCurripacoCutchi-SwahiliCuvokCuyononChecoLingua de signos checoCôôngDaantanai'DaasanachDabaDabarreDabeDacioDadibiDadiyaDagaDagaare do surDagaari DioulaDagara do norteDagbaDagbaniDagikDagomanDahaloDaho-DooDaiDairDaju, Dar DajuDaju, Dar FurDaju, Dar SilaDaka, SambaDakkaDakotaDakpakhaDálmataDamaDamakawaDamalDamar, esteDamar, oesteDambiDameliDampelasDanDanaruDanauDangaléatDani, Gran Val inferiorDani, Gran Valle medioDani, Gran Valle superiorDani do oesteDanésLingua de signos danésDanés, viaxeiroDanoDaoDaondaDaraiDargwaDari, ZoroastrianoDarlongDarmiyaDassDatoogaDaurDavawenyoDawawaDawera-DaweloorDawroDayDayak, MalayicDayiDazagaDeccanDeduaDefakaDegDegaruDegemaDegenanDegexit'anDehuDehwariDekDela-OenaleDelawareDelaware, PidginDeloDemDemaDemisaDemtaDendi (Benin)Dendi (República centroafricana)DengeseDengkaDenoDenyaDeníDeoriDera (Indonesia)Dera (Nixeria)DesanoDesiyaDewoinDezfuliDghwedeDhaisoDhalandjiDhankiDhanwar (Nepal)DhaoDhargariDhatkiDhimalDhivehiDhodiaDhundariDhurgaDhuwalDiaDibiyasoDiboDiboleDida, LakotaDida, YocobouéDidingaDidoDieriDigoDiiDijim-BwilimDillingDimaDimasaDimbongDimeDimli (idioma individual)DingDinkaDinka, noroesteDinka, noroesteDinka, sur centralDinka, suresteDinka, suroesteDirariDirashaDiriDirikuDirimDisaDitammariDitidahtDiuweDixon ReefDizinDjambarrpuynguDjamindjungDjangunDjauanDjawiDjeebbanaDjinangDjinbaDjingiliDjiwarliDobelDobuDoeDogaDoghoroDogon, AmpariDogon, Ana TingaDogon, Bondum DomDogon, BunogeDogon, Dogul DomDogon, Donno SoDogon, JamsayDogon, MomboDogon, Nanga DamaDogon, Tebul UreDogon, Tene KanDogon, Tiranige DigaDogon, Tomo KanDogon, Toro SoDogon, Toro TeguDogon, Yanda DomDogosoDogoséDogri (idioma individual)Dogri (macrolingua)DogribDokaDoko-UyangaDolganDolpoDomDomaakiDomariDombeLingua de signos dominicanoDompoDomuDomungDondoDongDong do norteDong do surDongoDongotonoDongxiangDoondoDori'oDoromu-KokiDororoDorzeDosoDoutaiDoyayoDrentsDrungDualaDuanoDuauDubliDubuDugunDuguriDugworDuhwaDukeDulbuDumaDumagat, RemontadoDumbeaDumiDumpasDumunDunaDunganDungmaliDungra BhilDunguDuraDuriDuriankereDurumaDuruwaDusnerDusun DeyahDusun MalangDusun WituDusun, SugutHolandésLingua de signos holandésNeerlandés medieval (ca. 1050-1350)Holandés, antigoDutton World SpeedwordsDuungoomaDuupaDuvleDuwaiDuwetDwangDyaabugayDyaberdyaberDyanDyangadiDyirbalDyugunDyulaDzaDzalakhaDzandoDzao MinDzodinkaDzongkhaDzùùngooDâwEE'ñapa WoromaipuMaroon criollo orientalEbiraEblanEbriéEbughuLingua de signos ecuatorianoEde CabeEde IcaEde IdacaEde IjeEde Nago, KuraEdoloEdomitaEdopiEfaiEfate, norteEfate do surEfeEfikEfutopEgaEggonLingua de signos egipcioExipcio (antigo)EhueunEipomekEitiepEjaghamEjamatEkajukEkariEkiEkitEkpeyeEl HugeiratEl MoloElamitaElemeElepiElipElkeiEloyiElsengEluElymianEmaeEmai-Iuleha-OraEmanEmbalohEmberá do norteEmberá-BaudóEmberá-CatíoEmberá-ChamíEmberá-TadóEmbuEmerillonEmilianEmplawasEmumuEnEnawené-NawéEndeEnets, BosqueEnets, TundraEngaEngenniEngganoInglésInglés, liberianoInglés medio (1100-1500)Inglés, Antigo (ca. 450-1100)EnrekangEnuEnwan (Estado de Akwa Ibom)Enwan (estado de Edu)EnyaEpenaEpi-OlmecEpieEravallanEraveEreEritaiErokwanasErreErromintxelaErsuEruwaErzyaEsanEseEse EjjaEshtehardiEsimbiEsperantoEsselenEstonioLingua de signos estonioEstonio, estándarEsumaEtcheminEtebiEtenEteocretanEteochipriotaLingua de signo etíopeEtkywanEton (Camerún)Eton (Vanuatu)EtruscoEtuloEvantEvenEvenkiEwage-NotuEweEwondoExtremeñoEyakFaganiFaitaFaiwolFalaFaliFali, BaissaFali do NorteFali do surFaliscanFamFanagaloFang (Camerún)Fang (Guinea ecuatorial)FaniaFantiFarefareFeroésFars, noroesteFars, sudoesteFasFasuFatalekaFatalukuFayuFe'fe'FembeFerogeFixinoFijian, occidentalFilipinoLingua de signos finlandés-suecoFinésLingua de signos finésFinésFinés, TornedalenFinonganFipaFiranFiwagaIslas FlindersFoauFoiFoia FoiaFolopaFomaFonFongoroFoodoForakFordataForeFortsenalFrankishFrancésLingua de signos francésFrancés, CajunFrancés medieval (ca. 1400-1600)Francés arcaico (842-ca. 1400)Frisón do lesteFrisón do norteFrisón, antigoFrisón do oesteFriulianoFulahFulfulde, AdamawaFulfulde, BagirmiFulfulde, BorguFulfulde, centro este de NigerFulfulde, MaasinaFulfulde, NixerianoFulfulde, oeste de NigerFuliiruFulniôFumFungwaFurFuruFutuna do lesteFutuna-AniwaFuyugFweFwâiFyamFyerGaGandaGadangGaaGaamGabriGabrielino-FernandeñoGadaba, BodoGadaba, MudhiliGadaba, Pottangi OllarGadangGaddangGaddiGadeGadjerawangGadsupGaélico, hiberno-escocésGaélico, escocésGafatGagaduGagauzGaguGahriGaikundiGailGainaGalGalambuGalatianGalelaGaleyaGallegoGalegoGalindanGaloGamberaGamilaraayGamitGamkonoraGamoGamo-NingiGanaGanangGandaGaneGanggalidaGanglauGangteGanguluGantsGanzaGanziGaoGapapaiwaGarasia, AdiwasiGarasia, RajputGarhwaliGarifunaGarig-IlgarGaroGarreGarusGarzaGataGalo cisalpinoGaulish, TransalpinoGavarGavião Do JiparanáGavião, ParáGawar-BatiGawwadaGayilGayoGaziGbagyiGbanuGbanziriGbariGbaya (República centroafricana)Gbaya (Sudán)Gbaya, noroesteGbaya do suroesteGbaya-BossangoaGbaya-BozoumGbaya-MbodomoGbayiGbe, AyizoGbe, CiGbe, DefiGbe,  Xwla do lesteGbe, GbesiGbe, KotafonGbe, MaxiGbe, SaxweGbe, TofinGbe, WaciGbe, WemeGbe, Xwla occidentalGbe, XwelaGbiiGbiri-NiraguGeGebeGedagedGedeoGeezGejiGelaGelao, verdeGelao, vermelloGelao, brancoGemeGenGendeGengleXeorxianoGeorgiano, antigoGepoGeraAlemánLingua de signos alemánAlemán, Colonia TovarGermánicas, huteritaAlemán, Alta Idade Media (ca. 1050-1500)Alemán, Baixa Idade MediaAlemán, Baixa Idade Media (ca. 750-1050)Alemán, PennsylvaniaAlemán, suizoGerumaGeser-GoromGhadamèsGhale, septentrionalGhale, meridionalLingua de signos de GhanaGhanonggaGhariGhayaviGheraGhodoberiGhomaraGhomalaGhotuoGhulfanGianganGibanawaGidarGiiwoGikyodeGilakiGilbertésGilimaGilyakGimi (Terras altas do leste)Gimi (Oeste de nova britania)GimmeGimnimeGinumanGinyangaGirawaGiryamaGitongaGituaGitxsanGiyugGiziga, norteGiziga, SouthGizrraGlaro-TwaboGlavdaGlio-OubiGnauGoariaGobasiGobuGodiéGodwariGoemaiGofaGogoGogodalaGokanaGolaGolinGondiGondi do norteGone DauGongdukGonjaGoodenough, oesteGooniyandiGorGorakorGorapGorontaloGorovuGorowaGóticoGoundoGourmanchémaGowlanGowliGowroGozarkhaniGrangaliGran andamanés, mezcladoGreboGrebo, BarclayvilleGrebo, CentralGrebo, GbolooGrebo do norteGrebo do surLingua de signos griegoGrego antigo (ata 1453)Griedo, capadocciaGrego moderno (1453-)Grego, micénicoGresiGromaGroningsGros VentreGuaGuahiboGuajajaraGuajáGuambianoGuana (Brasil)Guana (Paraguay)GuananoGuancheGuanyinqiaoGuaraníGuaraní. do leste de BoliviaGuaraní, MbyáGuaraní, paraguayoGuaraní. do oeste de BoliviaGuarayuGuarequenaLingua de signos de GuatemalaGuatóGuayaberoGudanjiGudeGuduGuduf-GavaGugadjGugu BadhunGugu WarraGuguberaGuguyimidjirGuhu-SamaneLingua de signos GuineanoGuiqiongGujaratiGujariGula (República centroafricana)Gula (Chad)Gula IroGula'alaaGulayGuleGuliguliGumaluGumatjGumawanaGumuzGunGundiGungabulaGunguGuntaiGunwingguGunyaGupa-AbawaGupapuynguGuragoneGuramalumGuraniGurdjarGureng GurengGurgulaGuriasoGurinjiGurmanaGuroGuruntum-MbaaruGusiiGusilayGuwamuGuyaGuyaniGvokoGwaGwahatikeGwamhi-WuriGwandaraGwedaGwenoGwereGwichʼinGyeleGyemHaHabuHadiyyaHadothiHadramiHadzaHaekeHahonHaiomHaidaHaida do norteHaida do surHaigwaiLingua de signos de HaiphongHaislaIdioma da cultura haitiana vodounHajiHajongHaköHalangHalang DoanHalbiHaliaHalkomelemHamapHambaHamer-BannaHamtaiHanHangaHanga HundiHangazaHaniHanoLingua de signos de HanoiHanunooHaramiHarariHaroiHarsusiHaruaiHarukuHaryanviHarzaniHashaHassaniyyaHatamHatticHaussaLingua de signos de hausaHavasupai-Walapai-YavapaiHavekeHavuHawaianoHayaHazaragiHdiHebreoHebreo ancianoHeheHeibanHeiltsukHelambu SherpaHelongHemaHembaHerdéHereroHermitHernicanHewaHeyoHibitoHidatsaHigaononHijukHiligaynonHimarimãHindiHindi, FijiHindko do norteHindko do surHinduriHindustaní, caribeñoHinukhHiri MotuHititaHititaNeo HittiteHitita, antigoHituHiwHixkaryánaHlaiHlersuHmarHmongHmong DawHmong DonHmong DôHmong NjuaHmong, sudoeste de GuiyangHmwavekeHoLingua de signos de ciudad Ho Chi MinHo-ChunkHoavaHobyótHoia HoiaHolikachukHoliyaHolmaHoloholoHoluHomaLingua de signos hondureñoLingua de signos de Hong KongHoniHopiHoroHoromHorpaHoteHotiHovonganHoyahoyaHozoHponHrangkholHreHrusoHuHuachipaeriHuambisaHuarijioHuastecHuauluHuave, San Dionisio do marHuave, San Francisco do MarHuave, San Mateo do MarHuave, Santa María do MarHubaHuicholHuillicheHuitoto, MinicaHuitoto, MuruiHuitoto, NüpodeHukuminaHulaHulauláHuliHulungHumeneHumlaHun-SaareHundeHungHunganaHúngaroLingua de signos húngaroHúngaro, antigoHunjara-Kaina KeHunnicHunsrikHunzibHupaHupdëHuplaHurrianHwanaHyaHyamHértevinHõneI-WakIaaiIamaleleIatmulIauIbaloiIbanIbanagIbaniIbatanIbéricoIbibioIbinoIbuIbuoroIslandésLingua de signos islandésIceve-MaciIda'anIdakho-Isukha-TirikiIdatéIdereIdesaIdiIdoIdomaIdonIdu-MishmiIdunaIfoIfugao, AmganadIfugao, BatadIfugao, MayoyaoIfugao, TuwaliIfèIgalaIganaIgboIgedeIgnacianoIgoIgutaIgweIhaPidgin basado en el ihaIhievbeIja-ZubaIjo, suresteIkIkaIkizuIkoIkoma-Nata-IsenyeIkpengIkpeshiIkposoIku-Gora-AnkwaIkuluIkwereIlaIle ApeIli TurkiIli'uunIllyrianIlokoIlongotIlueIlwanaImbonguImondaImroingInabaknonInapangLingua de signos indioIndo-portuguésIndonesioLingua de signos indonesioIndonesio, PeranakanIndriIdioma do val de IndusIneseñoIngaInga, JunglaIngrianIngushInoke-YateInonhanInorInterglossaInterlingua (lingua internacional auxiliar)InterlingueSignos internacionalesInthaInuktitutInuktitut, este de CanadáInupiakInupiatun, norte de AlaskaInupiatun, noroeste de AlaskaIowa-OtoIpikoIpiliIpuloIquitoIrIraqwIrarutuIrayaIresimIrigweIrlandésLingua de signos irlandésIrlandés medio (900-1200)Irlandés antigo (ata 900)Irlandés, primitivoIrulaIrántxeIsabiIsanzuIsconahuaIsebeIsekiriIshkashimiIsinaiIsirawaIsnagIsokoLingua de signos israelíIstriotIsu (división Fako)Isu (División Menchum)ItalianoLingua de signos italianoItawitItelmenIteneIteriItikItneg, BanaoItneg, BinonganItneg, InlaodItneg, MaengItneg, MasadiitItneg, MoyadanItoItonamaItu Mbon UzoItzáIvatanIvbie Okpela-Norte-ArheIwaidjaIwalIwamIwam, SepikIwurIxcatecIxilIyayuIyiveIyoIzereIzonIzoraIñapariJabutíJadJadgaliJah HutJahankaJakatiJakunJalkunanLingua de signos xamaicanoLingua de signos xamaicanoJamamadíJandavraJangkangJangshungJanjiXaponésLingua de signos xaponésXaponés, antigoJapreríaJaqaruJaraJaraiJarawa (India)JaruJaunsariXavanésXavanés, caribeñoXavanés, Nova CaledoniaJavindoJaweJayaJeberoJehJehaiJemezJengJereJeri KuoJerungLingua de signo de JhankotJiamaoJiarongJibaJibuJiidduJilbeJilimJimi (Camerún)Jimi (Nixeria)JinaJinuo, BuyuanJinuo, YouleJirelJiruJitaJjuJobaJofotek-BromnyaJola-FonyiJola-KasaJonkor BourmataguilLingua de signos xordanoJortoJoráJowuluJuJu/'hoanJuangXudeu-ÁrabeJudeo-bereberJudeo-GeorgianoJudeo-italianoXudeu-PersaJudeo-TatJukun TakumJumjumLingua de signos JumlaJumliJur ModoJurayJurchenJurúnaJutishJuwalJwira-PepesaJúmaK'iche'KaambaKaanKaansaKabaKabalaiKabardianKabateiKabiyèKabolaKabrasKaburiKabutraKabuverdianuKambaKabwariKabyleKachama-GanjuleKachariKachinKacipo-BalesiKaco'KadaiKadarKadaruKadazan, río KliasKadazan, Labuk-KinabatanganKadiwéuKaduoKafaKafoaKagateKagayanenKagomaKagoroKaguluKaheKahuaKaianKaiboboKaidipangKaiepKaikadiKaikeKaikuKaili, Da'aKaili, LedoKaili, UndeKaimbulawaKaimbéKaingangKaingáng, São PauloKairakKairiruKairui-MidikiKaisKaiviKaiwáKaiyKajakseKajaliKajamanKakabaiKakabeKakandaKaki AeKakoKakwaKala Lagaw YaKalaallisutKalabakanKalabariKalabraKalaganKalagan, KaganKalamKalamiKalamséKalanadiKalangaKalaoKalapuyaKalapuya do norteKalapuya do surKalarkoKalashaKalenjinKalinga, ButbutKalinga, LimosKalinga, LubuaganKalinga, val MabakaKalinga, MajukayangKalinga do surKalispel-Pend d'OreilleKalkotiKalkutungKallahan, Keley-IKallahan, TinocKalmykKalouKaluliKalumpangKamKamakanKamangKamanoKamantanKamarKamaraKamarianKamaruKamasKamasaKamasauKamayoKamayuráKamba (Kenya)KambaataKambairaKamberaKamberóKambiwáKami (Nixeria)Kami (Tanzania)KamoKamoroKamuKamulaKamviriKamweKanakanabuKanamaríKanashiKanasiKanaujiKandasKandawoKandeKanembuKangKangaKangeanKanggapeKangjiaKango (Dsitrito Bas-Uélé)Kango (distrito de Tshopo)KangriKanietKanikkaranKaningdon-NindemKaningiKaningraKaninuwaKaniteKanjariKanjobal do oesteKanjuKankanaeyKankanay do norteKannadaKanoéKansaKantosiKanuKanufiKanum, BädiKanum, NgkâlmpwKanum, SmärkyKanum, SotaKanuriKanuri, BilmaKanuri, CentralKanuri, MangaKanuri, TumariKanyokKaoKaondeKapKapinKapinawáKapingamarangiKaporiKaprimanKaptiauKapyaKaqchikelKara (República centroafricana)Kara (Korea)Kara (Papúa Nova Guinea)Kara (Tanzania)Kara-KalpakKaraboro do lesteKaraboro do oesteKarachay-BalkarKaradjeriKaragasKaraimKarajáKarakhanidKaramiKaramojongKarangKarangaKarankawaKaraoKarasKarataKarawaKarbiKarbi, AmriKare (República centroafricana)Kare (Papúa Nova Guinea)KarekareKarelianKaren, BweKaren, GebaKaren, GekoKaren, LahtaKaren, ManumanawKaren, Pa'oKaren, PakuKaren, Phrae PwoKaren, Pwo do lesteKaren, Pwo do norteKaren, Pwo do oesteKaren, S'gawKaren, YinbawKaren, YintaleKaren, ZayeinKareyKariKaringaniKaripunaKaripúnaKarirí-XocóKaritiânaKariyaKariyarraKarkar-YuriKarkinKarkoKarnaiKaro (Brasil)Karo (Ethiopia)KarokKaronKaron DoriKaroreKasangaKasemKashayaKashmiriKashubianoKasiguraninKaskaKaskeanKasuaKataangKatabagaKatawixiKatbolKatcha-Kadugli-MiriKathuKatiKatkariKatlaKatoKatsoKatu do lesteKatu do oesteKatuaKatukínaKatukína, PanoanKaulongKaurKaureKaurnaKauweraKavalanKavetKawachaKawaiisuKaweKawiKaxararíKaxuiânaKayabíKayagarKayah do lesteKayah do oesteKayanKayan MahakamKayan, BaramKayan, BusangKayan, rio KayanKayan, MendalamKayan, RejangKayan, WahauKayapóKayardildKayeliKayongKayortKaytetyeKayupulauKazakoKazukuruKe'oKeakKeaparaKedangKederKehuKeiKeigaKeinKeiyoKekchíKela (República demoncrática do Congo)Kela (Papúa Nova Guinea)KelabitKele (República Democrática do Congo)Kele (Papúa Nova Guinea)KelikoKeloKelonKemakKembayanKemberanoKembraKemiehuaKemtuikKenaboiKenatiKendayanKendejeKendemKengaKeninjalKensiuKenswei NseiLingua de signos de Kentish, antigoKenyah, WahauLingua de signos keniataKenyangKenyiKeoru-AhiaKepkiriwátKepo'KeraKerakKerehoKerekKeres do lesteKeres do oesteKereweKerewoKerinciKesawaiKetKetangalanKeteKetengbanKetumKewa, EastKewa, WestKeyaganaKgalagadiKhakasKhalajKhalaj, TurkicKhalingKham, Parbate orientalKham, GamaleKham, SheshiKham, Parbate occidentalKhambaKhamtiKhamyangKhanaKhandesiKhantyKhaoKhariaKharia TharKhasiKhayoKhazarKheKhehekKhengkhaKhetraniKhinalughKhirwarKhisaKhlorKhlulaJemer, centralJemer do norteKhmuKho'iniKholokKhorasani TurkishKhorezmianoKhotaneseKhowarKhuaKhuenKhunsariKhvarshiKhángKhünKibetKibiriKickapooKikaiKikuyuKilivilaKiliwaKilmeriKimKim MunKimaamaKimaragangKimbuKimbunduKimkiKimréKinabalianKinabatangan, superiorKinalaknaKinaray-AKingaKinnauriKinnauri, BhotiKinnauri, ChitkuliKinnauri, HarijanKintaqKinukuKinyarwandaKiokoKiongKiorrKiowaKipsigisKiputKir-BalarKireKirghizoKirghizoKirikiriKirmanjki (lingua individual)KisKisaKisankasaKisarKisiKisi do surKissi do norteKistaneKitanKitjaKitsaiKituba (Congo)Kituba (República Democrática do Congo)KiunumKiwai, noresteKiwai do surKlamath-ModocKlaoKlingonKnaanicKoKoalibKoasatiKobaKobianaKobolKobonKochKodaKodakuKodavaKodeohaKodiKodiaKoenoemKofaKofeiKofyarKoguryoKohinKohistaní, IndusKohoKohumonoKoiKoiali, montañaKoiari, GrassKoibalKoirengKoitabuKoiwatKok BorokKokataKokeKokodaKokolaKokotaKol (Camerún)Kol (Papúa Nova Guinea)KolaKolami, noroesteKolami do surKolbilaKoli, KachiKoli, ParkariKoli, WadiyaraKoluwawaKom (Camerún)Kom (India)KomaKombaKombaiKombioKomeringKomiKomi-PermyakKomi-ZyrianKominimungKomo (República Democrática do Congo)Komo (Sudán)KomodoKompaneKomyandaretKon KeuKonaiKondaKonda-DoraKonerawKongoKongo, San SalvadorKonjo, CoastalKonjo, terras altasKonkani (lingua individual)Konkani (macrolingua)Konkani, GoanKonkombaKonniKono (Guinea)Kono (Nixeria)Kono (Sierra Leona)KonomalaKonongoKonsoKonzoKoongoKoonzimeKooreteKoparKopkakaKorafe-YeghaKoraga, KorraKoraga, MuduKorakKoranaKorandjeCoreanoLingua de signos coreanaCoreano medieval (séculos X a XVII)Coreano antigo (séculos III a IX)KoreguajeKoresh-e RostamKorkuKoro (Costa de marfil)Koro (Papúa Nova Guinea)Koro (Vanuatu)KoromféKoromiraKoroniKoropKoropóKoroshiKorowaiKoruboKorupun-SelaKorwaKoryakKosadleKosenaKoshinKosraeanoKota (Gabón)Kota (India)Kota Marudu TalantangKotavaKotiKottKouyaKovaiKoveKowakiKowiaiKoy Sanjaq SuratKoyaKoyagaKoyoKoyukonKpaguaKpalaKpanKpasamKpatiKpatiliKpelleKpelle, GuineaKpelle, LiberiaKpessiKplangKracheKrahn do lesteKrahn do oesteKrahôKraolKrenakKrevinianoKreyeKrikati-TimbiraKrimKrioKriolInglés kriol, BelizeKrisaKrobuKrongoKru'ng 2Krumen, PlapoKrumen, PyeKrumen, TepoKrymchakKrytsKuaKuanKuanhuaKuanuaKuanyamaKubeKubiKuboKubuKucongKudiyaKudmaliKudu-CamoKugamaKugboKui (India)Kui (Indonesia)KuijauKuikúro-KalapáloKujargeKukKukatjaKukeleKuknaKuku-MangkKuku-Mu'inhKuku-MuminhKuku-UgbanhKuku-UwanhKuku-YalanjiKulaKulango, BondoukouKulango, BounaKulereKulfaKulisusuKulon-PazehKulung (Nepal)Kulung (Nixeria)KumaluKumamKuman (Rusia)KumaoniKumarbhag PahariaKumbaKumbainggarKumbaranKumbewahaKumhaliKumiaiKumukioKumykKumzariKuna, BorderKuna, San BlasKunamaKunbarlangKundaKundal ShahiKunduvadiKungKung-EkokaKungarakanyKunggariKuniKuni-BoaziKunigamiKunimaipaKunjaKunjenKunyiKunzaKuoKuotKupaInupiakKupsabinyKurKuramaKurankoKurdoKurdo, centralKurdo do norteKurdo do surKuriKuriaKurichiyaKurmukarKurramaKurtiKurtokhaKuruduKurukhKurumba, AluKurumba, AttapadyKurumba, BettaKurumba, JennuKurumba, KannadaKurumba, MulluKurux, nepalíKuruáyaKusaalKusagheKushiKuskokwim, superiorKusuKusundaKutenaiKutepKuthantKuttoKutuKuturmiKuuku-Ya'uKuviKuwaaKuwaataayKuyKw'adzaKwaKwaKwaamiKwadiKwaioKwajaKwakiutlKwakumKwalhioqua-TlatskanaiKwamaKwambiKwameraKwamiKwangKwangaKwangaliKwanjaKwara'aeKwasioKwayaKwazaKweguKwerKwerbaKwerba MamberamoKwereKwerisaKweseKwestenKwiniKwinsuKwintiKwomaKwomtariKxoeKyakKyakaKyeneleKyerungKâteKéléKölschLa'biLaalLaariLabaLabelLabirLaboLabuLacandónLachiLachi, blancoLadakhiLadino (Xudeu-español)LadinoLaeko-LibuatLafofaLaghuLaghuuLagwanLaha (Indonesia)Laha (Viet Nam)LahananLahndaManchúLahu ShiLaimbueLaiyoloLakLaka (Chad)Laka (Nixeria)LakaleiLakhaLakiLakkiaLakonLakondêLakotaLalaLala-BisaLala-RobaLaliaLalo, DongshanbaLalo, XishanbaLalu, orientalLalu, occidentalLama (Togo)LamaholotLamaleraLamangLamatukaLambaLambadiLambichhongLamboyaLambyaLameLamenuLametLamja-Dengsa-TolaLamkangLammaLamnsoLamogaiLampung ApiLampung NyoLamuLamu-LamuLandomaLang'eLangamLangbasheLangiLango (Sudán)Lango (Uganda)LangobárdicoLingua de signos da Bélxica francófonaLanohLaosianoLaomianLaopangLingua de signos laosianaLaragiaLardilLarevatLariLarike-WakasihuLaroLartehLaruLasalimuLasgerdiLashiLasiLatgalianoLatínLatuLatundêLituanoLingua de signos letónLetón, estándarLauLauaLauanLaujeLauraLaurentianoLavatbura-LamusongLaveLavenLavukaleveLawa do lesteLawa, occidentalLawanganLawunuiaLayakhaLazLecoLeelauLefaLega-MwengaLega-ShabundaLegboLegenyemLehaliLehalurupLeharLeiponLelakLele (Chad)Lele (Congo)Lele (Guinea)Lele (Papúa Nova Guinea)LelemiLelepaLembata, surLembata, OesteLembenaLemerigLemioLemnianLemolangLemoroLenakelLencaLenduLengiluLengoLengolaLeningitijLenjeLenkauLenyimaLepchaLepkiLeponticLereLeseLesing-GelimiLetemboiLeti (Camerún)Leti (Indonesia)LevukaLewoLewo ElengLewotobiLeyighaLezghianoLhokpuLhomiLi'oLiabukuLiana-SetiLibidoLibinzaLiburnianLingua de signos libiaLigbiLigenzaLigurianoLigurio (Ancián)LihirLijiliLikaLikiLikilaLikubaLikumLikwalaLilauLillooetLimassaLimba do lesteLimba, Central-OesteLimbuLimbumLimburguésLimiLimilnganLinduLineal ALingalaLingaoLingarakLingua francaLingua Franca NovaLipoLisabata-NunialiLiselaLishLishana DeniLishanid NoshanLishán DidánLisuLituanoLingua de signos lituanaLitzlitzLivLivviLo-TogaLoarkiLobalaLobiLobu, LanasLobu, TampiasLodhiLogbaLogoLogolLogooliLogorikLohar, GadeLohar, LahulLojbanLokaaLokoLokoyaLolaLolakLoleLoloLolodaLolopoLolopo, meridionalLoma (Costa de marfil)Loma (Liberia)LomaivitiLomavrenLombardLombiLomboLomweLomwe, MalawiLoncongLong WatLongguLongtoLongudaLoniuLonwolwolLonzoLooLopaLopiLopitLorangLorediakarkarLoteLotudLouLounLoup «A»Loup BLoziLua'LuangLuba-KatangaLuba-LuluaLubilaLubuLuchaziLucumiLudianLufuLugbaraLuguruLuiLuimbiLuisenoLukpaSami LuleLumba-YakkhaLumbeeLumbuLumunLunaLunanakhaLundaLundayehLunggaLuo (Camerún)Luo (Kenia e Tanzania)LuriLuri do norteLuri do surLusengoLushaiLushootseedLusiLusitanioLutosLuvaleLuwatiLuwian, cuneiformeLuwiano, hieroglíficoLuwoLuxemburguésLuyanaLuyiaLwaluLycianLydianLyngngamLingua de signos de LyonsLyéléLáadanLüMa (República Democrática do Congo)Ma (Papua nueva Guinea)Ma'anyanMa'diMa'di do surMa'yaMaaMaakaMaayMaba (Chad)Maba (Indonesia)MabaaleMabaanMabireMacaMacaguaxeMacaguánMacanésMacedonioMacedonio, anciánMachameMachiguengaMachinereMachingaMacoMacunaMacushiMada (Camerún)Mada (Nixeria)Lingua de signos de MadagascarMadakMadenMadiMadngeleMadureseMaeMaekMaewo, centralMafaMafeaMagahiMagar do lesteMagar do oesteMagomaMagoriMaguindanaonMahaliMahicanMahongweMahouMai BratMaiaMaiadomuMaianiMaidu, noresteMaidu, noresteMaidu, valMaiiMailuMaindoMainfränkischKenyah estabelecidoMairasiMaisinMaithiliMaiwa (Indonesia)Maiwa (Papúa Nova Guinea)MaiwalaMajangMajeraMajhiMajhwarMak (China)Mak (Nixeria)MakaaMakahMakasaeMakasarMakayamMakhuwaMakhuwa-MarrevoneMakhuwa-MeettoMakhuwa-MonigaMakhuwa-SakaMakhuwa-ShirimaMakian, lesteMakian, occidentalMaklewMakolkolMakondeMaku'aMakurápMakweMalMal PahariaMala (Nixeria)Mala (Papúa Nova Guinea)MalgacheMalagasy, BaraMalagasy, MasikoroMalagasy, Betsimisaraka septentrionalMalgacheMalagasy, SakalavaMalagasy, Betsimisaraka meridionalMalagasy, Tandroy-MahafalyMalagasy, TanosyMalagaso, BaraMalagasy, TsimihetyMalalamaiMalangoMalankuravanMalapandaramMalaryanMalasMalasarMalasar, MalaMalavedanMalayo (idioma individual)Malayo (macroLingua)Malaio, AmbonésMalay, BabaMalayo, BacaneseMalay, BalinésMalay, BandaMalayo, BerauMalayo, BukitMalayo, centralMalayo, Islas CocosMalay, JambiMalayo, KedahMalayo, Kota Bangun KutaiMalay, KupangMalay, LarantukaMalay, MakassarMalay, ManadoMalayo, molucas do norteMalaio, PapuanMalaio, PattaniMalaio, SabahMalaio, EstándarMalayo, Tenggarong KutaiMalayalamoMalaynonMalaioLingua de signos malaiaMale (Etiopia)Male (Papúa Nova Guinea)Malecite-PassamaquoddyMalengMaleu-KilengeMalfaxalMalganaMalgbeMalíMalilaMalimbaMalimpungMaloMalolMaltésLingua de signos maltésMalua BayMalviMaléku JaíkaMamMamaMamaaMamaindéMamanwaMamasaMambaeMambaiMambila, CamerúnMambila, NixeriaMamboruMambwe-LunguMampruliMamujuMamuliqueMamusiMamvuMan MetManamManambuManangbaManangkariManchúManda (Australia)Manda (India)Manda (Tanzania)MandahuacaMandaicoMandaico, clásicoMandanMandandanyiMandarMandaraMandariMandayaMandealiManderMandingoMandinkaMandjakMandobo AtasMandobo BawahManduri, BagaManemMangMangalaMangarayiMangarevaMangasMangayatMangbetuMangbutuMangerrManggaraiMangoMangoleMangsengMangueManideManikionManinka, KonyankaManinka, SankaranManinkakan do lesteManinkakan, KitaManinkakan, occidentalManipaManipuriManipuri, antigoMankanyaManna-DoraMannanManobo, AgusanManobo, AtaManobo, CotabatoManobo, DibabawonManobo, IlianenManobo, KinamigingManobo, MatigsalugManobo, OboManobo, Rajah KabunsuwanManobo, SaranganiManobo, Bukidnon occidentalManombaiMansakaMansiMansoankaMantaMantsiManx [Gaélico de Manx]ManyaManyawaManyikaManzaMaonanMaoríMapeMapenaMapiaMapidianMapoyoMapudungunMapunMaquiritariMaraMarachiMaragheiMaragusMaramaMarambaMaranaoMaranungguMararitMarathMarathi, antigoMarauMarbaMaremgiMarenjeMarfaMarganyMarghi centralMarghi surMarguMari (Provincia Sepik do leste)Mari (Provincia de Madang)Mari (Rusia)Mari do lesteMari do oesteMaria (India)Maria (Papua Nueva Guinea)Maria, DandamiMaricopaMaridanMaridjabinMarikMarimanindjiMarindMarind, BianMaringMaringarrMarinoMaririMarithielLingua de signos marítimoMaritsauáMariyediMarkaMarkweetaMarmaMarovoMarquesano, norteMarquesan, surMarriammuMarrucinianMarshalésMarsianoLingua de signos do viñedos de MartaMarti KeMartu WangkaMartuyhuniraMaruMarwariMarwari (India)Marwari (Pakistán)MarúboMasaabaMasaiMasalitMasanaMasbatenyoMasela, centralMasela, esteMasela, oesteMashco PiroMashi (Nixeria)Mashi (Zambia)MasimasiMasiwangMaskelynesMaslamMasmajeMassalatMassepMatagalpaMatalMatbatMatengoMatepiMatipuhyMatlatzinca, AtzingoMatlatzinca, San FranciscoMatoMatorMatsésMattoleMatukarMatumbiMatísMaungLingua de signos mauritanoMauwakeMawa (Chad)Mawa (Nixeria)MawakMawanMawayanaMawchiMawesMaxakalíMayagudunaMaya, epigráficoMayangnaMayekaMayoMayogoMazagwayMazahua, CentralMazahua, MichoacánMazanderaniMazateco, AyautlaMazateco, ChiquihuitlánMazateco, HuautlaMazateco, IxcatlánMazateco, Jalapa De DíazMazateco, MazatlánMazateco, San Jerónimo TecóatlMazateco, SoyaltepecMbaMbalaMbalanhuMbandjaMbangalaMbangiMbangweMbara (Australia)Mbara (Chad)Mbariman-GudhinmaMbatiMbatoMbayMbeMbe'MbelimeMbembe, Cross RiverMbembe, TigonMbereMbesaMbo (Camerún)Mbo (República Democrática do Congo)MboiMbokoMboleMbongaMbongnoMbosiMboweMbreMbudumMbuguMbugweMbukoMbukushuMbulaMbula-BwazzaMbuleMbulungishMbumMbundaMbungaMburkuMbwelaMe'enMedeburMedia LenguaMediakMedianMedumbaMefeleMegamMehekMehinákuMehriMekeoMekmekMekweiMelanau, CentralMelanau, Daro-MatuMelanau, Kanowit-TanjongMelanau, SibuMele-FilaMeloMelpaMemoniMendankwe-NkwenMende (Papúa Nova Guinea)Mende (Sierra Leone)MengakaMengenMengisaMenkaMenomineeMentawaiMenyaMeohang do lesteMeohang, oesteMeoswarMerMerameraMereiMereyMeriamMerlavMeroiticoMeruMerwariMesakaMeseMeskwakiMesmeMesmesMesqanMessapicMeta'MewariMewatiLingua de signos mexicanaMeyahMfinuMfumteMi'kmaqMiamiMianMianiMiao, agrupamiento chuanqiandianoMiao, qiandong orientalMiao, Xiangxi orientalMiao con cornosMiao, Qiandong do norteMiao florido, flores pequenasMiao, qiandong meridionalMiao, Xiangxi occidentalMichifMichigameaMidobMien, Biao-JiaoMien, IuMigaamaMigabacMigumMikasukiMiliMiltuMilukMilyanMina (Camerún)Mina (India)MinaeanMinangkabauMinanibaiMinavehaMindericoMindiriMingang DosoMingrelianMinidienMinoanMinokokMinriqMintilMiqieMirandésMirganMiritiMiriwungMishipMisingMittuMitukuMiuMiwaMiwok, bahiaMiwok de la sierra centralMiwok de la costaMiwok, LakeMiwok, Sierra norteMiwok, llanurasMiwok, Sierra do surMixe, CoatlánMixe, IsthmusMixe, JuquilaMixe, MazatlánMixe, Norte centralMixe, QuetzaltepecMixe, TlahuitoltepecMixe, TotontepecMixteco, AlacatlatzalaMixteco, AlcozaucaMixteco, AmoltepecMixteco, Apasco-ApoalaMixteco, AtatláhucaMixteco, AyutlaMixteco, CacaloxtepecMixteco, ChayucoMixteco, ChazumbaMixteco, ChigmecatitlánMixteco, CoatzospanMixteco, CuyamecalcoMixteco, Diuxi-TilantongoMixteco, HuitepecMixteco, ItundujiaMixteco, IxtayutlaMixteco, JamiltepecMixteco, JuxtlahuacaMixteco, Magdalena PeñascoMixteco, MetlatónocMixteco, MitlatongoMixteco, MixtepecMixteco, Tlaxiaco norteMixteco, noroeste de OaxacaMixteco, OcotepecMixteco, PeñolesMixteco, Pinotepa NacionalMixteco, San Juan ColoradoMixteco, San Juan TeitaMixteco, San Miguel o GrandeMixteco, San Miguel PiedrasMixteco, Santa Lucía MonteverdeMixteco, Santa María ZacatepecMixteco, SilacayoapanMixteco, SindihuiMixteco, SinicahuaMixteco, sueste de NochixtlánMixtec, sur de PueblaMixteco, Tlaxiaco meridionalMixteco, SoyaltepecMixteco, TacahuaMixteco, TamazolaMixteco, TezoatlánMixteco, TidaáMixteco, TijaltepecMixteco, TlazoyaltepecMixteco, TututepecMixtec, Juxtlahuaca do oesteMixteco, YoloxochitlMixtec, YosondúaMixteco, YucuañeMixtec, YutanduchiMiyaMiyakoMiyobeMlabriMlahsöMlapMlompMmaalaMmenMnong, CentralMnong do lesteMnong do surMo'daMoabiteMobaMobilianMochiMochicaMochoMocovíModangModoleSererMofu do norteMofu-GudurMogholiMogumMohaveMohawkMohegan-PequotMoi (Congo)Moi (Indonesia)MoikodiMoingiMojiMokMokenMokerangMokilésMoklenMokoleMokpweMokselaMokshaMolaleMolbogLingua de signos moldavaMolengueMolimaMoloMolofMolokoMom JangoMomaMomareMombumMominaMomunaMonMon, antigoLingua de signos monásticaMondropolonMondéMongoMongolMongolLingua de signos de MongoliaMongol clásicoMongol, HalhMongolMongol, periféricoMongondowMoniMono (Camerún)Mono (República Democrática do Congo)Mono (Islas Solomon)Mono (EE.UU.)MonomMonpa, KalaktangMonpa, TawangMontagnaisMontolMonumboMonzomboMooMopán MaiaMor (península de Bomberai)Mor (Illas Mor)MoraidMorawaMorerebiMoresadaMori AtasMori BawahMorigiMorisyenMoroLingua de signos marroquíMorokodoMoromMoroneneMororiMorouasMortlockeseMoruMosimoMosiroMoskonaMossiMotaMotlavMotuMouk-AriaMovimaLingua de signos mozambiqueñaMozárabeMpadeMpiMpiemoMpotoMpotovoroMpuonoMpurMruMserMualangMubamiMubiMudaMudugaMufianMugomMuinaneMuji, septentrionalMuji, QilaMuji, meridionalMukha-DoraMukuluMulahaMulamMullukmullukVarios idiomasMuluridyiMumMumuyeMunaMundaMundabliMundangMundaniMundariMundatMundurukúMungakaMungguiMungkipMunicheMunitMunjiMunseeMuongMuratayakMuria do lesteMuria, afastado oesteMuria do oesteMurik (Malaysia)Murik (Papúa Nova Guinea)MurkimMurleMurrinh-PathaMursiMurupiMurut, KeningauMurut, TagalMurut, TimugonMuruwariMusakMusarMusasaMuseyMusguMushunguluMusiMuskumMusomMussau-EmiraMuthuvanMutuMuyaMuyangMuyu, norteMuyu, surMuyuwMuziMvanipMvubaMwaghavulMwanMwaniMwatebuMwera (Chimwera)Mwera (Nyasa)Mwimbi-MuthambiMyeneMysianMághdìMískitoMóchenoMündüN'KoN/uNaNaabaNaasioiNabaNabakNabiNacheringNadruvianNadëbNafaanraNafiNafriNafusiNaga PidginNaga, AngamiNaga, AoNaga, ChangNaga, ChokriNaga, ChotheNaga, InpuiNaga, KharamNaga, KhezhaNaga, KhiamniunganNaga, KhoibuNaga, KonyakNaga, LeinongNaga, LiangmaiNaga, Long PhuriNaga, LothaNaga, MakuriNaga, MakyanNaga, MaoNaga, MaramNaga, MaringNaga, MonsangNaga, MoyonNaga, MziemeNaga, NocteNaga, Norte de RengmaNaga, ParaNaga, PhomNaga, PochuriNaga, PoumeiNaga, PuimeiNaga, RongmeiNaga, SangtamNaga, Rengma meridionalNaga, SumiNaga, TaraoNaga, TaseNaga, ThangalNaga, TutsaNaga, WanchoNaga, YimchungruNaga, ZemeNagarchalNageNago, septentrionalNago, meridionalNagumiNahaliNahariNahuatl, CentralNahuatl, Huasteca centralNahuatl, Central PueblaNahuatl, clásicoNahuatl, CoatepecNahuatl, Huasteca orientalNahuatl, GuerreroNahuatl, PueblaNahuatl, HuaxcalecaNahuatl, Isthmus-CosoleacaqueNahuatl, Isthmus-MecayapanNahuatl, Isthmus-PajapanNahuatl, MichoacánNahuatl, MorelosNahuatl, Norte de OaxacaNahuatl, Norte de PueblaNahuatl, OmetepecNahuatl, OrizabaNahuatl, Santa María La AltaNahuatl, Sierra NegraNahuatl, Sudeste de PueblaNahuatl, TabascoNahuatl, TemascaltepecNahuatl, TetelcingoNáhuatl, TlamacazapaNahuatl, Oeste de  HuastecaNahuatl, Zacatlán-Ahuacatlán-TepetzintlaNaiNaka'elaNakaiNakamaNakanaiNakaraNakeNakiNakwiNalcaNaliNalikNaluNalögoNama (Papúa Nova Guinea)NamakuraNamatNambas, grandeNambikuára do surNamboNambyaNamiaNamiaeLingua de signos namibioNamlaNamoNamonuitoNamosi-Naitasiri-SeruaNamuyiNanaiNancereNandeNandiNankinaNantiNanticokeNanubioNapuNar PhuNaraNarakNarangoNarauNarimNaroNaromNarragansettNarrinyeriNaruaNarunggaNasalNasarianNaskapiNasu, WumengNasu, WusaNatanziNatchezNateniNathemboNatioroNatüguNaueteNaunaNauríNavajoNavutNawaruNawathinehenaNawdmNawuriNaxiNayiNayiniNcaneNchumbuluNda'nda'NdaiNdakaNdaktupNdaliNdamNdambaNdasaNdauNde-GbiteNde-Nsele-NtaNdebele do norteNdebele do SurNdemliNdendeuleNdengerekoNdingNdoNdoboNdoeNdogoNdoloNdomNdombeNdonde HambaNdongaNdoolaNdugaNdumuNdundaNdungaNdutNdyuka-Trio PidginNeapolitanoNedebangNefameseNegerhollandsNegeri Sembilan MalayNegidalNehanNekNekginiNekoNekuNemeNemiNenNendNenetsNengoneNeo arameo, asirioNeo-Aramaic, Barzani JewishNeo arameo, BohtanNeo arameo, caldeoNeoarameo, occidentalLingua de signos nepalésNeteLingua de signos neozelandesaNewariNeyoNez PerceNgaanyatjarraNgad'aNgad'a, orientalNgadjunmayaNgaingNgajuNgalaNgalakanNgalumNgamNgamamboNgambayNgaminiNgamoNganasanNgandiNgando (República centroafricana)Ngando (República Democrática do Congo)NgandyeraNgangamNganyaywanaNgarinmanNgarinyinNgarlaNgarlumaNgasNgasaNgatik Men's criolloNgawunNgbakaNgbaka Ma'boNgbaka ManzaNgbandi do norteNgbandi do surNgbeeNgbindaNgbunduNgelimaNgembaNgeqNgeteNggemNggwahyiNgieNgiemboonNgileNgindoNgitiNgizimNgomNgombaNgombaleNgombe (Repúlcia Centroafricana)Ngombe (República Democrática do Congo)NgongoNgoniNgoshieNgulNguluNguluwanNgumbiNgundiNgunduNgungwelNgurimiNgurmburNguônNgwabaNgweNgwoNgäbereNhandaNhengatuNhuwalaNiasLingua de signos nicaraguenseNicobarese, CarNicobarese, CentralNicobarese do surNiellimLingua de signos nigerianaNihaliNiiNiksekNilaNilambaNimadiNimanburNimbariNimboranNimiNimoNimoaNinamNindiNingeraNinggerumNingilNingyeNinzoNipsanNisaNisenanNisga'aNisi (China)Nisu, orientalNisu, septentrionalNisu do surNisu, suroccidentalNiuafo'ouNiuatoputapuNiuésNivacléNjalgulguleNjebiNjenNjerepNjyemNkamiNkangalaNkariNkem-NkumNkhumbiNkonghoNkonyaNkorooNkoyaNkukoliNkutuNnamSen contido lingüísticoNobiinNobonobNocamánNogaiNoiriNokukuNomaandeNomaneNomatsiguengaNomuNonuyaNooksackNoonNooneNoricNornNorraNoruego AntigoÁrabe do norte, antigoNorueguésNoruego BokmålNoruegués nynorskLingua de signos noruegaNoruego, viajeroNotreNotsiNottowayNottoway-MeherrinNovialNoyNsengaNshiNsongoNtchamNtombaNuaulu do norteNuaulu do surNubacaNubiNubio antigoNubriNuerNugunu (Australia)Nugunu (Camerún)NukNukak MakúNuknaNukuiniNukumanuNukuoroNukuriaNumana-Nunku-Gbantu-NumbuNumanggangNumbamiNumeNumidianNung (Vietnam)NungaliNunggubuyuNunguNuni do norteNuni do surNupbikhaNupe-Nupe-TakoNusa LautNusuNuu-chah-nulthNyabwaNyaheunNyahkurNyakyusa-NgondeNyala, esteNyaliNyamNyamalNyamboNyamusa-MoloNyamwangaNyamweziNyanekaNyang'iNyangaNyanga-liNyangatomNyangboNyanggaNyangumartaNyanjaNyankoleNyaturuNyawNyawaygiNyembaNyengoNyenkhaNyeuNyiginaNyiha (Malawi)Nyiha (Tanzania)Nyika (Malawi e Zambia)Nyika (Tanzania)NyindrouNyinduNyoleNyongNyoreNyoroNyulnyulNyungaNyungweNyâlayuNzakambayNzakaraNzanyiNzimaNá-MeoNêlêmwa-NixumwakO'chi'chi'O'duObanlikuObispeñoObloObokuitaiOboloObulomOcainaOccitano (después de 1500)OdOdiaiOdoodeeOdualOdutOfayéOfoOgbahOgbiaOgbogoloOgbronuagumOgeaOhlone do norteOhlone do surOirat, escritoOirataOjibwaOjibwa, centralOjibwa do lesteOjibwa, noroesteOjibwa, SevernOjibwa do oesteOkanaganOki-No-ErabuOkiekOkinawan, centralOko-Eni-OsayenOko-JuwoiOkoboOkodiaOkolodOkpamheriOkpe (Noroeste Edo)Okpe (suoeste de Edo)OksapminOkuOlekhaOloOlomaOlratOlu'boOlulumo-IkomOmaguaOmaha-PoncaOmbambaOmboOmiOmokOmotikOmuranoOnaOne, InebuOne, KaboreOne, KwamtimOne, MolmoOne do norteOne do surOneidaOngOninPidgin baseado no oninOnjobOnoOnobasuluOnondagaOntenuOntong JavaOorlamsOpaoOpataOpuuoOrang KanaqOrang SeletarOrejónOringOriya, AdivasiOrmaOrmuOrmuriOroOro WinOrochOrohaOrokOrokaivaOrokoOrokoloOromo (Afan)Oromo, Borana-Arsi-GujiOromo do lesteOromo, oeste centralOroqenOroweOrumaOryaOsageOsatuOscanOsingOsosoOsetioOsético antigoOt DanumOtankOtiOtomi, Terras altas orientaisOtomi, Estado de MéxicoOtomi, IxtencoOtomi, MezquitalOtomi, QuerétaroOtomi, TemoayaOtomi, TenangoOtomi, TexcatepecOtomi, TilapaOtoroOttawaOtuhoOtukeOumaOuneOwaOweniaOwinigaOyOya'oyaOydaPa DiPa'aPa-HngPaamaPaasaalPacahuaraPacohPadoePaekchePaelignianoPagiPagibetePaguPahari, KulluPahari, MahasuPahari-PotwariPahiPahlavaniPahlaviPai TavyteraPaicîPaipaiPaiute do nortePaiwanPak-TongPakanhaPakaásnovosLingua de signos de PakistánPakuPalíPalaicoPalauanPalaung, RuchingPalaung, RumaiPalaung, ShwePalawano, Brooke's PointPalawano, centralPalawano, sudoestePalenqueroPaliPalikúrPaliyanPalorPalpaPalu'ePaluanPamPambiaPame, CentralPame do nortePame do surPamlicoPamonaPamosuPampangaPana (Burkina Faso)Pana (República centroafricana)Lingua de signos panameñaPanamintPanaráPanasuanPanawaPancanaPanchparganiaPandePangasinanPangsengPangwaPangwaliPanimPaniyaPunjabíPanjabi, OccidentalPankararéPankararúPankhuPanneiPano, KulinaPanoboPanytyimaPapapanaPaparPapasenaPapelPapiPapiamentoPapitalaiPaporaPapumaParachiLingua de signos paraguaioParakanãParananParanawátParaujanoParaukParawenPardhanPardhiPareParecísParengaParkwaParsiParsi-DariParthianParyaPashto, centralPashto do nortePashto do surPasiPatamonaPataniPataxó Hã-Ha-HãePatepPathiyaPatpatarPattaniPaulohiPaumaríPausernaPawaiaPawneePaynamarPePearPechPechenegPeerePeiPekalPelaPele-AtaPelendePemonPenan, do lestePenan, occidentalLingua de signos de PenangPenchalPendauPengoPenrhynPentlatchPeraiPeroPersaLingua de signos persaPersa, iraníPersa, maniqueo da idade mediaPersa antigo (ca. 600-400 a.C.)Lingua de signos peruvianoPetatsPetjoPfaelzischPhaiPhakePhalaPhaluraPhana'PhangduwaliPhendeLingua de signos filipinoPhimbiFenicioPholaPhola, AloPholoPhong-KniangPhowa, AniPhowa, HlephoPhowa, LaboPhrygianPhu ThaiPhuanPhudagiPhuiePhukhaPhumaPhunoiPhuongPhupaPhuphaPhuzaPiamatsinaPiamePiapocoPiaroaPicardPicene, nortePicene do surPictishPigdin anglochinoPidgin, CamerúnPidgin, NixerianoPidgin, TimorPiamontésPijaoPijePijinPilagáPileniPima BaixoPimbwePinai-HagahaiPingelapesePiniPiniguraPinjiPintiiniPintupi-LuritjaPinyinPipilPirahãPiratapuyoPirlatapaPiroPisaboPiscatawayPisidianPitcairn-NorfolkPitiPitjantjatjaraPitta PittaPiuPiya-KwonciLingua de signos dos Indios das llanurasPlautdietschPlayeroPnarPochutecoPodenaPogoloPohnpeianPokangáPokePokomoPolabianPolariPolciPolacoLingua de signos polacoPolonombaukPomPomoPomo, centralPomo do lestePomo, norestePomo do nortePomo, sudestePomo do surPonamPonguPonosakanPonticPopoloca, CoyotepecPopoloca, MezontlaPopoloca, San Felipe OtlaltepecPopoloca, San Juan AtzingoPopoloca, San Luís TemalacayucaPopoloca, Santa Inés AhuatempanPopoluca, terras altasPopoluca, OlutaPopoluca, SayulaPopoluca, TexistepecPopti'PoqomamPoqomchi'PorohanonPuerto SandwichPort VatoPortuguésLingua de signos portuguésPotawatomiPotiguáraPouyePowariPowhatanPoyanáwaPrasuniPrincipenseLingua de signos de ProvidenciaPrussianPrākrit, ArdhamāgadhīPrākrit, MāhārāṣṭriPrākrit, SauraseniPsikyePu KoPuarePuelcheLingua de signos de Puerto RicoPuinavePukapukaPulaarPulabuPularPuluwatesePumaPumi do nortePumi do surPumpokolPuméPunan AputPunan Bah-BiauPunan Batu 1Punan MerahPunan MerapPunan TubuPunicPunuPuocPuquinaPuragiPurariPurepechaPurepecha, terras altas occidentalesPuriPurikPurisimeñoPuruboráPurumPashtúnPutaiPutohPutukwamPuyoPuyo-PaekchePuyumaPwaameiPyapunPyenPyu (Myanmar)PáezPááfangPäriPémonoPévéPökootQ'anjob'alQabiaoQaqetQashqa'iQatabanianQawasqarQiang do norteQiang do surQimantQuapawLingua de signos de QuebecQuechanQuechúaQuechua, Ambo-PascoQuechua, Arequipa-La UniónQuechua, AyacuchoQuechua, CajamarcaQuechua, Cajatambo Lima NorteQuechua, ChachapoyasQuechua, ChinchaQuechua, Chiquián AncashQuechua, clásicoQuechua, Corongo AncashQuechua, CuscoQuechua, Apurímac do lesteQuechua, Huallaga HuánucoQuechua, Huamalíes-Dos de Mayo HuánucoQuechua, Huaylas AncashQuechua, Huaylla WancaQuechua, Jauja WancaQuechua, LambayequeQuechua, Margos-Yarowilca-LauricochaQuechua, tierras bajas de NapoQuechua, Bolivia do NorteQuechua, Norte de JunínQuechua, Conchicos Anchash do NorteQuechua, PacaraosQuechua, Panao HuánucoQuechua, PunoQuechua, San MartínQuechua, Santa Ana de Tusi PascoQuechua, Sihuas AncashQuechua, Sur de BoliviaQuechua, Conchucos Ancash do SurQuechua, Pastaza do SurQuechua, Yanahuanca PascoQuechua, YauyosQuenyaQueyuQuechua, Alto CalderónQuichua, Cañar Terra AltaQuechua, Alto ChimborazoQuichua, Alto de ImbaburaQuichua, Alto de LojaQuechua, Norte de PastazaQuichua, Salasaca HighlandQuichua, Santiago do EsteroQuichua, Tena terra baixaQuileuteQuinaultQuinquiQuiripiRabhaZandeRaeticRahambuuRajasthaniRajbanshiRajiRajongRakahanga-ManihikiRakhineRalteRamaRamoaainaRamopaRampiRangRangkasRanglongRangpuriRaoRapaRapanuiRapoisiRaptingRara Bakati'RasawaRatagnonRatahanRathawiRauteRavulaRawaRawangRawatRawoRazajerdiReelRejangReliRemaRembarungaRembongRemoRempiRemunRendilleRengaoRennell-BellonaLingua de signos rennellésRepanbitipRer BareRerauRerepResheResígaroRettaReyesanoRiang (India)Riang (Myanmar)RiantanaRibunRienRikbaktsaRinggouRirioRitarungoRiungRoglai, CacgiaRoglai do norteRoglai do surRogoRohingyaRomaRomagnolRomamRumano, balcanRumano, bálticoRamaní, cárpatoRumano, Kalo finésRumano, SinteRumano, TavringerRumano, VlaxRumano, galésRomanésLingua de signos rumanaRomanés, IstroMacedonio RomanésRumano, MeglenoRomanés-GriegoRumano-SerbioRomanésvaRomanésRomaníRomblomanonRomboRomkunRonRongaRonggaRongpoRonjiRoonRoriaRotokasRotumanRovianaRudbariRufijiRugaRukaiRumaRumuKiroundiRungaRungusRungwaRusoLingua de signos rusaRuso antigoRusynRutulRuuliRuundRwaSaSasakSa'banSaochSaafi-SaafiSaamSaamiaSaaroaSabaSabaeanSabanêSabaotSabineSabuSabümSacapultecoSadriSadri, OraonSaekSaepSafalibaSafeyokaSafwaSagalaSagallaSahoSahuSaisiyatSajalongSajau BasapSakachepSakaoSakataSakeSakirabiáSalaSalampasuSalarSalasSalchuqSalemanSalibaSalinanSalish, Puget Sound meridionalSalish, StraitsSallandsSalt-YuiSalumáLingua de signos salvadoreñaSamSamaSama, CentralSama, PangutaranSama do surSamaritánSamarokenaSamataoSambaSamba LekoSambal, BotolanSambeSamberigiSamburuSameiSami, AkkalaSami, InariSami, KemiSami, KildinSami do norteSami, PiteSami, SkoltSami do surSami, TerSami, UmeSamoSamo, MatyaSamo, MayaSamo do norteSamoanoSamogitiánSamosaSampangSamreSamtaoSamvediSanapanáSandaweSanga (República Democrática do Congo)Sanga (Nixeria)SanggauSangilSangirSangisariSangkongSanglechiSangoSango, RivereñoSangu (Gabón)Sangu (Tanzania)SaniSanieSaniyo-HiyeweSansiSánscritoSantaliSanumáSaparuaSapoSaponiSaposaSapuanSapéSarSaraSara KabaSara Kaba DemeSara Kaba NáàSaramaccanSarasiraSaravecaSardoSardo campidanésSardo, gallurésSardo, LogurdorésSardo, sassarésSarikoliSarliSarsiSartangSaruaSaruduSarugaSasakSasaruSatawaleseSaterfriesischSateré-MawéLingua de signos de Arabia SaudíSaurashtraSauriSauria PahariaSauseSausiSaviSavosavoSawaiSaweruSawiSawilaSawknahSajón antigoSaxón superiorSasakEscocésEscocés, viaxeiroScythianSebaSebat Bet GurageSeberuangSebopSebuyauSecheltSecoyaSedangSedoaSeekuSegaiSegejuSegetSehwiSeimatSeit-KaitetuSekaniSekapanSekarSeke (Nepal)Seke (Vanuatu)SekiSeko PadangSeko TengahSekpeleLingua de signos de SelangorSelaruSelayarSeleeSelepetSelianSelkupSelungai MurutSeluwasanSemaiSemandangSemaq BeriSembakung MurutSemelaiSemimiSemnamSemnaniSempanSenaSena, MalawiSenayaSeneSenecaSenedSengeleSenggiSengoSengsengSenhaja De SrairSenoufo, CebaaraSenoufo, DjiminiSenoufo, MamaraSenoufo, NyarafoloSenoufo, PalakaSenoufo, ShempireSenoufo, SupyireSenoufo, SyenaraSenoufo, TagwanaSensiSentaniSentinelSepa (Indonesia)Sepa (Papúa Nova Guinea)SeraSerbioSerbo-croataSereSererSeriSeriliSeroaSerranoSeruSeruaSerudung MurutSerui-LautSetaSetamanSetiSettlaSewa BaySezeShaShabakShahmirzadiShahrudiShall-ZwallShama-SambugaShamangShambalaShanShanenawaShangaSharanahuaBahia tiburónSharwaShastaShattShauShawneeSheShehriShekhawatiShekkachoShekoSheltaShenduSheniSherbroSherdukpenSherpaShiShikiShillukShinaShina, KohistaniShinaboShipibo-ConiboShixingSholagaShom PengShonaShoo-Minda-NyeShorShoshoniShuaShuaditShuarShubiShughniShumashtiShumchoShuswapShuwa-ZamaniShwaiSialumSiamouSianSianeSiangSiar-LakSiawiSibeSicanianSicelSicilianoSidamoSideticSieLingua de signos de Sierra LeonaSighuSihanSikaSikaianaSikaritaiSikianaSikkimeseSiksikaSikuleSilaSileibiSilesianSilesio, baixoSilimoSiliputSilopiSilt'eSimaaSimbaSimbaliSimbariSimboSimekuSimeulueSimteSinagenSinasinaSinaugoroSindarinSindhiSingaLingua de signos de SingapurSingphoCingalésSininkereSinsauruSinyarSioSionaSipacapenseSiraSirayaSiriSirianoSirionóSirmauriSiroiSisaala, TumulungSisaala do lesteSissalaSissanoSiuslawSivandiSiwaiSiwiSiwuSkagitSkalvianSkouEslavo (Athapascan)Slavey do norteSlavey, surEslovacoLingua de signos eslovacoEslovenoSnohomishSo (República Demoncrática do Congo)ShonaSobeiSogaSogdianSoiSokSokoroSolanoSoliSolongSolosSomSomalíSomba-SiawariSomraiSomraySomyevSondeSongeSonghai, Koyraboro SenniSonghay, Humburi SenniSonghay, Koyra ChiiniSongoSongomenoSongooraSongway Kiini, TondiSonhaSoniaSoninkeSonsorolSooSopSoqotriSoraAlemán Baixa Idade MediaSorbiano, superiorSori-HarenganSorkheiSorothapticSorsoganon do norteSorsoganon do surSos KundiSotho do SurSouLingua de signos sudafricanoBahia sur esteSowaSowandaEspañolLingua de signos españolEspañol, Loreto-UcayaliEspañol, antigoSpokaneSquamishSranan TongoLingua de signos de Sri LankaStellingwerfsStieng, BudehStieng, BuloStoneySuaboSuarminSuauSubaSuba-SimbitiSubanen, centralSubanen do norteSubanen, meridionalSubanon, KolibuganSubanon, oesteSubiyaSubtiabaSudestSudovianSuenaSugaSugangaSuiSukiSukuSukumaSukurSukurumSulaSulkaSulodSumaSumariupSumauSumbawaSumbwaSumerioSunamSundanésSunwarSuoySurSurbakhalSuriSurigaononSurjapuriSursurungaSuruaháSurubuSuruíSuruí Do ParáSusquehannockSusuSusuamiSuundiSuwawaSuyáSvanSwabianSwahili (idioma individual)Swahili (macrolingua)Swahili, CongoSiswatiSuecoLingua de signos suecaLingua de signos suizo-francésLingua de signos suizo-germanaLingua de signos suizo-italianoSylhetiSyriacSirio, clásicoSálibaSantotomenseSénoufo, NanerigéSénoufo, SenaraSénoufo, SìcìtéSôT'enTa'oih, inferiorTa'oih, superiorTaabwaTabaruTabassaranTablaTaboTabriakTacanaTachawitTachelhitTachoniTadaksahakTadyawanTae'TafiTagabawaTagakauloTagaloTagargrentTagbanwaTagbanwa, CalamianTagbanwa, CentralTagbuTagdalTagishTagoiTahitianoTahltanTaiTai DaengTai DamTai DoTai DónTai HongjinTai LoiTai LongTai NüaTai PaoTai ThanhTai YaTaiapTaikatTainaeTainoTairora, norteTairora, surTairumaTaitaLingua de signos taiwanésTajeTajikoTajioTajuasohnTakelmaTakestaniTakiaTakuaTakuuTakwaneTalTalaTalaudTaliabuTaliengTalinga-BwisiTaliseTalodiTalokiTalondo'TaluTalyshTama (Chad)Tama (Colombia)TamagarioTamahaq, TahaggartTamajaq, TawallammatTamajeq, TayartTaman (Indonesia)Taman (Myanmar)TamanakuTamang, orientalTamang, Gorkham orientalTamang, noroesteTamang, occidentalTamashekTamashekTamazight, Atlas centralTamazight, TemacineTamazight, TidikeltTambasTamboraTambotaloTamiTamilTamil antigoTamkiTampuanTampulmaTanacrossTanahmerahTanainaTanana, inferiorTanana, superiorTanapagTandaganonTandiaTanemaTangaleTangchangyaTangguTangkoTanglangTangoaTanguatTangutTanimbiliTanimuca-RetuarãTanjijiliTanna, norteTanna, suroesteLingua de signos tanzanaTapebaTapeiTapietéTapirapéTarahumara, CentralTarahumara, terra baixaTarahumara do norteTarahumara do sudesteTarahumara do suroesteTarangan, esteTarangan, oesteTarengTarianaTarifitTarokTarokoTaromi, superiorTarpiaTartesoTasawaqTasmanoTasmateTat, musulmánTatanaTártaroTatuyoTauadeTaulilTaungyoTaupotaTauseTaushiroTausugTauyaTavetaTavoyanTawalaTawandêTawaraTawbuid, OrientalTawbuid, occidentalTawortaTawoyanTay BoiTay KhangTayoTaznatitTboliTchitchegeTchumbuliTe'unTeanuLingua de signos de TebulTedagaTeeTefaroTegaliTehitTehuelcheTeke, IbaliTeke-EboTeke-FuumuTeke-KukuyaTeke-LaaliTeke-NzikouTeke-TegeTeke-TsaayiTeke-TyeeTektitekoTela-MasbuarTelefolTelougouTemTembo (Kitembo)Tembo (Motembo)TembéTemeTemeinTemiTemiarTemoqTemuanTenggerTenharimTeninoTenisTennetTeopTeorTepecanoTepehua, HuehuetlaTepehua, PisafloresTepehua, TlachichilcoTepehuan do norteTepehuan do suresteTepehuan do suroesteTeraTerebuTereiTerenoTeressaTerewengTeribeTerikTermanuTernateTernateñoTeseTeshenawaTesoTetelaTeteteTetumTetun DiliTewa (Indonesia)Tewa (EE.UU.)TeweThaThachanadanThaiLingua de signos thaiThai SongThai do noresteThai do norteThai do surThakaliThangmiThaoTharakaTharu, ChitwaniaTharu, DangauraTharu, KathoriyaTharu, KochilaTharu, RanaThayoreThaypanThoThompsonThophoThracianThu LaoThudamThulungThurawalThuriTialeTiangTibeaTibetanoTibetano, AmdoTibetano, clásicoTibetano, KhamsTibetano, antigoTichurongTicunaTidoreTieneTifalTigakTigreTigrinyaTiiTikarTikopiaTillamookTilungTimaTimbeTimneTimucuaTinaniTindiTingui-BotoTiniguaTinputzTipperaTiraTirahiTiriTirurayTitaTitánTivTiwaTiwa do norteTiwa do surTiwiTiéfoTjurruruTlingitToTo'abaitaToaripiTobaToba-MaskoyTobangaTobatiTobeloTobianTobilungToboTochoTodaTodrahTofanmaTogoyoTohono O'odhamTojolabalTok PisinTokanoTokelauTokharian ATokharian BToku-No-ShimaTolTolakiTolomakoTolowaTomaTomadinoTombelalaTombonuoTombuluTominiTomoipTondanoTonga (Nyasa)Tonga (Islas Tonga)Tonga (Zambia)TongweTonjonTonkawaTonsawangTonseaTontemboanTooroTopoiyoToposaToraja-SadanToramTokelauToroToromonoToronaTorricelliTorwaliToráTotelaTotoTotoliTotonac, CoyutlaTotonac, Filomena Mata-CoahuitlánTotonac, tierra altaTotonac, PapantlaTotonac, TecpatlánTotonac, Necaxa superiorTotonac, occidentalTotonac, Xicotepec De JuárezTotonac, YecuatlaTotoroTouoToura (Costa de marfil)Toura (Papúa Nova Guinea)Toussian do norteToussian do surToweiTregamiTremembéTriengTrimurisTringLingua de signos de Trinidad e TobagoTrinitarioTripuri tempranoTriqui, ChicahuaxtlaTriqui, CopalaTriqui, San Martín ItunyosoTrióTrukáTrumaiTs'ün-LaoTsaangiTsakhurTsakonianTsakwamboTsamaiTsatTsekuTsetsautTshanglaTsikimbaTsimanéTsimshianTsishinginiTsoTsoaTsogoTsongaTsotsoTsouTsumTsuvadiTsuvanTswaSetchwanaTswapongTuTuamotuanTubarTucanoTugenTugunTugutilTujia do norteTujia do surTukang Besi do NorteTukang Besi do SurTukiTukpaTukudedeTukumanfédTulaTulehuTulishiTuluTulu-BohuaiTuma-IrumuTumakTumbukaTumiTumleoTumshuqeseTumtumTumzabtTunebo, AngosturasTunebo, Barro NegroTunebo, CentralTunebo, occidentalTunenTungagTunggareTuniaTunicaLingua de signos tunecinoTunjungTunniTunzuTuotombTuparíTupinambáTupinikinTupuriTupíTurakaTuriTuriwáraTurkaTurkanaTurcoLingua de signos turcoTurko, Balkan GagauzTurco antigoTurco otomano (1500-1928)TurkmenoTuroyoTurumsaTurungTuscaroraTutchone do norteTutchone do surTuteloTutongTutubaTututniTuvaluTuvinianTuwariTuwuliTuxináwaTuxáTuyucaTwanaTwendiTwentsTchiTyapTyaraityTz'utujilTzeltalTzotzilTàyTày Sa PaTày TacTéénTübatulabalUUab MetoUamuéUareUbagharaUbangUbiUbirUbykhUdaUdiUdiheUdmurtUdukUfimLingua de signos ugandánUgaríticoUgheleUgongUhamiUiguroUighur antigoUisaiUjirUkaanUkhwejoUkitUkpe-BayobiriUkpet-EhomUcraínoLingua de signos ucranianaUkueUkurigumaUkwaUkwuani-Aboh-NdoniUlau-SuainUlchUlithianoUllatanUlukwumiUlumanda'UlwaUmaUma' LasanUma' LungUmanakainaUmatillaUmbindhamuUmbrianUmbu-UnguUmbugarlaUmbunduUmbuygamuUmedaUmonUmotínaUmpilaUmpqua, superiorUnaUnamiIdiomas no codificadosSen determinarUneapaUnemeAlemán criollo de Rabaul; unserdeutschUnuaUra (Papúa Nova Guinea)Ura (Vanuatu)UradhiUrak Lawoi'UraliUrapminUrarinaUrartianUratUrduUrhoboUriUriginaUrimUrimoUripiv-Wala-Rano-AtchinUrninganggUruUru-Eu-Wau-WauUru-Pa-InUruangnirinUruavaUrubú-KaaporLingua de signos de Urubú-KaaporLingua de signos uruguayoUrumUrumiUsaghadeUsanUsarufaUshojoUskuUspantecoUsuiUtarmbungUte do sur PaiuteUtuUvbieUvean, oesteUyaUyajitayaUzbekoUzbeko do norteUzbeko do surUzekweVaagri BooliVafsiVaghat-Ya-Bijim-LegeriVaghriVaghuaVaglaVaiVaipheiValeLingua de signos valencianaValmanValpeiVamaleVameVandalicVangunuVanimoVanoVanumaVaoVarhadi-NagpuriVarisiVarliVasaviVeddahVehesVeluwsVemgo-MabasVendaVenecianoVeneticLingua de signos venezolanaVengoVentureñoVepsVera'aVestinianVidundaViemoVietnamitaVilelaViliVinmavisVinzaVishavanVitiVitouVlaamsVlaamse GebarentaalVolapükVolscianVonoVoroVoticVumbuVunapuVunjoVurësVuteVwanjiVõroWaWa'emaWaamaWaamwangWaataWabWaboWabodaWadaginamWaddarWadjiginyWadjiguWae RanaWaffaWagawagaWagayaWagdiWagemanWagiWahgiWahgi, NorteWaigaliWaigeoWailakiWailapaWaimaWaima'aWaimahaWaimiri-AtroariWaioliWaiwaiWajaWajarriWakaWakawakaWakdeWakhiWakonáWalaWalakWali (Gana)Wali (Sudán)WalingWalioWalla WallaWallisianValónWalmajarriWalserWalunggeWamasWambayaWambonWambuleWameyWaminWampanoagWamparWampurWanWanambreWanapWandaWandalaWandamenWandarangWandjiWaneciWangaWangaaybuwan-NgiyambaaWanggamalaWangganguruWanggomWanmanWannuWanoWantoatWanukakaWanéWaoraniWapanWapishanaWappoWar-JaintiaWaraWaraoWarapuWaray (Australia)Waray (Filipinas)WardamanWardujiWaremboriWaresWarisWaritaiWariyanggaWarjiWarkay-BipimWarlmanpaWarlpiriWarluwaraWarnangWaropenWarrgamayWarrwaWaruWarumunguWarunaWarunguWasaWasco-WishramWasemboWashoWaskiaWasuWatakatauiWatamWatiwaWatubelaWatut, medioWatut, norteWatut, surWaubeWauráWauyaiWawaWawoniiWaxianghuaWayampiWayanaWayoróWayuWayuuWedauWehWejewaWelikiGalésGalés, medioGalés antigoWeriWersingWestphalienWetamutWewawWeytoArenasbrancasWiarumusWichitaWichí Lhamtés GüisnayWichí Lhamtés NoctenWichí Lhamtés VejozWik-EpaWik-IiyanhWik-KeyanganWik-Me'anhaWik-MungkanWik-NgathanaWikalkanWikngencheraWilawilaWintuWinyéWipiWiradhuriWirafédWiranguWiruWiyotWocconWogamusinWogeoWoiWojenakaWolaneWolaniWolayttaWoleaianWolioWolofWolof, GambianoWom (Nixeria)Wom (Papúa Nova Guinea)WomoWongoWoriaWorimiWorodougouWotapuri-KatarqalaiWotuWoun MeuWuduWuliwuliWulnaWumbokoWumbvuWunambalWurruguWushiWusiWutungWutunhuaWuvulu-AuaWuzlamWyandotWymysorysWáraWãphaWè do norteWè do surWè occidentalXaasongaxangoXakriabáXamtangaXavánteXerénteXetáXhosaXibeXincaXipayaXiriXiriânaXoklengXukurúXaracuYaakuYabaranaYabaânaYabemYabenYabongYaceYaeyamaYafiYagariaYagnobiYagomiYaguaYagwoiaYahadianYahangYahunaYaka (República centro africana)Yaka (Congo)Yaka (República Democrática do Congo)YakaikekeYakamaYakanYakhaYakomaYakutYalaYalahatanYalakaloreYalarnngaYaleYale, KosarekYalebaYali, AnggurukYali, NiniaYali, dialecto do val de PassYalunkaYamapYambaYambesYambetaYamdenaYameoYamiYaminahuaYamnaYamongeriYamphuYan-nhanguGandaYandruwandhaYaneshaYangbenYangkamYangmanYangoYangulamYangum DeyYangum GelYangum MonYankunytjatjaraYanomamöYanomámiYansiYanyuwaYaoYaouréYapeseYapundaYaqayYaquiYarawataYarebaYarsunYasaYassicYau (Provincia Morobe)Yau (Provincia de Sandaun)YaulYaumaYaurYaviteroYawaYawalapitíYawanawaYawarawargaYaweyuhaYawiyoYawuruYazgulyamYeiYekheeYekoraYelaYeleYelmekYeloguYembaYemsaYendangYeniYenicheYerakaiYeretuarYerongYerukulaYessan-MayoYetfaYevanicYeyiYi, AxiYi, NaluoYi, SichuanYi, Wuding-LuquanYiddishYiddish do lesteYidish do oesteYidghaYidinyYilYimasYinchiaYindjibarndiYindjilandjiYineYinggardaYir YorontYisYobaYogadYoidikYokeYokutsYolaYomYombeYonaguniYongYongkomYopnoYoraYoronYorubaYout WamYoyLingua de signos Yucatec MaiaYuchiYucunaYugYugambalLingua de signos yugoslavoYugur do lesteYugur do oesteYuhupYukaghir do norteYukaghir do surYukiYukpaYukubenYuluYupik, CentralYupik, Siberia centralYupik, NaukanYupik, golfo do pacíficoYupik, SirenikYuquiYuracareYurokYurutíYuwanaYámanaZabanaZaghawaZaiwaZakhringLeguaje de signos de ZambiaZan GulaZanakiZande (idioma individual)ZangskariZangwalZapotecoZapoteco, AloápamZapoteco, AmatlánZapoteco, antigoZapoteco, Asunción MixtepecZapoteco, AyoquescoZapoteca, CajonosZapoteco, ChichicapánZapoteco, ChoapanZapoteco, Coatecas AltasZapoteco, CoatlánZapoteco, El AltoZapoteca, ElotepecZapoteco, Guevea De HumboldtZapoteca, GüiláZapoteca, IsthmusZapoteco, LachiguiriZapoteco, LachixíoZapoteca, Lapaguía-GuiviniZapoteca, LoxichaZapoteco, MazaltepecZapoteco, MiahuatlánZapoteco, MitlaZapoteco, MixtepecZapoteco, OcotlánZapoteco, OzolotepecZapoteco, PetapaZapoteco, QuiavicuzasZapoteca, Quioquitani-QuieríZapoteco, RincónZapoteca, San Agustín MixtepecZapoteco, San Baltazar LoxichaZapoteco, San Pedro QuiatoniZapoteco, San Vicente CoatlánZapoteca, Santa Catalina AlbarradasZapoteco, Santa Inés YatzechiZapoteco, Santa María QuiegolaniZapoteco, Santiago XanicaZapoteco, Santo Domingo AlbarradasZapoteco, Sierra de JuárezZapoteco, Ixtlán sudesteZapoteca do surZapoteca, TabaaZapoteca, TexalapanZapoteco, TexmelucánZapoteca, TilquiapanZapoteco, TlacolulitaZapoteco, TotomachapanZapoteco, XadaniZapoteca, XanaguíaZapoteco, YalálagZapoteca, YareniZapoteca, YateeZapoteco, YatzachiZapoteco, YautepecZapoteca, ZaachilaZapoteco, ZanizaZapoteco, ZoogochoZaramoZariZarmaZarpáticoZauzouZayZayse-ZergullaZazaZazaoZeemZeeuwsZembaZemgalianZenagZenagaZerenkelZhabaZhang-ZhungZhireZhoaZhuangZhuang, Hongshuihe centralZhuang, DaiZhuang, Hongshuihe orientalZhuang, GuibeiZhuang, GuibianZhuang, LianshanZhuang, LiujiangZhuang, LiuqianZhuang, MinzZhuang, NongZhuang, QiubeiZhuang, YangZhuang, YongbeiZhuang, YongnanZhuang, YoujiangZhuang, ZuojiangZiaZialoZigulaZimakaniZimbaLingua de signos de ZImbaweZinzaZireZiriyaZizilivakanZo'éZokhuoZoque, ChimalapaZoque, CopainaláZoque, Francisco LeónZoque, RayónZoque, TabascoZouZulgo-GemzekZulúZumaiaZumbunZuniZáparout-Ma'inAhánÁncáÖmieÖngePK�m�\^m�4ƆƆLC_MESSAGES/gstreamer-1.0.monu�[�����Q�
�,01'F(n���#��($.:S�*�/�(��%q�'#A'e ���#�	 " ,> (k � � %� %� 0!$M!$r!#�!�!"�!�! ":"=L"=�"�"�"%#0+#7\#7�#$�#'�#$*5$.`$&�$)�$,�$E
%)S%}%�%!�%%�%!�%&
(&(3&'\&'�&
�&(�&'�&%'.'E'6Q'�'�'I�'3�'/.(-^(9�(�(%�(|)!�)�)�)(�)'*'/*�W*7�*9$+	^+h+m+'~+/�+(�+&�+'&,&N,)u,�,�,�,E�,71-!i-�-�-�-�-4�-�--.4?.Jt.�.�.#�.# /D/4c/�/W�/"0304C0$x0�0�0�0�0/�0.1�A12)2H2Bh2�2T�2353U3�i3*�3474 W4x4*�4�4�49�46,55c50�52�5Y�58W6"�6?�6<�6Q07'�7�7�7 �7�78k+81�8]�8'9-9:9P9/k9�9�9�9�9�9�9
�9�9::$:1:26:&i:.�:A�:;!;);$E;!j;/�;�;�;(�;<
<<$<8<&I<p<	}<�<
�<�<�<3�<5=7N=D�=�=?�=0>A>J>V>v>�>
�>�>�>�>�>
�>�>"?(?8?"G?Aj?�?�?
�?#�?	@B'@/j@�@�@w�@�3A�A�ABB3BQBgB~B�B�B�B��B�C�CT�CDD D�=D��D�E
�EC�E
 F,.F[FcFsFF�F�F�F�F�F�FJ�F+6GbG rG�G�G�G�G#�GH*H<H	NHXH'mH<�H$�H:�H
2I$@IeI.nI�I�I�I�I�I
JJ%J-<J	jJ
tJ%�J�J�J�J�J�J�J �JK#K1+K]KrK~K��K.M4GM6|M&�M�M�M#�M*N$EN#jN:�N�NB�N7&O6^O��Oz<P"�P2�P7
Q2EQ&xQ'�Q,�Q#�Q0RDIR;�R3�R%�R2$S,WSB�S5�S7�S05T%fT'�T%�T+�TUCULaU'�U(�U-�US-V1�V>�V$�V&W>W3XW7�W)�W'�W4XYKX@�X�X/�X0-Y8^Y2�Y!�Y�Y6Z;8Z5tZ�Z/�Z1�Z?[Y[y[5�[�[�[b�[;W\-�\+�\@�\&.],U]��],.^%[^"�^4�^3�^3
_�A_O�_;?`{`�`�`4�`4�`0a5Fa.|a3�a-�a%
b-3b*abI�b=�b)c>cDcJc"gc5�c�c1�cd?-d*md/�d6�d6�d*6eFae)�e[�e&.fUfAhf5�f�f�f�f"g35g7ig��g�h<�h+�hDi _ic�i�i,�i,j�Dj<�j# k$Dk)ik(�k=�k �kl56l5ll!�lA�l m['m6�m$�m?�mDn[dn-�n�no"o?oZozqo8�oV%p|p�p)�p�p?�p!q:qYqmq�q�q�q
�q�q�q�q�q?r2Er:xr>�r�r*�r#$s3Hs-|s8�s
�s�s8t
EtPtitrt�t0�t�t	�t&�tu(u/GuLwu7�u7�u=4vrvCwv6�v�v�v
w*wDwZwlw(}w	�w)�w�w�w+�w!x9x)MxBwx�x�x�x/y"1yRTy/�y�y$�yvz�{z){={X{r{#�{�{�{+�{+|H|$a|��|;}	G}]Q}�}�} �}��}��~��H��7
�E�M�_�
n�|���������ԀS�,G�t�1��1��.�"�7�)V�
����
������)ςI��%C�Ei���0Ã�=��;�[� w�����҄��+�1�B�@b�������ޅ��!�;�R�7[������� �/Vk|?�A�����l�K�6q�Z���$��`�I!
(��MD���<'��7.�,���BJY=D��2&+?'�E�OL�{�o��(pt�cC�9���8^mh��"f�b4�>E�x!��/T���e�RH�,��
G�w5XJ��r���1�3�����$��;_sF���
��@-��IH��68:��a�-��*y1��[�P�P%��}�O�0>]4<*%N����vF�zG���B���@)�2���M��\#Q"5�u3:9i�Q	nj�A�7C
�g��+#�K	W=;��L�����NS~&)U����. �d�0"%s" is a directory.%d blacklist entry%d blacklist entries%d blacklisted file%d blacklisted files%d feature%d features%d plugin%d plugins, A lot of buffers are being dropped.Additional debug info:
%s
An error happened while waiting for EOS
Application used to create the mediaArbitrary application data to be serialized into the mediaBlacklisted files:Buffering, setting pipeline to PAUSED ...
Check if the specified element or plugin existsColon-separated paths containing pluginsComma-separated list of category_name:level pairs to set specific levels for the individual categories. Example: GST_AUTOPLUG:5,GST_ELEMENT_*:3Comma-separated list of plugins to preload in addition to the list stored in environment variable GST_PLUGIN_PATHCould not close resource.Could not close supporting library.Could not configure supporting library.Could not create temp file "%s".Could not decode stream.Could not demultiplex stream.Could not determine type of stream.Could not encode stream.Could not get info on "%s".Could not get/set settings from/on resource.Could not initialize supporting library.Could not load plugin file: %s
Could not multiplex stream.Could not open file "%s" for reading.Could not open file "%s" for writing.Could not open resource for reading and writing.Could not open resource for reading.Could not open resource for writing.Could not perform seek on resource.Could not read from resource.Could not synchronize on resource.Could not write to resource.Disable colored debugging outputDisable debuggingDisable spawning a helper process while scanning the registryDisable trapping of segmentation faults during plugin loadingDisable updating the registryDo not install a fault handlerDo not print any progress informationDone buffering, setting pipeline to PLAYING ...
EOS on shutdown enabled -- Forcing EOS on the pipeline
EOS on shutdown enabled -- waiting for EOS after Error
EOS received - stopping pipeline...
ERROR: Pipeline doesn't want to pause.
ERROR: from element %s: %s
ERROR: pipeline could not be constructed.
ERROR: pipeline could not be constructed: %s.
ERROR: pipeline doesn't want to play.
ERROR: pipeline doesn't want to preroll.
ERROR: the 'pipeline' element wasn't found.
Element doesn't implement handling of this stream. Please file a bug.Enable verbose plugin loading diagnosticsEncoding error.Error closing file "%s".Error while seeking in file "%s".Error while writing to download file.Error while writing to file "%s".Execution ended after %FOUND TAG
FOUND TAG      : found by element "%s".
FOUND TAG      : found by object "%s".
FOUND TAG      : found by pad "%s:%s".
FOUND TOC
FOUND TOC      : found by element "%s".
FOUND TOC      : found by object "%s".
Failed after iterations as requested.File "%s" is a socket.Filter capsForce EOS on sources before shutting the pipeline downFreeing pipeline ...
GStreamer OptionsGStreamer developers were too lazy to assign an error code to this error.GStreamer encountered a general core library error.GStreamer encountered a general resource error.GStreamer encountered a general stream error.GStreamer encountered a general supporting library error.GStreamer error: clock problem.GStreamer error: negotiation problem.GStreamer error: state change failed and some element failed to post a proper error message with the reason for the failure.Gather and print index statisticsGot EOS from element "%s".
Got message #%u (%s): Got message #%u from element "%s" (%s): Got message #%u from object "%s" (%s): Got message #%u from pad "%s:%s" (%s): Groups related media that spans multiple tracks, like the different pieces of a concerto. It is a higher level than a track, but lower than an albumHomepage for this media (i.e. artist or movie homepage)How the image should be rotated or flipped before displayINFO:
%s
ISRCIndex statisticsInternal GStreamer error: caps problem.Internal GStreamer error: code not implemented.Internal GStreamer error: event problem.Internal GStreamer error: pad problem.Internal GStreamer error: seek problem.Internal GStreamer error: tag problem.Internal GStreamer error: thread problem.Internal clock error.Internal data flow error.Internal data flow problem.International Standard Recording Code - see http://www.ifpi.org/isrc/Interrupt while waiting for EOS - stopping pipeline...
Interrupt: Stopping pipeline ...
LEVELLISTList the plugin contentsMake all warnings fatalManufacturer of the device used to create this mediaMissing element: %s
Model of the device used to create this mediaName of the tv/podcast/series show the media is fromName of the tv/podcast/series show the media is from, for sorting purposesNo Temp directory specified.No error message for domain %s.No file name specified for reading.No file name specified for writing.No space left on the resource.No standard error message for domain %s and code %d.No such element or plugin '%s'
Origin of media as a URI (location, where the original of the file or stream is hosted)Output TOC (chapters and editions)Output messagesOutput status information and property notificationsOutput tags (also known as metadata)PATHSPLUGINSPipeline is PREROLLED ...
Pipeline is PREROLLING ...
Pipeline is live and does not need PREROLL ...
Prerolled, waiting for buffering to finish...
Print a machine-parsable list of features the specified plugin or all plugins provide.
                                       Useful in connection with external automatic plugin installation mechanismsPrint all elementsPrint available debug categories and exitPrint list of blacklisted filesPrint supported URI schemes, with the elements that implement themPrint the GStreamer versionRating attributed by a user. The higher the rank, the more the user likes this mediaRedistribute latency...
Resource busy or not available.Resource not found.Restrict the possible allowed capabilities (NULL means ANY). Setting this property takes a reference to the supplied GstCaps object.Selected clock cannot be used in pipeline.Setting pipeline to NULL ...
Setting pipeline to PAUSED ...
Setting pipeline to PLAYING ...
Setting pipeline to READY ...
Setting state to %s as requested by %s...
Show GStreamer OptionsStream contains no data.The artist of the entire album, as it should be displayedThe artist of the entire album, as it should be sortedThe episode number in the season the media is part ofThe lyrics of the media, commonly used for songsThe season number of the show the media is part ofThe stream is encrypted and can't be decrypted because no suitable key has been supplied.The stream is encrypted and decryption is not supported.The stream is in the wrong format.The stream is of a different type than handled by this element.There is no codec present that can handle the stream's type.This application is trying to use GStreamer functionality that has been disabled.URI to the copyright notice of the dataURI to the license of the dataUnknown optionWARNING: erroneous pipeline: %s
WARNING: from element %s: %s
Waiting for EOS...
When checking if an element or plugin exists, also check that its version is at least the version specifiedYour GStreamer installation is missing a plug-in.a location within a city where the media has been produced or created (e.g. the neighborhood)albumalbum artistalbum artist sortnamealbum containing this dataalbum containing this data for sorting purposesalbum gain in dbalbum sortnameapplication dataapplication nameartistartist sortnameattachmentaudio codecbeats per minutebitratebuffering...capschangeable in NULL, READY, PAUSED or PLAYING statechangeable only in NULL or READY statechangeable only in NULL, READY or PAUSED statecity (english name) where the media has been recorded or producedcodeccodec the audio data is stored incodec the data is stored incodec the subtitle data is stored incodec the video data is stored incomma separated keywords describing the contentcommentcommonly used titlecommonly used title for sorting purposescomposercomposer sortnamecontactcontact informationcontainer formatcontainer format the data is stored incontrollablecopyrightcopyright notice of the datacopyright uricould not link %s to %scould not parse caps "%s"could not set property "%s" in element "%s" to "%s"count of discs inside collection this disc belongs tocount of tracks inside collection this track belongs tocountry (english name) where the media has been recorded or produceddatedate and time the data was created (as a GstDateTime structure)date the data was created (as a GDate structure)datetimedescriptiondetected capabilities in streamdevice manufacturerdevice modeldisc countdisc numberdisc number inside a collectiondurationempty pipeline not allowedencoded byencoderencoder used to encode this streamencoder versionepisode numberexact or average bitrate in bits/sexpected error of the horizontal positioning measures (in meters)extended commentfile attached to this streamforce capsforce caps without doing a typefindfree text commenting the datafree text commenting the data in key=value or key[en]=comment formfreeform name of the language this stream is ingenregenre this data belongs togeo elevation of where the media has been recorded or produced in meters according to WGS84 (zero is average sea level)geo latitude location of where the media has been recorded or produced in degrees according to WGS84 (zero at the equator, negative values for southern latitudes)geo location capture directiongeo location citygeo location countrygeo location elevationgeo location horizontal errorgeo location latitudegeo location longitudegeo location movement directiongeo location movement speedgeo location namegeo location sublocationgeo longitude location of where the media has been recorded or produced in degrees according to WGS84 (zero at the prime meridian in Greenwich/UK,  negative values for western longitudes)groupinghomepagehuman readable descriptive location of where the media has been recorded or producedimageimage orientationimage related to this streamindicates the direction the device is pointing to when capturing  a media. It is represented as degrees in floating point  representation, 0 means the geographic north, and increases clockwiseindicates the movement direction of the device performing the capture of a media. It is represented as degrees in floating point representation, 0 means the geographic north, and increases clockwisekeywordslanguage codelanguage code for this stream, conforming to ISO-639-1 or ISO-639-2language namelength in GStreamer time units (nanoseconds)licenselicense of datalicense urilocationlyricsmaximum bitratemaximum bitrate in bits/sminimumminimum bitrateminimum bitrate in bits/smovement speed of the capturing device while performing the capture in m/sname of the encoding person or organizationno element "%s"no property "%s" in element "%s"no sink element for URI "%s"no source element for URI "%s"nominal bitratenominal bitrate in bits/snumber of beats per minute in audioorganizationpeak of the albumpeak of the trackperformerperson(s) performingperson(s) responsible for the recordingperson(s) responsible for the recording for sorting purposesperson(s) who composed the recordingperson(s) who composed the recording, for sorting purposespreview imagepreview image related to this streamreadablereference level of track and album gain valuesreplaygain album gainreplaygain album peakreplaygain reference levelreplaygain track gainreplaygain track peakseason numberserialserial number of trackshort text describing the content of the datashow nameshow sortnamespecified empty bin "%s", not allowedsubtitle codectitletitle sortnametrack counttrack gain in dbtrack numbertrack number inside a collectionuser ratingversionversion of the encoder used to encode this streamversion of this datavideo codecwritableProject-Id-Version: gstreamer 1.0.3
Report-Msgid-Bugs-To: http://bugzilla.gnome.org/
PO-Revision-Date: 2012-12-15 03:29+0200
Last-Translator: Fran Dieguez <frandieguez@ubuntu.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
X-Project-Style: gnome
«%s» é un directorio.%d entrada na lista negra%d entradas na lista negra%d ficheiro na lista negra%d ficheiros na lista negra%d característica%d características%d engadido%d engadidos, Estanse a desbotar moitos búferes.Información adicional de depuración:
%s
Produciuse un erro ao esperar a EOS
Aplicativo usado para crear o medioDatos arbitrarios do aplicativo para serializalos no medioFicheiros na lista negra:Almacenando no búfer, estabelecendo a canalización a PAUSADA...
Comprobar se o elemento ou engadido especificado existeRutas separadas por punto e coma contendo os engadidosLista de pares nome_categoría:nivel separados por comas para estabelecer niveis específicos para as categorías individuais. Exemplo: GST_AUTOPLUG:5,GST_ELEMENT_*:3Lista de engadidos para precargar separados por comas ademais da lista almacenada na variábel de contorno GST_PLUGIN_PATHNon foi posíbel pechar o recurso.Non foi posíbel pehar a biblioteca de asistencia.Non foi posíbel configurar a biblioteca de asistencia.Non foi posíbel crear o ficheiro temporal «%s».Non foi posíbel descodificar o fluxo.Non foi posíbel demultiplexar o fluxo.Non foi posíbel determinar o tipo de fluxo.Non foi posíbel codificar o fluxo.Non foi posíbel obter a información de «%s».Non foi posíbel obter/estabelecer a configuración de/en o recurso.Nonon foi posíbel iniciar a biblioteca de compatibilidade.Non foi posíbel cargar o ficheiro do engadido: %s
Non foi posíbel multiplexar o fluxo.Non foi posíbel abrir o ficheiro «%s» para ler.Non foi posíbel abrir «%s» para escribir.Non foi posíbel abrir o recurso para a súa lectura ou escritura.Non foi posíbel abrir o recurso para a súa lectura.Non foi posíbel abrir o recurso para a súa escritura.Non foi posíbel realizar unha busca no recurso.Non foi posíbel ler desde o recurso.Non foi posíbel sincronizar o recurso.Non foi posíbel escribir no recurso.Desactivar a coloración da saída depuradaDesactivar depuraciónDesactivar o lanzamento dun proceso de axuda ao escanear o rexistroDesactivar a captura de fallos de segmentación durante a carga de engadidosDesactivar a actualización do rexistroNon instalar un manexador predeterminadoNon mostrar ningunha información de progresoRematouse de almacenar no búfer, estabelecendo a canalización para REPRODUCIR...
EOS ao apagar activado; Forzando EOS na tubería
EOS ao apagar activado; -- agardando polo EOS despois de erro
EOS recibido: detendo a tubería...
ERROR: A tubería non quere pausarse.
ERRO: do elemento %s: %s
ERRO: non foi posíbel construír a canalización.
ERRO: non foi posíbel construír a canalización: %s.
ERRO: a tubería non quere reproducirse.
ERRO: a tubería non quere prepararse.
ERRO: o elemento «canalización» non foi atopado.
O elemento non implementa un manexador deste fluxo. Por favor, complete o informe e erro.Activar a saída detallada do diagnóstico de carga de engadidosErro de codificación.Produciuse un erro ao pechar o ficheiro «%s».Produciuse un erro ao buscar no ficheiro «%s».Produciuse un erro de escritura ao descargar o ficheiro.Produciuse un erro ao escribir no ficheiro «%s».A execución rematou despois de %ETIQUETA ENCONTRADA
ATOPADA ETIQUETA      : atopada polo elemento «%s».
ETIQUETA ENCONTRADA      : encontrada polo obxecto «%s».
ATOPADA ETIQUETA      : atopada pola cela «%s:%s».
TOC ATOPADO
TOC ATOPADO    : atopado polo elemento «%s».
TOC ATOPADO    : encontrado polo obxecto «%s».
Produciuse un fallo despois das iteracións que se solicitaron.O ficheiro «%s» é un socket.Filtro de capacidadesForzar EOS nas orixes antes de pechar a canalizaciónLiberando a tubería...
Opcións de GStreamerOs desenvolvedores de GStreamer foron demasiado vagos para engadir un código de erro a este erro.GStreamer encontrou un erro xeral no núcleo da biblioteca.GStreamer encontrou un erro xeral de recurso.GStreamer encontrou un erro xeral de fluxo.GStreamer atopou un erro de compatibilidade xeral na biblioteca.Erro de GStreamer: problema de reloxo.Erro de GStreamer: problema de negociación.Produciuse un erro de GStreamer: produciuse un fallo durante o cambio de estado e algún elemento fracasou ao publicar a mensaxe de erro correspondente co motivo do fallo.Obter e imprimir as estatísticas do índiceObtívose un EOS do elemento «%s».
Obtívose a mensaxe num. %u (%s): Obtívose a mensaxe nº %u do elemento «%s» (%s): Obtívose a mensaxe nº %u do obxecto «%s» (%s): Obtívose a mensaxe nº %u da cela «%s:%s» (%s): Agrupa temas relacionados que se expanden varias pistas, como as diferentes partes dun concerto. É un nivel máis alto que o dunha pista, pero máis baixo que o dun álbum.Páxina principal para este medio (p.ex. páxina principal do artista ou filme)Como se debería rotar ou voltear a imaxe antes de mostralaINFORMACIÓN:
%s
ISRCEstatísticas do índiceErro interno de GStreamer: probema coas capacidades.Erro interno de GStreamer: código non implementado.Erro interno de GStreamer: problema cos eventos.Erro interno de GStreamer: problema de desprazamento.Erro interno de GStreamer: problema coa busca.Erro interno de GStreamer: problema coas etiquetas.Erro interno de GStreamer: problema cos fíosProduciuse un erro no reloxo interno.Produciuse un erro no fluxo interno de datos.Hai un problema no fluxo interno de datos.International Standard Recording Code; consulte http://www.ifpi.org/isrc/Interromper ao agardar polo EOS - detendo a canalización…
Interromper: parando a canalización …
NIVELLISTAListar o contido do engadidoFacer todas as advertencias fataisFabricante do dispositivo usado para crear este medioElemento que falta: «%s»
Modelo do dispositivo usado para crear este medioNome do programa/podcast/serieNome do programa/podcast/serie, para propósitos de ordenaciónNon se especificou un directorio temporal.Non hai unha mensaxe de erro para o dominio %s.Non se especificou un nome de ficheiro para a lectura.Non se especificou un nome de ficheiro para escritura.Non queda espacio dispoñíbel no recurso.Non hai unha mensaxe de erro estándar par ao dominio %s e código %d.Non existe o elemento ou engadido «%s»
Orixe do medio como un URI (localización, onde está aloxado o ficheiro ou fluxo orixinal)TOC de saída (capítulos e edicións)Mensaxes de saídaInformación do estado da saída e notificacións das propiedadesEtiquetas de saída (tamén coñecido como metadatos)RUTASCOMPLEMENTOSA tubería está PREPARADA...
A tubería está PREPARÁNDOSE...
A tubería está viva e non necesita PREPARARSE...
Preparado, agardando a encher o búfer para rematar…
Imprimir unha lista de características analizábeis por unha máquina do engadido especificado ou fornecer todos os engadidos.
                                       Útil xunto con mecanismos de instalación externa automática de engadidos.Imprimir todos os elementosImprimir as categorías de depuración dispoñíbeis e saírImprimir lista dos ficheiros na lista negraImprimir os esquemas URI admitidos, cos elementos que os implementanImprimir a versión de GStreamerPuntuación atribuída por un usuario. Canto maior sexa a puntuación mais lle gustará ao usuario.Redistribuír latencia...
O recurso está ocupado ou non dispoñíbel.Recurso non encontrado.Restrinxir as posíbeis capacidades permitidas (NULL significa CALQUERA). Ao estabelecer esta propiedade obtense unha referencia do obxecto GstCaps fornecido.Non é posíbel usar o reloxo seleccionado na canalización.Estabelecendo a tubería a NULL...
Estabelecendo a tubería a PAUSA...
Estabelecendo a tubería a REPRODUCINDO.
Estabelecendo a tubería a PREPARADO...
Estabelecendo o estado a %s segundo foi solicitado por %s...
Mostrar as opcións de GStreamerO fluxo non contén datos.O artista do álbum enteiro, como se debería mostrarO artista do álbum enteiro, como se debería ordenarO número do capítulo na tempadaAs letras do ficheiro multimedia, xeralmente usado para canciónsO número de tempada do programaO fluxo está cifrado e non é posíbel descifralo porque non se forneceu a chave axeitada.O fluxo está cifrado e o descrifrado non é posíbel.O fluxo está no formato incorrecto.O fluxo é dun tipo diferente que o manexado por este elemento.Non hai un códec dispoñíbel que poida manexar este tipo de fluxo.Este aplicativo está tentando usar unha funcionalidade de GStreamer que foi deshabilitada.URI á nota de dereitos de autoría dos datosURI á licenza dos datosOpción descoñecidaAVISO: canalización errónea: %s
AVISO: do elemento %s: %s
Agardando pola EOS...
Ao comprobar se un elemento ou engadido existe, tamén comprobar se a súa versión é cando menos a versión especificadaÁ súa instalación de GStreamer fáltalle un engadido.unha localización nunha cidade onde foi gravado ou producido o medio (p.ex. o barrio)álbumeartista do álbumenome de ordenación do artista do álbumeo álbum que conten estes datoso álbum que conten estes datos para propósitos de ordenamentoganancia do álbum en dBnome de ordenación do álbumedatos do aplicativonome do aplicativoartistanome de ordenación do artistaanexocódec de songolpes por minuto (bpm)taxa de bitsalmacenando no búfer…capacidadesintercambiábel entre os estados NULL, READY, PAUSED ou PLAYINGintercambiábel só entre os estados NULL ou READYintercambiábel só entre os estados NULL, READY ou PAUSEDcidade (nome en inglés) onde foi gravado ou producido o mediocódeccódec no que se almacenan os datos do soncódec no que se almacenan os datoscódec no que se almacenan os datos dos subtítuloscódec no que se almacenan os datos do vídeopalabras clave separadas por comas describindo o contidocomentariotítulo usado de forma comúntítulo usado comunmente para propósitos de ordenamentocompositornome curto do compositorcontactoinformación de contactoformato do contedorformato do contedor no que se almacenan os datoscontrolábelcopyrightnota de dereitos de autoría dos datosURI aos dereitos de autornon foi posíbel ligar %s a %snon foi posíbel analizar as capacidades «%s»non foi posíbel estabelecer a propiedade «%s» no elemento «%s» a «%s»número de discos na colección á que pertence o disconúmero de pistas na colección á que pertence a pistapaís (nome en inglés) onde foi gravado ou producido o mediodatadata e hora na que se crearon os datos (como estrutura GstDateTime)data na que se crearon os datos (como estrutura GDate)data e horadescricióncapacidades detectadas no fluxofabricante do dispositivomodelo do dispositivonúmero de discosnúmero de disconúmero do disco dentro dunha colecciónduraciónnon se permite unha canalización baleiracodificado porcodificadorcodificador usado para codificar este fluxoversión do codificadornúmero de episodiotaxa de bits exacta ou promedio en bits/serro esperado das medidas de posicionamento horizontal (en metros)comentario estendidoficheiro anexo a este fluxoforzar as capacidadesforzar as capacidades sen facer un «typefind»comentario de texto sobre os datostexto libre comentando os datos como key=valor ou key[gl]=formulario de comentarionome freeform do idioma no que está este fluxoxéneroxénero ao que pertencen estes datoselevación xeográfica onde foi gravado ou producido o medio, en graos conforme a WGS84 (cero é o nivel medio do mar)latitude xeográfica onde foi gravado ou producido o medio, en graos conforme a WGS84 (cero é o ecuador, valores negativos para latitudes meridionais)dirección de captura da xeolocalizacióncidade da xeolocalizaciónpaís da xeolocalizaciónelevación da xeolocalizaciónerro horizontal de xeolocalizaciónlatitude da xeolocalizaciónlonxitude da xeolocalizacióndirección de movemento da xeolocalizaciónvelocidade de movemento da xeolocalizaciónnome da xeolocalizaciónsublocalización da xeolocalizaciónlonxitude xeográfica onde foi gravado ou producido o medio, en graos conforme a WGS84 (cero é o primeiro meridiano en Greenwich/GB, valores negativos para lonxitudes occidentais)agrupaciónsitio webdescrición da localización entendíbel por humanos de onde foi gravado ou producido o medioimaxeorientación da imaxeimaxe relacionada con este fluxoindica a dirección na que apunta o dispositivo que realiza a captura dun medio. Representase en graos ou nunha representación en coma flotante, 0 corresponde ao norte xeográfico e incrementa de forma horaria.indica a dirección do movemento do dispositivo que realiza a captura dun medio. Representase en graos ou nunha representación en coma flotante, 0 corresponde ao norte xeográfico e incrementa de forma horaria.palabras chavecódigo de idiomacódigo de idioma para este fluxo, axustándose a ISO-639-1 ou ISO-639-2nome do idiomaduración en unidades de tempo GStreamer (nanosegundos)licenzalicenza dos datosURI á licenzalocalizaciónletrastaxa de bits máximataxa máxima de bits en bits/smínimotaxa de bits mínimataxa mínima de bits en bits/svelocidade de movemento do dispositivo de captura mentres realiza a captura, en m/snome da persoa ou organización codificadoranon hai un elemento «%s»non hai unha propiedade «%s» no elemento «%s»non existe o elemento sumidoiro para o URI «%s»non existe un elemento orixe para o URI «%s»taxa de bits nominaltaxa de bits nominal en bits/snúmero de golpes por minuto (bpm) no sonorganizaciónpico do álbumpico da pistaintérpretepersoa(s) interpretandopersoa(s) responsábel(eis) da gravaciónpersoa(s) responsábel(eis) da gravación para propósitos de ordenamentopersoa(s) que compuxeron a gravaciónpesoa(s) que compuxeron a gravación, para propósitos de ordenamentoprevisualizar imaxevista previa da imaxe relacionada con este fluxolexíbelvalor do nivel de referencia da ganancia da pista e do álbumganancia do álbum (ReplayGain)pico do álbum (ReplayGain)nivel de referencia (ReplayGain)ganancia da pista (ReplayGain)pico da pista (ReplayGain)número de tempadaserienúmero de serie da pistatexto curto describindo o contido dos datosnome do programanome de ordenación do programao binario especificado «%s» está baleiro, non está permitidocódec do subtitulotítulonome de ordenación do títulonúmero de pistasganancia da pista en dBnúmero de pistanúmero de pista nunha colecciónpuntuación do usuarioversiónversión do codificador usado para codificar este fluxoversión destes datoscódec de vídeoescribíbelPK�m�\\�(XLC_MESSAGES/iso_3166-3.monu�[����� +��)�*:/W��
���)�9IXmz!����� �)5 No2{)����#�)�0	:(S|���)�,�#	7	
N	\	l	�	�	.�	�	�	�	
"
36
j
$�
	�
)�
,�

 

	British Antarctic TerritoryBurma, Socialist Republic of the Union ofByelorussian SSR Soviet Socialist RepublicCanton and Enderbury IslandsCzechoslovakia, Czechoslovak Socialist RepublicDahomeyDronning Maud LandEast TimorFrance, MetropolitanFrench Afars and IssasFrench Southern and Antarctic TerritoriesGerman Democratic RepublicGilbert and Ellice IslandsJohnston IslandMidway IslandsNetherlands AntillesNeutral ZoneNew HebridesPacific Islands (trust territory)Panama Canal ZoneSerbia and MontenegroSikkimSouthern RhodesiaUS Miscellaneous Pacific IslandsUSSR, Union of Soviet Socialist RepublicsUpper Volta, Republic ofViet-Nam, Democratic Republic ofWake IslandYemen, Democratic, People's Democratic Republic ofYugoslavia, Socialist Federal Republic ofZaire, Republic ofProject-Id-Version: iso_3166-3
Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues
POT-Creation-Date: 2018-01-17 22:10+0100
PO-Revision-Date: 2014-03-13 23:32+0100
Last-Translator: Jorge Barreiro <yortx.barry@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Generator: Lokalize 1.4
Plural-Forms: nplurals=2; plural=n != 1;
Territorio Británico da AntártidaBurma, República Socialista da Unión deBielorrusia, República Socialista Soviética deIllas Canton e EnderburyChecoslovaquia, República Socialista deDahomeyTerra da Raíña MaudTimor LesteFrancia MetropolitanaTerritorio Francés dos Afares e os IssasTerritorios Franceses do Sul e da AntártidaRepública Democrática de AlemañaIllas Gilbert e ElliceIlla JohnstonIllas de MidwayAntillas HolandesasZona NeutralNovas HébridasIllas do Pacífico (territorio en fideicomiso)Zona do Canal de PanamáSerbia e MontenegroSikkimRodesia MeridionalVarias Illas do Pacífico dos EEUUURSS, Unión de Repúblicas Socialistas SoviéticasAlto Volta, República doViet-Nam, República Democrática deIlla WakeIemen, República Democrática Popular doIugoslavia, República Federal Socialista deZaire, República doPK�m�\_�)˨T�TLC_MESSAGES/wget.monu�[������t9��:��;%=ct'�������(.W%w)�'�$�&&9$`8�<� �/Lk�"���= ^z'�(��!$#<,`)�6��=Y(j#���	����'#K[-m<���5 Hi3����%.Fb"|#���3�.I
ao)|�
��!�D�*>i�%��6�( !9 [  z � � 
� "�  !!#!E!'R!(z!�!!�!0�!" "2;"n"{"�"�"�"�"�"#7!#Y#'k#"�#�#4�#8�#6$
?$�J$%$%*+%V%f%r%�%�%�%J�%&*&@&S&\&z&�&�&�&�&5�&('5'T'
k'=v'�'+�'�'(-!(NO(E�(�(8�("3);V)�))�)
�)�)�)&�)(*D*S*+b*<�*�*	�*-�*/+K++h+3�+�+1�+2,,H,;u,"�,�,$�,-
2-@-M-/b-6�-�-!�-..=.\.k.*s.�.3�.*�."/)/G/I/#U/y/�/	�/�/�/�/�/�/�/�/0�0<�12?2+X2�2�2*�2�2�2
�23$3(3H3(e3"�3*�3.�3'4$34X4i41|4)�4F�4L5'l5=�5%�5"�5 6)<6)f6�6(�6D�6!7!?78a7C�7�7"�78':8#b8,�8E�81�8+9%G9!m9�9-�96�9::
:(:9:E:a:3z:�:�:D�:_&;A�;1�;/�;*<3G<+{<I�<"�<%=+:=4f=�=�=�=&�='>;>Z>By>'�>%�>

??/%?$U?
z?�?-�?F�?&�?"&@$I@(n@�@?�@9�@0.A1_A6�A&�A)�AB2+B<^B8�B�B1�B2CFC]C>zC"�C�CB�C?DNDaD.D �D�D#�DEGE!eE7�E&�E �EBFAJF�F
�F��F
oG
}G&�G�G�G$�G�GH&HIBH�H"�H�H�H%�HI4ITInI(�IB�I�IJ"J
>J;LJ!�J6�J�J�J0KT7KQ�K�KI�K.DLPsL�L,�LMM!M.9M0hM�M�M@�MV�MRNmNIvN3�N�N(OA4OvO5�O6�O*PJ+P5vP �P-�P(�P$Q6QLQ;iQH�Q�Q#	R-RGR.fR�R�R+�R�RR�R33S'gS"�S�S�S,�S�S�S	�S	TT/TKTTThT�T�T!��F����{1u6��29A�k|(v��8Q=D�lh�
#�T��;�W��<��c"q'x��LP�C��B�%��Yw�XK��\M�]f�I�����&�.��p�`yZ��U��i$���~��b �H@��?�a5���0�[��
��m>�*���S�e^��4��z�����E���o�	�����j��:r+GRs�,�-7�}V�g�n_J�d���N����3)��t/���O�
    The file is already fully retrieved; nothing to do.


%*s[ skipping %sK ]
Originally written by Hrvoje Niksic <hniksic@xemacs.org>.

REST failed, starting from scratch.
    %s (system)
    %s (user)
  Self-signed certificate encountered.
 (%s bytes) (unauthoritative)
 [following]%d redirections exceeded.
%s
%s (%s) - %s saved [%s/%s]

%s (%s) - %s saved [%s]

%s (%s) - Connection closed at byte %s. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - written to stdout %s[%s/%s]

%s (%s) - written to stdout %s[%s]

%s ERROR %d: %s.
%s URL: %s %2d %s
%s request sent, awaiting response... %s: %s, closing control connection.
%s: %s: Failed to allocate %ld bytes; memory exhausted.
%s: %s: Failed to allocate enough memory; memory exhausted.
%s: %s: Invalid WARC header %s.
%s: %s: Invalid boolean %s; use `on' or `off'.
%s: %s: Invalid byte value %s
%s: %s: Invalid header %s.
%s: %s: Invalid number %s.
%s: %s: Invalid progress type %s.
%s: %s: Invalid time period %s
%s: %s: Invalid value %s.
%s: %s:%d: unknown token "%s"
%s: %s:%d: warning: %s token appears before any machine name
%s: %s; disabling logging.
%s: Cannot read %s (%s).
%s: Cannot resolve incomplete link %s.
%s: Couldn't find usable socket driver.
%s: Error in %s at line %d.
%s: Invalid --execute command %s
%s: Invalid URL %s: %s
%s: Syntax error in %s at line %d.
%s: The certificate of %s has been revoked.
%s: Unknown command %s in %s at line %d.
%s: Warning: Both system and user wgetrc point to %s.
%s: cannot stat %s: %s
%s: corrupt time-stamp.
%s: illegal option -- `-n%c'
%s: invalid option -- '%c'
%s: missing URL
%s: option requires an argument -- '%c'
%s: unknown/unsupported file type.
'(no description)(try:%2d), %s (%s) remaining, %s remaining==> CWD not needed.
==> CWD not required.
Already have correct symlink %s -> %s

Bad port numberBind error (%s).
Can't be verbose and quiet at the same time.
Can't timestamp and not clobber old files at the same time.
Cannot back up %s as %s: %s
Cannot convert links in %s: %s
Cannot initiate PASV transfer.
Cannot open %s: %sCannot open cookies file %s: %s
Cannot parse PASV response.
Cannot specify both --ask-password and --password.
Cannot unlink %s (%s).
Cannot write to %s (%s).
Cannot write to WARC file.
Cannot write to temporary WARC file.
Connecting to %s:%d... Connecting to %s|%s|:%d... Connecting to [%s]:%d... Continuing in background, pid %d.
Continuing in background, pid %lu.
Continuing in background.
Control connection closed.
Could not seed PRNG; consider using --random-file.
Creating symlink %s -> %s
Data transfer aborted.
Directories:
Directory   Disabling SSL due to encountered errors.
Download quota of %s EXCEEDED!
Download:
ERRORERROR: Cannot open directory %s.
ERROR: GnuTLS requires the key and the cert to be of the same type.
ERROR: Redirection (%d) without location.
Encoding %s isn't valid
Error closing %s: %s
Error in proxy URL %s: Must be HTTP.
Error in server greeting.
Error in server response, closing control connection.
Error initializing X509 certificate: %s
Error matching %s against %s: %s
Error parsing certificate: %s
Error parsing proxy URL %s: %s.
Error while matching %s: %d
Error writing to %s: %s
FTP options:
Failed reading proxy response: %s
Failed to unlink symlink %s: %s
Failed writing HTTP request: %s.
File        File %s already there; not retrieving.
File %s already there; not retrieving.

File %s exists.
File has already been retrieved.
Found %d broken link.

Found %d broken links.

Found no broken links.

GNU Wget %s built on %s.

GNU Wget %s, a non-interactive network retriever.
Giving up.

HTTP options:
HTTPS (SSL/TLS) options:
HTTPS support not compiled inIPv6 addresses not supportedIndex of /%s on %s:%dInvalid IPv6 numeric addressInvalid PORT.
Invalid dot style specification %s; leaving unchanged.
Invalid host nameInvalid name of the symlink, skipping.
Invalid regular expression %s, %s
Invalid user nameLast-modified header invalid -- time-stamp ignored.
Last-modified header missing -- time-stamps turned off.
Length: Length: %sLicense GPLv3+: GNU GPL version 3 or later
<http://www.gnu.org/licenses/gpl.html>.
This is free software: you are free to change and redistribute it.
There is NO WARRANTY, to the extent permitted by law.
Link        Link: Loading robots.txt; please ignore errors.
Location: %s%s
Logged in!
Logging and input file:
Logging in as %s ... Login incorrect.
Malformed status lineMandatory arguments to long options are mandatory for short options too.

No URLs found in %s.
No certificate found
No data received.
No errorNo headers, assuming HTTP/0.9No matches on pattern %s.
No such directory %s.

No such file %s.
No such file %s.

No such file or directory %s.

Not descending to %s as it is excluded/not-included.
Not sure    Output will be written to %s.
Password for user %s: Password: Please send bug reports and questions to <bug-wget@gnu.org>.
Read error (%s) in headers.
Recursion depth %d exceeded max. depth %d.
Recursive download:
Rejecting %s.
Remote file does not exist -- broken link!!!
Remote file exists and could contain links to other resources -- retrieving.

Remote file exists but does not contain any link -- not retrieving.

Remote file exists.

Remote file is newer than local file %s -- retrieving.

Remote file is newer, retrieving.
Remote file no newer than local file %s -- not retrieving.
Removed %s.
Removing %s since it should be rejected.
Removing %s.
Resolving %s... Retrying.

Reusing existing connection to %s:%d.
Reusing existing connection to [%s]:%d.
Saving to: %s
Scheme missingServer error, can't determine system type.
Server file no newer than local file %s -- not retrieving.

Skipping directory %s.
Startup:
Symlinks not supported, skipping symlink %s.
Syntax error in Set-Cookie: %s at position %d.
The certificate has expired
The certificate has not yet been activated
The certificate's owner does not match hostname %s
The server refuses login.
The sizes do not match (local %s) -- retrieving.
The sizes do not match (local %s) -- retrieving.

This version does not have support for IRIs
To connect to %s insecurely, use `--no-check-certificate'.
Try `%s --help' for more options.
Unable to delete %s: %s
Unable to establish SSL connection.
Unknown authentication scheme.
Unknown errorUnknown hostUnknown system errorUnknown type `%c', closing control connection.
Unsupported listing type, trying Unix listing parser.
Unsupported scheme %sUnterminated IPv6 numeric addressUsage: %s NETRC [HOSTNAME]
Usage: %s [OPTION]... [URL]...
Using %s as listing tmp file.
WARC options:
WARNINGWarning: wildcards not supported in HTTP.
Wgetrc: Will not retrieve dirs since depth is %d (max %d).
Write failed, closing control connection.
Wrote HTML-ized index to %s [%s].
Wrote HTML-ized index to %s.
`connected.
couldn't connect to %s port %d: %s
done.
done.  done.    failed: %s.
failed: timed out.
idn_encode failed (%d): %s
ignoredmemory exhaustednothing to do.
time unknown       unspecifiedProject-Id-Version: wget 1.14
Report-Msgid-Bugs-To: bug-wget@gnu.org
PO-Revision-Date: 2012-11-11 23:30+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8-bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=(n != 1);

    O ficheiro xa está completo; non hai nada que facer.


%*s[ omitindo %sK ]
Escrito orixinalmente por Hrvoje Niksic <hniksic@xemacs.org>.

REST fallou, comezando desde o principio.
    %s (sistema)
    %s (usuario)
  Encontrouse un certificado autoasinado.
 (%s bytes) (dato non fidedigno)
 [seguíndoo]Superáronse %d redireccións.
%s
%s (%s) - gardouse %s [%s/%s]

%s (%s) - gardouse %s [%s]

%s (%s) - Conexión pechada no byte %s. %s (%s) - Conexión de datos: %s; %s (%s) - Erro de lectura no byte %s (%s).%s (%s) - Erro de lectura no byte %s/%s (%s). %s (%s) - escrito en stdout %s[%s/%s]

%s (%s) - escrito en stdout %s[%s]

%s ERRO %d: %s.
%s URL: %s %2d %s
Petición %s enviada, agardando unha resposta... %s: %s, pechando a conexión de control.
%s: %s: Produciuse un erro ao asignar %ld bytes; esgotouse a memoria.
%s: %s: Produciuse un erro ao asignar memoria dabondo; esgotouse a memoria.
%s: %s: Cabeceira WARC %s non válida.
%s: %s: Booleano %s non válido, empregue «on» ou «off».
%s: %s: Valor de byte %s non válido
%s: %s: Cabeceira %s non válida.
%s: %s: Número %s non válido.
%s: %s: Tipo de progreso %s non válido.
%s: %s: Período de tempo %s non válido
%s: %s: Valor %s non válido.
%s: %s:%d: elemento «%s» descoñecido
%s: %s:%d: aviso: o elemento %s aparece antes dos nomes de máquina
%s: %s; desactivando o rexistro.
%s: Non é posíbel ler %s (%s).
%s: Non foi posíbel resolver a ligazón incompleta %s.
%s: Non foi posíbel atopar un controlador de sockets utilizábel.
%s: Erro en %s na liña %d.
%s: Orde --execute non válida %s
%s: URL %s non válido: %s
%s: Erro de sintaxe en %s na liña %d.
%s: Revogouse o certificado de %s.
%s: Orde descoñecida %s en %s na liña %d.
%s: Aviso: Os ficheiros wgetrc do sistema e do usuario apuntan a %s.
%s: non é posíbel obter información de %s: %s
%s: marca de tempo danada.
%s: opción inaceptábel -- «-n%c»
%s: opción incorrecta -- «%c»
%s: falta o URL
%s: a opción require un argumento -- «%c»
%s: tipo de ficheiro descoñecido ou non compatíbel.
»(sen descrición)(intento:%2d), quedan %s (%s), quedan %s==> non foi necesario CWD.
==> non se require CWD.
Xa ten unha ligazón simbólica correcta %s -> %s

Número de porto erróneoErro facendo bind (%s).
Non é posíbel ser moi falador e estar en silencio ao mesmo tempo.
Non é posíbel poñer unha marca de tempo e non machacar os ficheiros antigos ao mesmo tempo.
Non é posíbel crear unha copia de seguridade de %s como %s: %s
Non é posíbel converter as ligazóns en %s: %s
Non foi posíbel comezar a transferencia PASV.
Non é posíbel abrir %s: %sNon é posíbel abrir o ficheiro de cookies %s: %s
Non foi posíbel analizar a resposta PASV.
Non é posíbel especificar á vez tanto --ask-password como --password.
Non é posíbel desligar %s (%s).
Non é posíbel escribir en %s (%s).
Non é posíbel escribir no ficheiro WARC.
Non é posíbel escribir no ficheiro WARC temporal.
Conectando con %s:%d... Conectando con %s|%s|:%d... Conectando con [%s]:%d... Continuando en segundo plano, pid %d.
Continuando en segundo plano, pid %lu.
Continuando en segundo plano.
Conexión de control pechada.
Non foi posíbel sementar PRNG; considere empregar --random-file.
Creando a ligazón simbólica %s -> %s
Transferencia de datos interrompida.
Directorios:
Directorio  Desactivando SSL debido aos erros encontrados.
SUPEROUSE a cota de descarga de %s!
Descarga:
ERROERRO: non é posíbel abrir o directorio %s.
ERRO: GnuTLS require que a clave e o certificado sexan do mesmo tipo.
ERROR: Redirección (%d) sen destino.
A codificación %s non é válida
Produciuse un erro ao pechar %s: %s
Erro no URL do proxy %s: Debe ser HTTP.
Erro no saúdo do servidor.
Erro na resposta do servidor, pechando a conexión de control.
Produciuse un erro ao inicializar o certificado X509: %s
Produciuse un erro ao comparar %s contra %s: %s
Produciuse un erro ao analizar o certificado: %s
Produciuse un erro ao analizar o URL do proxy %s: %s.
Produciuse un erro ao comparar %s: %d
Produciuse un erro ao escribir en %s: %s
Opcións de FTP:
Produciuse un erro ao ler a resposta do proxy: %s
Produciuse un erro ao desligar a ligazón simbólica %s: %s
Produciuse un erro ao escribir unha petición HTTP: %s.
Ficheiro    O ficheiro %s xa está aí, non se ha descargar.
O ficheiro %s xa está aí, non se ha descargar.

O ficheiro %s existe.
O ficheiro xa se descargou.
Atopouse %d ligazón rota.

Atopáronse %d ligazóns rotas.

Non se atoparon ligazóns rotas.

GNU Wget %s compilouse en %s.

GNU Wget %s, un descargador de ficheiros de rede non interactivo.
Abandonando.

Opcións de HTTP:
Opcións de HTTPS (SSL/TLS):
Non se compilou con compatibilidade para HTTPSNon se admiten os enderezos IPv6Índice de /%s en %s:%dEnderezo IPv6 numérico non válidoPORT incorrecto.
Especificación de estilo de puntos %s non válida; queda sen cambiar.
O nome do servidor non é válidoO nome da ligazón simbólica é incorrecto, omitindo.
Expresión regular non válida %s, %s
O nome do usuario non é válidoCabeceira Last-modified incorrecta -- ignorouse a marca de tempo.
Falta a cabeceira Last-modified -- marcas de tempo desactivadas.
Lonxitude: Lonxitude: %sLicenza GPLv3+: GNU GPL versión 3 ou posterior
<http://www.gnu.org/licenses/gpl.html>.
Isto é software libre: pode modificalo e redistribuílo.
Non hai NINGUNHA GARANTÍA, ata onde o permita a lei.
Ligazón     Ligazón: Cargando robots.txt; ignore os erros.
Localización: %s%s
Conectado!
Ficheiros de rexistro e de entrada:
Identificándome como %s ... Login incorrecto.
Liña de estado mal formadaOs argumentos obrigatorios nas opcións longas tamén o son nas curtas.

Non se atoparon URLs en %s.
Non se atopou ningún certificado
Non se recibiron datos.
Ningún erroNon hai cabeceiras, asúmese HTTP/0.9Non coincide co patron %s.
Non existe tal directorio %s.

Non hai tal ficheiro %s.
Non hai tal ficheiro %s.

Non hai tal ficheiro ou directorio %s.

Non se ha descender a %s porque está excluído ou non incluído.
Non seguro  Vaise escribir a saída en %s.
Contrasinal do usuario %s: Contrasinal: Envíe informes de fallo e preguntas a <bug-wget@gnu.org>.
Erro ao ler (%s) nas cabeceiras.
A profundidade de recursión %d excedeu a máxima %d.
Descarga recursiva:
Rexeitando %s.
O ficheiro remoto non exite -- ligazón rota!!!
O ficheiro remoto existe e pode conter ligazóns a outros recursos -- descargando.

O ficheiro remoto existe pero non contén ningunha ligazón -- non se descarga.

O ficheiro remoto existe.

O ficheiro remoto é máis novo que o ficheiro local %s -- descargando.

O ficheiro remoto é máis novo, descargando.
O ficheiro remoto non é máis novo que o ficheiro local %s -- non se descarga.
Retirouse %s.
Retirando %s porque debería ser rexeitado.
Retirando %s.
Resolvendo %s... Intentándoo de novo.

Reutilizando a conexión existente con %s:%d.
Reutilizando a conexión existente con [%s]:%d.
Gardando en: %s
Falta o esquemaErro no servidor, non é posíbel determinar o tipo do sistema.
O ficheiro do servidor non é máis novo que o ficheiro local %s -- non se descarga.

Omitindo o directorio %s.
Inicio:
Non se admiten ligazóns simbólicas, omitindo a ligazón simbólica %s.
Erro de sintaxe en Set-Cookie: %s na posición %d.
O certificado caducou
O certificado aínda non está activado
O propietario do certificado non coincide co nome de servidor %s
O servidor rexeita o login.
Os tamaños non coinciden (local %s) -- descargando.
Os tamaños non coinciden (local %s) -- descargando.

Esta versión non é compatíbel con IRIs
Para conectar de forma non segura con %s, use «--no-check-certificate».
Execute «%s --help» para obter máis información.
Non é posíbel eliminar %s: %s
Non foi posíbel establecer a conexión SSL.
Sistema de autenticación descoñecido.
Erro descoñecidoServidor descoñecidoErro de sistema descoñecidoTipo «%c» descoñecido, pechando a conexión de control.
Tipo de lista non compatíbel, probando o analizador de listas de Unix.
Esquema %s non compatíbelEnderezo IPv6 numérico sen rematarUso: %s NETRC [SERVIDOR]
Uso: %s [OPCIÓN]... [URL]...
Usando %s como un ficheiro temporal de lista.
Opcións WARC:
AVISOAviso: comodíns non compatíbeis en HTTP.
Wgetrc: Non se han descargar directorios, porque a profundidade chegou a %d (máximo %d).
Erro ao escribir, pechando a conexión de control.
Escrito un índice en HTML en %s [%s].
Escrito un índice en HTML en %s.
«conectado.
non foi posíbel conectar a %s porto %d: %s
feito.
feito.  feito.   fallou: %s.
fallou: tempo esgotado.
idn_encode fallou (%d): %s
ignoradoesgotouse a memorianon hai nada que facer.
tempo descoñecido   non especificadoPK�m�\���XNONOLC_MESSAGES/mc.monu�[������<%=\JPcQchjc�c�c�c�c$d7dWdkd	�d	�d	�d�d�d�d�d
�d
�d#�d(e
AeOele�e�e�e�e	�e�effff-f:f	CfMf]f
dfrf�f�f�f�f�f
�f
�f�f�fggg)g0g7g@gUgggmg~g�g�g�g�g�g%�g�g�gh%h
+h6hChHhUhihyh�h�h�h
�h�h	�h�h
�h�h
ii0i?iSicioi
~i�i�i�i�i�i�i�i�i�i�i�ijj
j%j+j8j>jGj\jmjtj�j�j
�j�j
�j�j'�jk	kk,k2k8k?kDkJkYk]kck
gkuk
~k�k�k�k�k�k	�k�k	�k�kllll&l6l=lElRl[lglolwll�l�l�l
�l�l�l�l
�l�l�l�l
�lmmm#m4mMmSm\mim	vm�m�m�m�m�m
�m�m�mn	nn!n
)n7n=n
Ln
Wnen{n�n	�n�n
�n�n�n�n�n�noo$o3oCo
_o	mowo�o�o�o�o�o|�oFsRsZsfsos{s�s�s�s$�s?�s	+t5t
:tHtPtct{t�t%�t�t�t�t�t�tuu+u/u7u	Hu3Ru
�u
�u+�u�u�u�u�uvv
)v7vGvK`v�vD�vw%w
?w	Mw
Ww7bw=�w�w�w�w	xx(x9xJxYxjx{x�x
�x�x�x�x�x�x�xyy'y7yFyWy
fyty�y�y�y�y�y�y�y�y
zz(z5zAz
HzVzez	vz�z�z�z�z�z�z�z�z{){ >{_{%t{ �{ �{ �{%�{#|!>|`|~|"�|&�|!�|$}'*}$R})w}%�}�}�}0�}*~F~8f~ �~ �~ �~"%8!O!q�%� ��!�)�C�^�z����� ��܀ �� �9�Y�(t�����"Ձ��
�0$�U�t�����5ς��.�.C�0r�����$Ѓ���4�S� s� ������˄݄���
��(�E�T�i�.�
����
х߅�
�
!�/�
D�O�c�u���
����������̆��	���/�F�V�n�{�����&ć����%�.�G�M�	^�h���'����шNֈO%�u�����������ʉЉ
׉����'�B�b�q�������Ċ����
� �:�0@�!q�����ċԋ����&�%:�`�z�����2Ì���"�>*�i�
m�x�
������
������ƍ͍ҍ���	�
��9�
J�X�e�l�{�"����ǎ
ώݎ��C�D�Z�k�$w�����Əۏ9�-�3�9�X�w�����Ɛא�B�R�l�y�	�� ����ȑّ3��
5�C�W�h�z�������"ʒ�!���!<�)^���������:��'�_�(r�������*̔��
��
 �+�";�%^���������	ȕҕ���)�@�G�
e�s�	������Ж
ٖ�
������$-�R�^�w�~���������͗ݗ���
��-�<�L�\�l�|���������Șט�����^�s�z�����	������
љFܙ#�)�8�#>�
b�m�y���������Ț��#��&�3�D�Y�p�
��'����/כ� �,�F�M�_�r�~���'��Ɯ֜�

�<�U�]�o��"������
��
̝ם
���	��!�-�<�I�4N�	����
������ ̞I�7�H�Z�_�l�	����	������=ԟ=�:P���
��������Ƞ۠$��	'�1�6�I�
O�Z�
p�
{�������!��ϡ���� �'�	-�<7�t�6��
��͢Т
��
��
�
�$�;�R�
X�c�o�����	������ɣ	أ
��	����	�!�	6� @�a�	q�{���
������äȤڤ������
�� ��������Ԧ�����3�/H�.x�
������˧Чߧ���%-�S�l�~�
����
����"Ԩ ���-�9�L�
X�f�x���������
����éҩ
�������&�3�C�P�c�w������
������
��	ɪӪ
��I��I�Q�e�
l�z�����	����ȫܫ
���	�"�+�
7�B�&R�/y�������׬ݬ���5�G�T�Y�	h�r�x�	~���,��?����
�
��2�!9�	[�e�m�i��	����%�"E�h�p�x���
������԰����&�
3�>�E�a�&p�$����ͱ���в(�8�4I��~���&��'� 	�*�0�9�E�
V�d�����������ҵ,�(�8�>�0^���/��Ѷ���	���'#�6K�7����շh�%U�	{�������Bʸ!
�/�F�e�m�v��������ǹڹ��#�	5�	?�	I�9S�	��0���Ⱥv�����
ƻ	Ի޻��
�,%�R�Z�s�#�� ��#׼"���&$�)K�$u�#����Ͻ"��.$� S�t�!����'Ӿ��	��(2�([�.�����b�k�q�������	����%�����2�7�=�O�k���&��!��
�(�!B�"d���	��������#��'�:�Q�e�%�&��"��#���%3�Y�w��������������'<�
d�r������������������"�;�Z�w���3������&�,3�$`�%����������������������� �$�43� h� ������#����6�S�d�@t����r�q��$�'�3�B�&Z�$����!��	��	��	����
���
:�E�%U�){���$������ �6�0O�
��	��������)����
����
3�>�\�
z���
��������
����
��	��"�:�N�V�\�r�������	����	������3�5�B�X�o�w�����
��������(��	�)�
8�C�
S�a�v������������	�
�(�7�J�V� b���
��������������	�
�	�&�8�	?�I�g�y�����
����������3��1�C�Z�u�|�����	������������	��
�����	�&�9�	L�V�_�s�����������������������
 �+�7�	N�X�a�p�x���	���������������� ��"�A�H�_�o�	���%��������
��!
�	,�6�I�V�^�j�y�����������	��	���	
�&�>�X�l�t���������&�����0�G�^�g�}����x����������������"�FA�	��������%�����&�.3�b�������"�������������<�	L�	V�3`�-��	����%����1�A�+\�m����Z�*g�7��������C�BF���������������
��.�@�O�_�n�����������������,�=�M�]�v��������������
�%�6�F�W�^�o���
��"�����������% �,F�/s�-��A��2�CF�D��1��3�?5�%u�>��3��/�3>�4r�2��5��7�5H�1~�:��-���E9�%�,��E��5�6N�8��6��"���.8�/g�+��5��3��-�3M�%��%��'��'��#�"A�3d�1��4��6��06�-g�;��$��0��3'�1[���A��+��.�/D�-t�I��!�(�%7�7]�8��%�0�;%�6a�'��$��/�5�,K�x���������
����2�"C� f�5����'�
����:�Y�m���������������*�?�O�
`�k��������
���� ;�\�p�������������#(�L�e�Tj�S��"�6�L�R�Y�n�~����������
�*� �7�H�"a����������$.
S@^%��
��,@V m#�����/GgzA��
�&�	!(4EK]!d����(�;V_r+��
�����\z��4��8R:f��-�0�(:4-o�.�+�W3m��	�%�&�	&	I=	�	�	 �	�	�	�	
6
L
)i
�
'�
#�
.�
@ a���F�8��<���'
C)
m

�
�
�
3�
DKXm����4� 0QXw2�� �3�'>DV_"x6�
���


-
;
I
W
e
s
�
��
�
�
�
�
���
$1>KOtj��!�+B	X^b���2�

+BOj+p�	��.��-B^{�.��3�!A%Nt|����/� "<#_�J���!
<J_p(����	���*71iy���.�V�M^r{"�
�����?ER<���+�2L.]�
������
�-B Ef�'����
�R�=WU����
�
 -Njv�����/� 1 N ] q � � � 
� � � !� !!(!?!D!M!_!w!-�!�!��!�"�"
�" �"�"�#&�#�#$ $$E$%K$q$7�$E�$%#%
6%D%J%W%k%�%�%3�%)�%&7&Q&j&v&�&&�&#�&#�&''$'
L'Z'k'~'�'�'
�'�'�'�'�'((2(;(N(
f(q(�(�(�(�(�(�(�(�())2)>)J)Z)j)�)�)^�)	**&*-*=*L*f*�*�*�*�*�*%�*�*+++.+@+5_+@�+�+�+ ,#,(*,S, p,�,�,�,�,�,
�,---.-07-@h-�-�-�-+�-�-&�-!.2.$;.j`.�/#�/�/$0''0O0V0^0d00!�0&�0�0�011-1A1Z1f1n1�1'�1$�1�1*2$,2�Q2�203GD30�3q�3�/4'�465#95]5	a5k5x5�5'�5�5�5!�5�56+60;64l6�6)�6>�67267i7z7�7�7�7(�74�7F8HG8.�8"�8��81t9
�9�9 �9�9F�90D:0u:-�:
�:	�:
�:&�:;0;I;^;r;�;%�;�;�;�;<A<a<:j<��< �="�=�=�=�=�=.>#5>Y>=l>	�>�>'�>)�>&$?7K?-�?�?)�?'�?$
@&/@V@!k@+�@#�@3�@3A-EA3sA"�A.�A�AB,B3DB4xB2�B��B	�C�C.�C�C�C�C
D#D<0DmD#�D�D�D	�D�D�D)E;E,XE#�E�E!�E(�E"F!6FXF	pF*zF�F#�F,�F-G,?GlG%�G*�G+�G'	H01H5bH3�H&�H�H%I,I LI&mI�I�I	�I!�I7�I
J%J<JPJWJcJtJ)�J(�J*�JK'K(4K&]K"�K�K4�K#�K"L5:L&pL)�L*�L$�LMMM&M-M4M;MBMIMPM`MxM
{MA�M!�M!�MN#N!@N-bN�N �N�N�N[�N����'�j����1�Ul�q.yY�CPb�����U�}>�r9������A[�����^y��	�F��p���
b?�N9Z����/L�;:��!�4U��4�r^����1:_�9��_S�~�iM���k�V��H�#ie$���T�x27��b���g�;����R���*�I�F���R����q�)}&�oV�,�v��W�����R?����=m:�#{:7'�zD*"+�s>@}O C/�a�rf�GJ|��)<�+i?U-����!��k��Zl����jJ$��gl�s0��^�!q�Z[�E�������K�B�k���(r�� �����z����s�t�<�o�%t]<�? �w�:Bc@wqH��~J�nJgN�h^�}�v��F�0������NDv$�~If��g���o���E{4[�XdQmK�����6�%"�����d��g����A��������*=�k�w�O
��������W#a���P2\
����i|����?����T
x2k���!5e5�Y^6�Pa-�}L���f�����6+;A5Z`����X�T
��Ai��O��[&�"��c3���zn��'l�V��Nt�3�]�W��fu�S���dH�&��@|����bSe;.��L�Fm�A�n��� J�S�{RY���0�|�-��������V�RG����cFX68�fQ��_x��d1%��<���B,/D�o~
o�
`�={��S)p�M���Ohv��
sPZ����+�`����������1��5���@�hCuO��uL�Q�����{`e-�=�Kb2�����v���L�].�\�(G�u(����E��9�U�G*��
1��	��������N>����5�mj2#]VK��tmw�M8���xz�)7BI�cY�G�C���l���D	d��9Ej��`�%"�)�|I;��y'�p����I�\ ����wH�����8>��/7��%r�+��(���*�����j	'>-�P	�#X��������������h��(��K�]=u6HC�8_heyY\��,a������~��0��"M�p3$�sE��x0Qa.T$XWqn�W���������pc\�&,��8Q&�
7<,_��/�@nt���z��4�����3y�����[��D��3��B��.T�4!M����
Failed while close:
%s

Please send any bug reports (including the output of 'mc -V')
as tickets at www.midnight-commander.org
 %s%s file error Total: %s  Total: %s/%s  with source mask:"%s"
and
"%s"
are the same directory"%s"
and
"%s"
are the same file"%s" is a directory"%s" is not a regular file%.2f KB/s%.2f MB/s%b %e  %Y%b %e %H:%M%d:%02d.%02d%ld B/s%ld replacements made%o %d %f%m%o %f%n"%s"%m%s
doesn't look like a tar archive.%s contains duplicate entries! Skipping!%s file error%s in %d file%s in %d files%s is not a directory
%s opening remote file %s%s removing remote file %s%s renaming files
%s: Warning: file %s not found
%s: done.%s: failure&Abort&Above&Access time&Active VFS list&Add current&Add new&Add word&Advanced chown&Again&All charsets&Always use ftp proxy:&Appearance...&Append&Background&Background jobs&Backspace through tabs&Backwards&Beginning&Below&Brief file list:&Cancel&Cancel quit&Case sensitive&Chdir&Close&Command&Compare directories&Configuration...&Copy&Cut to clipfile&Decimal offset&Delete&Directory tree&Discard&Dismiss&Display bits...&Do backups with following extension:&Do not change&Drop down menus&Dynamic paragraphing&Edit&Edit - F4&Encoding...&End&Equal split&External formatter&Fake half tabs&Fast dir reload&Fastest (Assume large files)&File&Files only&Filter...&Filtered view&Find all&Find declaration&Find file&Find recursively&Flush bookmarks&Format paragraph&Free VFSs now&Full 8 bits output&Full file list&General...&Go to line...&Grab lock&Group undo&Horizontal&ISO 8859-1&Ignore case&Ignore lock&Info&Inode&Insert&Insert file...&Invert selection&Keep&Keybar visible&Kill&Layout...&Left&Line number&Link&List...&Listing format edit&Listing mode...&Local&Long file list&Macintosh format (CR)&Mail...&Mark columns&Marked all&Menu file&Menubar visible&Minimal (Find a smaller set of change)&Mkdir&Modify time&Mouse page scrolling&Move&Name&Never&New&Next&Next bookmark&No&None&OK&Open file...&Options&Overwrite&Panel options...&Paste output of...&Permissions&Preallocate space&Prev bookmark&Previous&Quick&Quick cd&Quick save&Quick view&Quit&Redo&Refresh&Refresh screen&Reget&Remove&Rename/Move&Replace&Replace...&Rescan&Resize&Resume&Retry&Return does autoindent&Reverse&Right&Safe save&Save&Save setup&Search&Search...&Set&Show free space&Size&Size only&Skip&Sort order...&Sort...&Stable symlinks&Start/Stop record macro&Stop&Symlink&System Wide&System wide&Thorough&Toggle bookmark&Toggle fullscreen&Toggle ins/overw&Toggle line state&Tree&UTF-8 output&Undelete files (ext2fs only)&Undo&Unix format (LF)&Unsorted&Up&Update&Use ~/.netrc&User&User defined:&User menu&User menu...&Using shell patterns&Verbose operation&Version&Vertical&View&View - F3&Virtual FS...&Visible trailing spaces&Whole words&Window&Windows/DOS format (CR LF)&XTerm window title&Yes&read by owner&write by owner'%s' is not a symbolic link(chdir first)(stalled)(strict rfc959)* on keypad+ on keypad+number-  < No translation >- on keypad--colors KEYWORD={FORE},{BACK},{ATTR}:KEYWORD2=...

{FORE}, {BACK} and {ATTR} can be omitted, and the default will be used

 Keywords:
   Global:       errors, disabled, reverse, gauge, header
                 input, inputmark, inputunchanged, commandlinemark
                 bbarhotkey, bbarbutton, statusbar
   File display: normal, selected, marked, markselect
   Dialog boxes: dnormal, dfocus, dhotnormal, dhotfocus, errdhotnormal,
                 errdhotfocus
   Menus:        menunormal, menuhot, menusel, menuhotsel, menuinactive
   Popup menus:  pmenunormal, pmenusel, pmenutitle
   Editor:       editnormal, editbold, editmarked, editwhitespace,
                 editlinestate, editbg, editframe, editframeactive
                 editframedrag
   Viewer:       viewnormal,viewbold, viewunderline, viewselected
   Help:         helpnormal, helpitalic, helpbold, helplink, helpslink
/ on keypad7 &bits7-bit ASCII< Auto >< Default >< Reload Current Syntax ><Unknown group><Unknown user><readlink failed>A file already exists with this nameA user friendly text editor
written for the Midnight Commander.A&bout...A&llA&ll charsetsA&ppendA&sk new file nameA&uto save panels setupA&uto save setupA1 keyAborted transfer would be successful.Aborting transfer...AboutAccessed:   %sAccount:Active VFS directoriesAdd to external panelizeAdd to hotlistAltAlwa&ysAmerican EnglishAmpersandAn error occurred while migrating user settings: %sApostropheAppearanceAre you sure you want to remove entry "%s"?Arguments parse error!AsteriskAt signAuthentication failedAuto m&enusBack from &declarationBackTab/S-tabBackground jobsBackground process errorBackground process sent us a request for more arguments
than we can handle.Background process:Background process:
Directory "%s" not empty.
Delete it recursively?Background process: File existsBackground protocol errorBackslash keyBackspaceBlock SizeBlock is large, you may not be able to undo this actionBoth panels should be in the listing mode
to use this commandBretonBritish EnglishBuilt with GLib %d.%d.%d
ButtonBar|AsciiButtonBar|CopyButtonBar|DeleteButtonBar|DynamcButtonBar|EditButtonBar|ForgetButtonBar|FormatButtonBar|GotoButtonBar|HelpButtonBar|HexButtonBar|HxSrchButtonBar|IndexButtonBar|MarkButtonBar|MenuButtonBar|MergeButtonBar|MkdirButtonBar|MoveButtonBar|OptionsButtonBar|ParseButtonBar|PrevButtonBar|PullDnButtonBar|QuitButtonBar|RawButtonBar|RenMovButtonBar|ReplacButtonBar|RescanButtonBar|RmdirButtonBar|SaveButtonBar|SearchButtonBar|StaticButtonBar|UnWrapButtonBar|UnformButtonBar|ViewButtonBar|WrapC&hange timeC&heck wordC&hmodC&lear markedC&ompare filesC&onfirmation...C&ontinueC&ursor after inserted blockC1 keyCache directory:Canadian EnglishCancelCannot accept this keyCannot change directoryCannot chdir to "%s"Cannot chdir to "%s"
%sCannot chmod "%s"
%sCannot chmod target file "%s"
%sCannot chown "%s"
%sCannot chown target directory "%s"
%sCannot chown target file "%s"
%sCannot close source file "%s"
%sCannot close target file "%s"
%sCannot copy cyclic symbolic link
"%s"Cannot create %s directoryCannot create backup file
%s%s
%sCannot create pipe descriptorCannot create pipe streamsCannot create special file "%s"
%sCannot create target directory "%s"
%sCannot create target file "%s"
%sCannot create target symlink "%s"
%sCannot create temporary command file
%sCannot create temporary diff file
%sCannot create temporary directory %s: %s
Cannot create temporary merge file
%sCannot delete file "%s"
%sCannot execute commandCannot execute commands on non-local filesystemsCannot execute sort commandCannot fetch a local copy of %sCannot fetch a local copy of /ftp://some.host/editme.txtCannot find node %s in help fileCannot fstat source file "%s"
%sCannot fstat target file "%s"
%sCannot get size/permissions for %sCannot insert fileCannot invoke command.Cannot load block bitmap from:
%sCannot load inode bitmap from:
%sCannot make the hardlinkCannot move directory "%s" to "%s"
%sCannot move file "%s" to "%s"
%sCannot open "%s"
%sCannot open "%s" in parse mode
%sCannot open %s archive
%sCannot open %s for readingCannot open cpio archive
%sCannot open file "%s"Cannot open file %sCannot open file %s
%sCannot open file for writing: %sCannot open named pipe %s
Cannot open pipe for reading: %sCannot open pipe for writing: %sCannot open source file "%s"
%sCannot open tar archive
%sCannot open the %s file for writing:
%s
Cannot operate on ".."!Cannot overwrite directory "%s"Cannot overwrite directory "%s"
%sCannot overwrite file "%s"
%sCannot parse:Cannot preallocate space for target file "%s"
%sCannot read directory contentsCannot read source link "%s"
%sCannot remove directory "%s"
%sCannot remove file "%s"
%sCannot run external panelize in a non-local directoryCannot save fileCannot save file %s:
%sCannot save file:
%sCannot save: destination is not a regular fileCannot set correct permissions for directory %s
Cannot stat "%s"
%sCannot stat file "%s"
%sCannot stat source directory "%s"
%sCannot stat source file "%s"
%sCannot stat the destination
%sCannot translate from %s to %sCannot view: not a regular fileCannot write target file "%s"
%sCannot write to the %s file:
%s
CaretCas&e sensitiveCase &insensitiveCase sens&itiveCd follows lin&ksCh&ownChange &toChange line breaks to:Change spelling &language...Changed:    %sChanges to file lostCheck &POSIX new lineCheck input data! Some of parameters are NULL!Check wordChild died unexpectedlyChmod commandChoose codepageChoose syntax highlightingChown advanced commandChown commandClassic pro&gressbarClose fileCo&mplete: show allCo&py to clipfileCollect completionsColonColor optionsCommaCommandCommand &historyCommand &promptCompare directoriesCompletion/M-tabCompute tota&lsCon&tinueConfig directory:Configure optionsConfir&m before savingConfirm replaceConfirm save file: "%s"ConfirmationConfirmation|&DeleteConfirmation|&ExecuteConfirmation|&History cleanupConfirmation|Di&rectory hotlist deleteConfirmation|E&xitConfirmation|O&verwriteConsole outputContent:Continue from beginning?Cop&yCop&y to file...Copies toCopy "%s" directory to:Copy to clipboardCorrupted cpio header encountered in
%sCreate a new DirectoryCtrlCurrent text was modified without a file save.
Continue discards these changesCurrent text was modified without a file save.
Continue discards these changes.Cursor be&yond end of lineCut to clipboardCzechDanishData directory:Data types:DebugDeleteDelete %s?Delete macr&o...Delete macroDelete on keypadDeletingDestination "%s" must be a directory
%sDev. type: major %lu, minor %luDevice:     %sDi&rectory hotlistDi&ve into subdir if existsDialogTitle|CopyDialogTitle|DeleteDialogTitle|History cleanupDialogTitle|MoveDiff OptionsDiff algorithmDiff extra optionsDiff viewer: invalid modeDiff:Directory "%s" not empty.
Delete it recursively?Directory %s is not owned by you
Directory cache expired for %sDirectory hotlistDirectory labelDirectory label:Directory pathDirectory path:Directory scanningDirectory treeDisable X11 supportDisable mouse support in text versionDisables subshell supportDisplay bitsDisplays the current versionDo you really want to execute?Do you really want to quit the Midnight Commander?Do you want clean this history?Dollar signDomain:Don't load definitions of key bindings from file, use defaultsDotDown arrowDown arrow keypadDup failedDutchE&xitE&xtensionE&xternal panelizeERROR:ETA %sEditEdit &extension fileEdit &menu fileEdit Save ModeEdit fileEdit filesEdit hi&ghlighting group fileEdit is disabledEdit s&ymlinkEdit symlinkEdit: Editor optionsEna&ble ignore directories:Enables subshell support (default)Encod&ing...End keyEnd on keypadEnglishEnterEnter command label:Enter device (without /dev/) to undelete
files on: (F1 for details)Enter directory name:Enter file name:Enter line:Enter machine name (F1 for details):Enter on keypadEnter replacement string:Enter search string:Enter shell command(s):Enter sort options (see manpage) separated by whitespace:EqualErrorError %s creating directory %sError %s removing directory %sError calling programError dup'ing old error pipeError in file %s on line %dError reading %sError reading from pipe: %sError reported after abort.Error while closing the file:
%s
Data may have been written or notError writing to pipe: %sEsc key modeEscapeEsperantoEvent system already initializedEvent system not initializedExclamation markExecutable &firstExisting filename (filename symlink will point to):Existing: %s, size %sExt2lib errorExtension file editExternal commandExternal panelizeF&ull 8 bits inputFATAL: not a directory:FT&P link...FTP anonymous password:FTP directory cache timeout (sec):FTP to machineFTP: Account required for user %sFTP: Password required for %sFailed to initialize event systemFailed to read data from child stdout:
%sFailed to run:
%s
False:FaroeseFileFile "%s" is already being edited.
User: %s
Process ID: %dFile "%s" is too large.
Open it anyway?File %s is not owned by root or you or is world writable.
Using it may compromise your securityFile %s was modified.
Save before close?File &typesFile existsFile extension handlers:File has hard-links. Detach before saving?File highlightFile listin&gFile lockedFile name:File operationsFile was modified. Save with exit?File(s) was modified. Save with exit?File: %sFileOperation|CopyFileOperation|DeleteFileOperation|MoveFilename:Files processed: %zuFiles processed: %zu/%zuFiles tagged, want to cd?Filesystem: %sFill tabs with &spacesFilterFilter command and arguments:Filtered viewFind *.orig after patchingFind FileFind SUID and SGID programsFind rejects after patchingFinishedFir&st hitFlagFollow &linksFor&matFor&ward to declarationForces xterm featuresFormat error on file Extensions FileFree nodes:Free space: %s/%s (%d%%)FrenchFunction key 1Function key 10Function key 11Function key 12Function key 13Function key 14Function key 15Function key 16Function key 17Function key 18Function key 19Function key 2Function key 20Function key 21Function key 22Function key 23Function key 24Function key 3Function key 4Function key 5Function key 6Function key 7Function key 8Function key 9GIDGNU Midnight Commander %s
GNU Midnight Commander is already
running on this terminal.
Subshell support will be disabled.GermanGetting fileGo to matching &bracketGotoGoto lineGoto line (left)Goto line (right)Great thanGreat! You have a complete terminal database!
All your keys work well.GreekGrepping in %sGroupGroup "%s" is not empty.
Remove it?Group nameGroup name:H&intbar visibleHe&xadecimalHe&xadecimal offsetHelpHelp file format error
Highlighting groups file editHistoryHomeHome directory path is not absoluteHome on keypadHotlist LoadIf &size differsIgnore &space changeIgnore all &whitespaceIgnore tab &expansionIn se&lectionIncomplete file was retrieved. Keep it?Inconsistent extfs archiveInconsistent hardlinks of
%s
in cpio archive
%sInconsistent tar archiveInformationInput / display codepage:InsertInsert &date/timeInsert &literal...Insert fileInsert literalInsert on keypadInternal bug: Double start of link areaInternal error:Invalid source pattern '%s'Invalid token number %dInvalid valueIt seems that all your keys already
work fine. That's great.ItalianL&ynx-like motionLabel for "%s":LanguageLaunches the file viewer on a fileLayoutLearn &keys...Learn keysLeft arrowLeft arrow keypadLeft braceLeft bracketLeft parenthesisLess thanLinkLink %s to:Links:      %dListing modeLoadLoad definitions of key bindings from specified fileLoad fileLoad syntax fileLoading...Loading: %3d%%Location:   %Xh:%XhLog ftp dialog to specified fileMC was unable to write %s file,
your old hotlist entries were not deletedMa&rk moves downMacro not deletedMailMain optionsMalformed regular expressionMark &allMemory exhausted!Menu editMi&x all filesMidnight Commander %sMidnight Commander is being shut down.
Save modified file %s?Midnight Commander is being shut down.
Save modified file(s)?Midnight Commander is being shut down.
Save modified file?MinusMisspelledMkdi&r autonameMo&veMode:       %s (%04o)Modified git filesModified:   %sMore parsing errors will be ignored.Move "%s" directory to:Moving %sNameName of new group:Name:NavigationNew     : %s, size %sNew &entryNew &groupNew hotlist entryNew hotlist groupNlNo arguments given to the viewer.No node informationNo space informationNo suitable entries found in %sNo&rmalNoNameNon&eNorwegianNot an xterm or Linux console;
the panels cannot be toggled.Not implemented yetNum of replace tokens not equal to num of found tokensNumber sign #OKOn dum&b terminalsOpen filesOther 8 bitOther commandOther optionsOutput lines:Overwrite all targets?Overwrite this target?OwnerOwner nameOwner name:Owner:      %s/%sPa&ge scrollingPa&ste from clipfilePage DownPage Down keypadPage UpPage Up keypadPane&lizePanel optionsPanel splitPaneli&zePanelizePanels:ParameterPassword for \\%s\%sPassword:Paste output of external commandPause after runPe&rcentsPercent signPermPermissionPermissions (octal):Pers&istent selectionPipePipe close failedPipe failedPlease press the %s
and then wait until this message disappears.

Then, press it again to see if OK appears
next to its button.

If you want to escape, press a single Escape key
and wait as well.PlusPolishPortuguesePremature end of cpio archive
%sPreserve &attributesPress all the keys mentioned here. After you have done it, check
which keys are not marked with OK. Press space on the missing
key, or click with the mouse to define it. Move around with Tab.Press any key to continue...Press any key:Press macro hotkey:Press the macro's new hotkey:PrimePrint configure optionsPrint data directoryPrint extended info about used data directoriesPrint last working directory to specified fileQuestion markQuick cdQuick searchQuitQuotation markRe&gular expressionRe&verse files onlyReading failedRecord/Repeat &actionsReget failed, about to overwrite fileRegular expression errorRelative symlin&kRepeat last commandsRepeat times:ReplaceReplace with:Request to run in color modeRequests to run in black and whiteResets soft keys on HP terminalsResolving symlink...Right arrowRight arrow keypadRight braceRight bracketRight parenthesisRomanianRotating d&ashRun sortRunningRussianS&FTP link...S&et markedS&hell link...S&hell patternsS&ingle pressS&kipS&kip hiddenS&pell checkS&uspendS&wap panelsS&yntax fileSFTP to machineSM&B link...SMB authenticationSMB link to machineSUB-DIRSYMLINKSa&fe deleteSave &as...Save &mode...Save AsSave asSave blockSave fileSave file &positionSave macroScreen lis&tScreen size %dx%d is not supported.
Check the TERM environment variable.
ScreensSea&rch for contentSearchSearch &againSearch doneSearch is disabledSearch string not foundSearchingSearching %sSearching %s: %3d%%SelectSelect &groupSelect compare method:Select languageSemicolonSet &allSet &groupsSet &usersSet debug levelSet expression for filtering filenamesSet initial line number for the internal editorSetupSetup saved to %sShell link to machineShiftShow &backup filesShow &hidden filesShow directory s&izesShow mc with specified skinShow mi&ni-statusSimple s&wapSizeSize:       %sSki&p allSkin:SkinsSlash keySlovakSorry, I could not put the job in backgroundSorry, we cannot do password authenticated connections for now.SortSort blockSort orderSort returned non-zero: %sSourceSource "%s" is not a directory
%sSpace keySpanishSpecifies a color configurationStandard Colors:
   black, gray, red, brightred, green, brightgreen, brown,
   yellow, blue, brightblue, magenta, brightmagenta, cyan,
   brightcyan, lightgray and white

Extended colors, when 256 colors are available:
   color16 to color255, or rgb000 to rgb555 and gray0 to gray23

Attributes:
   bold, italic, underline, reverse, blink; append more with '+'
Start at:Starting linear transfer...StoppedStrip &trailing carriage returnSubgroup - press ENTER to see listSubjectSuggestSwedishSwitch &panels on/offSymbolic linkSymbolic link filename:Symlink '%s' points to:Synta&x highlightingSyntax &highlighting...Syntax file editSystem dataTab keyTab spacing:TabulationTargetTarget file already exists!Teach me a keyTemporary files will be created in %s
Temporary files will not be created
Terminal optionsThe %%var macro has no defaultThe %%var macro has no variableThe Commander can't change to the directory that
the subshell claims you are in. Perhaps you have
deleted your working directory, or given yourself
extra access permissions with the "su" command?The Midnight CommanderThe TERM environment variable is unset!
The file has been modified in the meantime. Save anyway?The file you are saving does not end with a newline.The format of the %s file has changed with version 3.0. You may either want to copy it from %smc.ext or use that file as an example of how to write it.The format of the %smc.ext file has changed with version 3.0. It seems that the installation failed. Please fetch a fresh copy from the Midnight Commander package.The shell is already running a commandThe shell is still active. Quit anyway?This function is not implementedTildaTime: %sTime: %s %sTime: %s %s (%s)Time: %s (%s)Timeout for freeing VFSs (sec):Timeout:ToTo run on slow terminalsTo&ggle markToggle s&yntax highlightingTop level groupTries to use an old highlight mouse trackingTries to use termcap instead of terminfoTrue:Two files are needed to compareTwo files are required to envoke the diffviewer.Type &writer wrapType 'exit' to return to the Midnight CommanderType:       %sU&nselect groupUIDUP--DIRUkrainianUnable to create event '%s'!Unable to create group '%s' for events!Unable to load '%s' skin.
Default skin has been loadedUnable to parse '%s' skin.
Default skin has been loadedUnable to save setup to %sUnable to save to fileUnable to use '%s' skin with 256 colors support
on non-256 colors terminal.
Default skin has been loadedUndelete files on an ext2 file systemUnderlineUnderstrikeUnexpected EOF on archive fileUnexpected end of file
%sUnexpected error in select() reading data from a child process:
%sUnexpected error in waitpid():
%sUnknown error in childUnknown tag on display format:Unmar&kUnselectUp arrowUp arrow keypadUse &passive modeUse SI si&ze unitsUse internal edi&tUse internal vie&wUse panel sort mo&deUse passive mode over pro&xyUse stickchars to drawUser &mini statusUser dataUser menuUser nameUser supplied format looks invalid, reverting to default.Username:Using the S-Lang library with terminfo database
Using the fast reload option may not reflect the exact
directory contents. In this case you'll need to do a
manual reload of the directory. See the man page for
the details.Using the ncurses library
Using the ncursesw library
VFS plugins and scripts:Vie&w file...View fileView: Virtual File System SettingVirtual File Systems:Visible &tabsWaiting to retry... %d (Control-G to cancel)WarningWarning -- ignoring fileWarning: Cannot change to %s.
Warning: Invalid flag %c in %s:
%s
Warning: Invalid line in %s:
%s
Warning: cannot load codepages listWarning: cannot open %s directory
WelshWhich extension file you want to edit?Which highlighting file you want to edit?Which menu file do you want to edit?Which syntax file you want to edit?Wil&dcard searchWith builtin Editor
With internationalization support
With mouse support on xterm
With mouse support on xterm and Linux console
With multiple codepages support
With optional subshell support
With subshell support as default
With support for X11 events
With support for background operations
Word wrap line length:Wrap modeYou have entered "%s"You have to chdir to extract files firstYou must first highlight a block of textYour old settings were migrated from %s
to %s
Your old settings were migrated from %s
to Freedesktop recommended dirs.
To get more info, please visit
http://standards.freedesktop.org/basedir-spec/basedir-spec-latest.html[NoName][dev][this_dir] [other_panel_dir]cdcolumnsdirectoriesdirectorye&xecute/search by owneredit symlink, unable to remove %s: %sedit symlink: %sexecu&te/search by groupexecute/searc&h by othersfilefilesfiles/directoriesfish: Disconnecting from %sfish: Getting host info...fish: Handshaking version...fish: Local read failed, sending zerosfish: Password is required for %sfish: Reading directory %s...fish: Sending initial line...fish: Sending password...fish: Waiting for initial line...fish: store %s: sending command...fish: storing fileftpfs: %sftpfs: CWD failed.ftpfs: Disconnecting from %sftpfs: Invalid host name.ftpfs: Login incorrect for user %s ftpfs: Reading FTP directory %s... %s%sftpfs: abort error: %sftpfs: abort failedftpfs: aborting transfer.ftpfs: connection interrupted by userftpfs: connection to server failed: %sftpfs: could not create socket: %sftpfs: could not setup passive modeftpfs: couldn't resolve symlinkftpfs: failed; nowhere to fallback toftpfs: invalid address familyftpfs: logged inftpfs: making connection to %sftpfs: sending login nameftpfs: sending user accountftpfs: sending user passwordftpfs: storing filegrouplink: %smail -s <subject> -c <cc> <to>no more memory while reallocating arraynon-local vfsnot enough memoryopen_inode_scan: %dotherownerrea&d by groupread &by othersreconnect to %s failedset &group ID on executionset &user ID on executionsftp: %ssftp: (Ctrl-G break) Listing... %ssftp: Enter passphrase for %s sftp: Enter password for %s sftp: Invalid host name.sftp: Listing done.sftp: No file handler data present for reading filesftp: Passphrase is empty.sftp: Password is empty.sftp: Unable to get current user name.sftp: an error occurred while reading %s: %ssftp: connection interrupted by usersftp: connection to server failed: %ssftp: making connection to %ssort|asort|esort|hsort|isort|msort|nsort|ssort|usort|vstick&y bitsymlink: %sto:undelfs: errorundelfs: loading deleted files information %d inodesundelfs: reading block bitmap...undelfs: reading inode bitmap...vfs_info is not fs!while allocating block bufferwhile calling ext2_block_iterate %dwhile doing inode scan %dwhile iterating over blockswhile starting inode scan %dwr&ite by otherswrite by grou&p~/.netrc file has incorrect mode
Remove password or correct modeProject-Id-Version: Midnight Commander
Report-Msgid-Bugs-To: http://www.midnight-commander.org/
POT-Creation-Date: 2017-03-04 18:55+0100
PO-Revision-Date: 2017-02-25 09:22+0000
Last-Translator: Piotr Drąg <piotrdrag@gmail.com>
Language-Team: Galician (http://www.transifex.com/mc/mc/language/gl/)
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);

Non foi posíbel pechar:
%s

Envíe calquera informe de fallo (incluíndo a saída de «mc -V»)
como un ticket a www.midnight-commander.org
Produciuse un erro no ficheiro  %s%s Total: %s  Total: %s/%s  con máscara de orixe:«%s»
e
«%s»
son o mesmo directorio«%s»
e
«%s»
son o mesmo ficheiro«%s» é un directorio«%s» non é un ficheiro regular%.2f KB/s%.2f MB/s%e %b  %Y%e %b %H:%M%d:%02d.%02d%ld B/s %ld substitucións feitas%o %d %f%m%o %f%n«%s»%m%s
non parece un arquivo de tipo tar.%s conten entradas duplicadas! Ignorando!Erro no ficheiro %s%s en %d ficheiro%s en %d ficheiros%s non é un directorio
%s abrindo ficheiro remoto %s%s eliminando ficheiro remoto %s%s renomeando ficheiros
%s: Aviso: non é posíbel atopar o ficheiro %s
%s: feito.%s: fallo&Interromper&ArribaData de &AccesoLista activa de ficheiros &Virtuais (VFS)e&Ngadir actual&Engadir novo&Engadir palabrac&Ambiar propietario e permisos&Outra vez&Todos os xogos de caracteresEmpregar &Sempre o proxy ftp:&Aparencia...Engadir ao &FinalEn 2º &Plano&Procesos en 2º plano&Eliminar en tabulacións&Cara atrás&Principioa&BaixoLista &Breve:&Cancelar&Cancelar saída&Distinguir maiúsculas&Cambiar directorio&Pechar&Orde&Comparar directorios&Configuración...&Copiar&Cortar ao portapapeisDesprazamento &Decimal&EliminarÁrbore de &Directorios&Desbotar&Ignorar&Mostrar bits...&Facer copias de seguranza coa seguinte extensión:&Sen cambiosMenús &DespregábeisParagrafado &Dinámico&Editar&Editar - F4&Codificando...&Finalsi&MetricoFormatador e&Xterno&Finxir medias tabulaciónsRe&Carga rápida de directoriosMáis &Rápido (asume ficheiros grandes)&FicheiroSó &Ficheiros&Filtro...Vista &FiltradaBuscar &TodosBuscar &DeclaraciónBuscar &Ficheiro&Busca recursivaLimpar &Todos os marcadoresDar formato ao parágra&FoLiberar os V&FS agoraSaída &Completa de 8 bitsLista &Completa&Xeral...&Ir á liña Obter &BloqueoDesfacer no &Grupo&Horizontal&ISO 8859-1&Ignorar maiúsculas/minúsculas&Ignorar bloqueo&Informaciónnodo-&I&Inserir&Inserir ficheiro...&Inverter a selección&ManterMostrar &Barra de teclas&Eliminar&Presentación...&EsquerdaNúmero de &Liña&Ligar&Lista...Edición do formato de &ListaModo de &Lista...&LocalLista &LongaFormato &Macintosh (CR)&Correo...&Marcar columnasTodos &MarcadosFicheiro de &MenúBarra do &Menú visíbel&Mínimo (busca o conxunto máis pequeno de cambio)Crear &DirectorioData de &ModificaciónAvance de páxina co &Rato&Mover&Nome&Nunca&Novo&Seguinte&Seguinte marcador&Non&Ningún&Aceptar&Abrir ficheiro...&Opciónss&ObrescribirOpcións dos &Paneis...&Pegar a saída de...&Permisos&Preasignar espazoMarcador ante&Rior&Anterior&Rápidoca&Mbiar directorioGardar &RápidoVista &Rápida&Sair&RefacerActuali&Zar&Actualizar a pantalla&Reintentar&Quitar&Renomear/MoverSubstituí&RSubstituí&R...Actuali&Zar&RedimensionarContinua&R&Reintentar&Volver a autosangradoInve&Rter&DereitaGardar &Seguro&Gardar&Gardar configuración&Busca&Busca...A&Plicar&Amosar o espazo dispoñíbel&Tamaño&Só tamaño&Omitir&Ordenar...&Ordenar...Ligazóns simbólicas e&StábeisIniciar/parar gravación da &Macro&DeterLigazóns &SimbólicasTodo o &SistemaTodo o &SistemaComple&ToAl&Ternar o marcadorAl&Ternar o modo de pantalla completaAlternar &InserciónAlternar &Liña de estadoÁr&BoreSaída &UTF-8rec&Uperar ficheiros (só ext2fs)&DesfacerFormato &Unix (LF)&Sen ordenar&Arriba&Actualizar&Usar ~/.netrc&UsuarioDefinida polo &Usuario:Menú de &UsuarioMenú de &Usuario...&Usando modelos de consola&Operación detallada&Versión&Vertical&Vista&Ver - F3Sistema de ficheiros &Virtual (VFS)...Espazos finais &Visíbeis&Palabras completas&XanelaFormato &Windows/DOS (CR LF)Titulo da xanela &Xterm&Si&Lido polo propietarioesc&rito polo propietario«%s» non é unha ligazón simbólica(primeiro chdir)(atoado)(rfc959 estrito)* no teclado numérico+ no teclado numérico+número-  < Sen tradución >- no teclado numérico--colors CONTEXTO={FRENTE},{FONDO},{ATRIBUTOS}:CONTEXTO2=...

{FRENTE}, {FONDO} e {ATRIBUTOS}poden omitirse, empregarase o valor predeterminado

 Contextos:
   Globais:            errors, disabled, reverse, gauge, header
                       input, inputmark, inputunchanged, commandlinemark
                       bbarhotkey, bbarbutton, statusbar
   Visor de ficheiros: normal, selected, marked, markselect
   Diálogos:           dnormal, dfocus, dhotnormal, dhotfocus, errdhotnormal,
                       errdhotfocus
   Menús:              menunormal, menuhot, menusel, menuhotsel, menuinactive
   Menús emerxentes:   pmenunormal, pmenusel, pmenutitle
   Editor:             editnormal, editbold, editmarked, editwhitespace,
                       editlinestate, editbg, editframe, editframeactive
                       editframedrag
   Visor:              viewnormal,viewbold, viewunderline, viewselected
   Axuda:              helpnormal, helpitalic, helpbold, helplink, helpslink
/ no teclado numérico7 &bitsASCII (7 bits)< Auto >< Predeterminado >< Recargar a sintaxe actual ><Grupo descoñecido><Usuario descoñecido><fallou readlink>Xa existe un ficheiro con ese nomeUn editor de texto de uso amigábel
escrito para o Midnight Commander.So&Bre...&Todos&Todos os xogos de caracteres&EngadirPre&Guntar polo novo nome de ficheiroConfiguración do &Auto-gardadoConfiguración do &Auto-gardadoTecla «A1»Transferencia interrompida satisfactoriamente.Interrompendo transferencia...SobreAccedido:     %sConta:Directorios virtuais (VFS) activosEngadir a panel externoEngadir a favoritosAlt&SempreInglés americanoEtProduciuse un erro ao migrar a configuración do usuario: %sApostrofoAparenciaEstá seguro de que quere retirar a entrada «%s»?Produciuse un erro ao analizar os argumentos!AsteriscoSímbolo de «en» (at) @Produciuse un fallo de autenticaciónAuto m&Enús&Volver á declaraciónRetroceso/S-tabTraballos en segundo planoProduciuse un erro nun proceso en 2º planoO proceso en 2º plano enviounos unha petición con máis argumentos
dos que estamos preparados para manexar.Procesos en 2º planoProceso en segundo plano:
O directorio «%s» non está baleiro.
Eliminalo recursivamente?Proceso en 2º plano: O ficheiro xa existeProduciuse un erro de protocolo en proceso en 2º plano«\» Barra invertidaRetroceso (<--)Tamaño do bloqueO bloque é moi grande, pode que non se poida desfacer esta acciónAmbos os dous paneis deben estar en modo lista
para usar esta ordeBretónInglés británicoConstruido con GLib %d.%d.%d
ButtonBar|ASCIIButtonBar|CopiarButtonBar|EliminarButtonBar|DinámicoButtonBar|EditarButtonBar|EsquecerButtonBar|FormatoButtonBar|Ir aButtonBar|AxudaButtonBar|HexaButtonBar|BuscaHexaButtonBar|ContidoButtonBar|MarcarButtonBar|MenúButtonBar|MesturarButtonBar|Crear directorioButtonBar|MoverButtonBar|OpciónsButtonBar|AnalizarButtonBar|AnteriorButtonBar|BaixarButtonBar|SaírButtonBar|BrutoButtonBar|Renomear/MoverButtonBar|RemplButtonBar|ActualizarButtonBar|EliminarDirectorioButtonBar|GardarButtonBar|BuscarButtonBar|EstáticoButtonBar|DespregarButtonBar|SenFormatoButtonBar|VerButtonBar|PregarData de &CambioRe&Visar palabrac&Hmod&Limpar marcadosc&Omparar ficheirosc&Onfirmación...c&OntinuarC&ursor despois do bloque inseridoTecla «C1»Directorio de caché:Inglés canadenseCancelarNon se pode aceptar esta teclaNon é posíbel cambiar de directorioNon é posíbel cambiar ao directorio «%s»Non é posíbel cambiar ao directorio «%s»
%sNon é posíbel cambiar permisos de «%s»
%sNon é posíbel cambiar os permisos do ficheiro destino «%s»
%sNon é posíbel cambiar o propietario de «%s»
%sNon é posíbel cambiar os permisos do directorio destino «%s»
%sNon é posíbel cambiar o propietario do ficheiro destino: «%s»
%sNon é posíbel pechar o ficheiro orixe «%s»
%sNon é posíbel pechar o ficheiro destino «%s»
%sNon é posíbel copiar unha ligazón simbólica cíclica
«%s»Non é posíbel crear o directorio %sNon é posíbel crear o ficheiro de copia de seguranza
%s%s
%sNon foi posíbel crear o descritor da canalizaciónNon é posíbel crear a canalización de fluxosNon é posíbel crear o ficheiro especial «%s»
%sNon é posíbel crear o directorio destino «%s»
%sNon é posíbel crear o ficheiro destino «%s»
%sNon é posíbel crear a ligazón simbólica «%s»
%sNon é posíbel crear o ficheiro temporal para ordes
%sNon é posíbel crear o ficheiro temporal «diff»
%sNon é posíbel crear directorio temporal %s: %s
Non é posíbel crear o ficheiro temporal para mesturas
%sNon é posíbel eliminar o ficheiro «%s»
%sNon é posíbel executar a ordeNon é posíbel executar ordes desde sistemas de ficheiros non locaisNon foi posíbel executar «ordenar»Non é posíbel obter unha copia local de %sNon é posíbel obter unha copia local de /ftp://some.host/editme.txtNon é posíbel atopar o nodo %s no ficheiro de axudaNon é posíbel identificar o ficheiro orixe «%s»
%sNon é posíbel identificar o ficheiro destino «%s»
%sNon é posíbel obter tamaño/permisos do ficheiro: %sNon é posíbel inserir o ficheiroNon é posíbel invocar a orde.Non é posíbel cargar mapa de bloques de: 
%sNon é posíbel cargar o mapa de nodo-i de: 
%sNon é posíbel crear a ligazón permanenteNon é posíbel mover o directorio «%s» a «%s»
%sNon é posíbel mover o ficheiro «%s» a «%s»
%sNon é posíbel abrir «%s»
%sNon é posíbel abrir «%s» en modo de análise
%sNon é posíbel abrir o arquivo %s
%sNon é posíbel abrir %s para lecturaNon é posíbel abrir o arquivo cpio
%sNon é posíbel abrir o ficheiro «%s»Non é posíbel abrir o ficheiro %sNon se pode abrir o ficheiro %s
%sNon é posíbel abrir o ficheiro para escritura: %sNon é posíbel abrir a canalización nomeada %s
Non é posíbel abrir canalización para lectura: %sNon é posíbel abrir canalización para escritura: %sNon é posíbel abrir o ficheiro orixe «%s»
%sNon é posíbel abrir arquivos de tipo tar
%sNon é posíbel abrir o ficheiro «%s» para escritura:
%s
Non é posíbel operar sobre «..»!Non é posíbel sobrescribir o directorio «%s»Non é posíbel sobrescribir o directorio «%s»
%sNon é posíbel sobrescribir o ficheiro «%s»
%sNon é posíbel analizar:Non é posíbel reservar espazo para o ficheiro destino «%s»
%sNon é posíbel ler o contido do directorioNon é posíbel ler a ligazón orixe «%s»
%sNon é posíbel eliminar o directorio «%s»
%sNon é posíbel eliminar o ficheiro «%s»
%sNon é posíbel executar a panelización externa nun directorio non localNon é posíbel gardar o ficheiroNon é posíbel gardar o ficheiro %s:
%sNon é posíbel gardar o ficheiro:
%sNon se pode gardar: o destino non é un ficheiro normalNon é posíbel dar permisos axeitados ao directorio %s
Non é posíbel identificar «%s»
%sNon é posíbel identificar o ficheiro «%s»
%sNon é posíbel identificar o directorio de orixe «%s»
%sNon é posíbel identificar o ficheiro orixe «%s»
%sNon é posíbel determinar o destino
%sNon é posíbel converter de %s a %sNon é posíbel ver: non é un ficheiro regularNon é posíbel escribir o ficheiro destino «%s»
%sNon é posíbel escribir no ficheiro %s:
%s
CircunflexoDistinguir &Maiúsculas&Non distinguir maiúsculasDis&Tinguir maiúsculasCd segue li&Gazónsch&Own&Cambiar aCambiar saltos de liña por:Cambiar i &Idioma de revisiónCambiado:     %sPerdéronse os cambios no ficheiroVerificar salto de líña &POSIXVerifique os datos de entrada! Hai parámetros nulos!Revisar palabraO proceso fillo rematou inesperadamenteOrde chmodSeleccionar xogo de caracteresElixa a sintaxe de resalteCambiar propietario e permisosCambiar propietarioBarra de pro&Greso clásicaPechar o ficheiroco&Mpletar: mostrar todosCopiar ao &PortapapeisRecoller os rematesDous puntosOpcións de corComaOrde&Historial de ordes&Liña de ordesComparar directoriosCompletar/M-TabCalcular &TotaisCon&TinuarDirectorio de configuración:ConfiguraciónConfir&Mar antes de gardarConfirmar cambiosGardar o ficheiro: «%s»?ConfirmaciónConfirmation|&EliminarConfirmation|e&XecutarConfirmation|Limpar &HistorialConfirmation|Eliminar &FavoritosConfirmation|Saí&RConfirmation|s&ObrescrituraSaída de consolaContido:Continuar desde o principio?c&OpiarCopiar a un &Ficheiro....Enviar copias aCopiar directorio «%s» a:Copiar ao portapapeisCabeceira cpio danada atopada en
%sCrear un novo directorioCtrlO texto actual foi modificado e non foi gardado.
Continuar desbotará estes cambios.O texto actual foi modificado e non foi gardado.
Continuar debotará estes cambios.Cursor &Máis aló do fin da liñaCortar ao portapapeisChecoDanésDirectorio de datos:Tipos de datos:DepuraciónEliminarEliminar %s?Eliminar macr&O...Eliminar macro«Supr» do teclado numéricoEliminandoO destino «%s» debe ser un directorio
%sTipo disp.: maior %lu, menor %luDispositivo:  %sdi&Rectorio de favoritosEntrar en sub&Directorio se existeDialogTitle|CopiarDialogTitle|EliminarDialogTitle|Limpar historialDialogTitle|MoverOpcións de comparaciónAlgoritmo de comparaciónOutras opcións de comparaciónVisor de diferenzas: modo incorrectoDiferenza:O directorio «%s» non está baleiro.
Eliminalo recursivamente?Non é propietario do directorio %s 
O cache para %s expirouFavoritos Etiqueta do directorio:Etiqueta do directorio:Ruta do directorio:Ruta do directorio:Examinando directorioÁrbore de directoriosDesactivar a compatibilidade X11Desactivar o rato na versión textoDesactivar o uso de subterminalMostrar bitsMostrar a versión actualConfirma que quere executalo?Confirma que quere saír do Midnight Commander?Desexa eliminar este historial?Símbolo do dólarDominio:Non cargar as asociacións de teclas, empregar as predeterminadasPuntoFrecha abaixo«Frecha abaixo» do teclado numéricoFallou na duplicaciónHolandés&Saíre&XtensiónPaneis e&XternosERRO:Tempo restante %sEditar&Editar o ficheiro de extensiónsEditar ficheiro de &MenúEditar modo de gardarEditar o ficheiroEditar ficheirosEditar resaltado de &Grupos de ficheirosA edición está desactivadaEditar li&Gazón simbólicaEditar ligazón simbólicaEditar: Opcións do editori&Gnorar directorios...Activar uso de subterminal (predeterminado)Cod&Ificando...Tecla «Fin»«Fin» do teclado numéricoInglésIntroIntroduza a etiqueta da orde:Introduza o dispositivo (sen /dev/) onde quere
recuperar ficheiros: (F1 para máis detalles)Introduza nome do directorio:Escriba o nome do ficheiro:Escriba a liña:Escriba o nome da máquina (F1 para máis detalles):«Intro» do teclado numéricoEscriba a cadea a substituír:Escriba a cadea a buscar:Orde(s) a executar:Opcións para ordenar (ver manual), separadas por espazos:IgualErroProduciuse un erro %s creando o directorio %sProduciuse un erro %s eliminando o directorio %sProduciuse un erro ao chamar ao programaProduciuse un erro duplicando antigo erro de canalizaciónProduciuse un erro no ficheiro %s na liña %dProduciuse un erro ao ler %sProduciuse un erro ao ler da canalización: %sInformouse dun erro despois de interromper.Produciuse un erro ao pechar o ficheiro:
%s
É probábel que os datos non se escribiranProduciuse un erro ao escribir na canalización: %sTecla «Escape»EscapeEsperantoO sistema de accións xa foi iniciadoO sistema de accións non foi iniciadoSigno de exclamación&Executábeis primeiroApuntando a:O nome de ficheiro xa existe (ligazón simbólica apuntando):Existente: %s, tamaño %sProduciuse un erro de ext2libEditar o ficheiro de extensiónsOrde externaPaneis externos&Entrada completa de 8 bitsFATAL! Non é un directorio:Conexión por FT&P...Contrasinal do FTP anónimo:Atraso da caché do directorio FTP (seg):Conexión por FTPFTP: requírese conta para o usuario %sFTP: é preciso contrasinal para %sNon foi posíbel iniciar o sistema de acciónsProduciuse un erro ao ler os datos da saída estándar filla:
%sNon foi posíbel executar:
%s
Falso:FaroésFicheiroO ficheiro «%s» esta xa sendo editado
Usuario: %s
ID. do proceso: %dO ficheiro «%s» é grande de máis.
Abrir aínda así?O ficheiro «%s» non pertence a Vd. nin a root, nin ten permiso
global de escritura. Usalo podería comprometer a súa seguranza.O ficheiro %s foi modificado.
Quere gardalo antes de pechar?&Tipos de ficheirosO ficheiro xa existeManexadores de extensións de ficheiro:Hai outras ligazóns duras ao ficheiro. Desexa separalas ao gardar?Resaltar ficheiroLis&Tado de ficheirosFicheiro bloqueadoNome do ficheiro:Operacións de ficheiroO ficheiro foi modificado. Desexa gardalo ao saír?O(s) ficheiro(s) foi/foron modificado(s). Quere gardalo(s) ao saír?Ficheiro: %sFileOperation|CopiarFileOperation|EliminarFileOperation|MoverNome do ficheiro:Ficheiros procesados: %zuFicheiros procesados: %zu/%zuHai ficheiros marcados. Quere cambiar de directorio?Sistema de ficheiros: %sCambia tabulacións por e&SpazosFiltroOrde de filtrado e argumentos:Vista filtradaBuscar ficheiros orixinais logo de aplicar parchesBuscar ficheiroBuscar programas con SUID e SGIDBuscar ficheiros rexeitados logo de aplicar parchesRematado&Primeira coincidenciaMarcaSeguir &LigazónsFor&MatoAva&Nzar á declaraciónForzar as funcionalidades de xtermAtopouse un erro de formato no ficheiro de extensiónsNodos libres:Espazo libre: %s/%s (%d%%)FrancésTecla «F1»Tecla «F10»Tecla «F11»Tecla «F12»Tecla «F13»Tecla «F14»Tecla «F15»Tecla «F16»Tecla «F17»Tecla «F18»Tecla «F19»Tecla «F2»Tecla «F20»Tecla «F21»Tecla «F22»Tecla «F23»Tecla «F24»Tecla «F3»Tecla «F4»Tecla «F5»Tecla «F6»Tecla «F7»Tecla «F8»Tecla «F9»GIDGNU Midnight Commander %s
GNU Midnight Commander xa se está
executando neste terminal.
A compatibilidade de subterminal quedará desactivada.AlemánObtendo ficheiroIr á coincidencia do &ParénteseIr aIr á liñaIr á liña (esquerda)Ir á liña (dereita)Maior quePerfecto! As súas táboas de terminal son correctas!
Todas as teclas funcionan axeitadamente.GregoBuscando en %sGrupoO grupo «%s» non está baleiro.
Quere eliminalo?Nome do grupoNome do grupo&Suxestións visíbeisHe&XadecimalDesprazamento he&XadecimalAxudaO ficheiro de axuda ten un erro de formato
Editar resaltes de cor do grupoHistorialInicioA ruta do directorio de inicio non é absoluta«Inicio» do teclado numéricoCargar favoritosSe o &Tamaño difireIgnorar cambios en e&SpazosIgnora os espa&Zos en brancoIgnorar &TabulaciónsNa se&LecciónO ficheiro esta incompleto. Desexa conservalo?Arquivo extfs inconsistenteLigazóns inconsistentes para
%s
no arquivo cpio
%sArquivo de tipo tar inconsistenteInformaciónEntrada / mostrar xogo de caracteres:InserirInserir &Data e horaInserir &Literalmente...Inserir ficheiroInserir literalmente«Insert» do teclado numéricoErro interno: Dobre inicio da área de ligazónProduciuse un erro interno:Patrón orixinal incorrecto «%s»O elemento número %d é incorrectoValor incorrectoParece ser que todas as súas teclas xa
funcionan correctamente. Perfecto!ItalianoNavegación ao estilo L&YnxEtiqueta para «%s»:IdiomaAbrir un ficheiro co visorPresentaciónRedefinir &Teclas...Redefinir teclasFrecha esquerda«Frecha esquerda» do teclado numéricoChave esquerdaCorchete esquerdoParéntese esquerdoMenor queLigarCrear ligazón a %s como:Ligazóns:     %dModo de listadoCargarCargar asociacións de teclas desde o ficheiro indicadoCargar ficheiroCargar ficheiro de sintaxeCargando...Cargando: %3d%%Localización: %Xh:%XhGardar rexistro dos diálogos ftp nun ficheiroMC non foi quen de escribir o ficheiro %s,
a lista de favoritos antiga non foi borradama&Rcar e baixarMacro non eliminadaCorreo-eOpcións principaisA expresión regular é incorrectaMarcar &TodosMemoria esgotada!Editar menúme&Sturar todos os ficheirosMidnight Commander %sSaíndo de Midnight Commander.
Gardar o ficheiro modificado %s?Saíndo de Midnight Commander.
Gardar o(s) ficheiro(s) modificado(s)?Saíndo de Midnight Commander.
Gardar o ficheiro modificado?MenosMal escritaNomear automaticamente ao crear di&RectorioMo&VerModo:         %s (%04o)Ficheiros git modificadosModificado:   %sO resto de erros de análise serán ignorados.Mover o directorio «%s» a:Movendo %sNomeNome do novo grupo:Nome:NavegaciónNovo     : %s, tamaño %sNova &EntradaNovo &GrupoNova entrada de favoritosNovo grupo favoritosNlNon hai argumentos para o visor.Sen información sobre nodosSen información do espazoNon se atopan entradas apropiadas en %sNo&RmalSenNomeNin&GúnNorueguésNon se está usando nin xterm nin a consola Linux;
os paneis non se poden agochar.Non implementado aíndaO número de elementos a substituír non é o mesmo que o número de elementos atopadosSímbolo de numeral #AceptarSó en terminais &BobasAbrir ficheirosOutro (8 bit)Outra ordeOutras opciónsLiñas de saídaSobrescribir todos os ficheiros?Sobrescribir este ficheiro?PropietarioNome do propietarioNome do propietario:Propietario:  %s/%sAvance de pá&XinaPegar do portapapei&SAv Páx«Av Pág (páxina abaixo) do teclado numéricoRe Páx«Re Pág» (páxina arriba) do teclado numérico&Levar a panelOpcións dos paneisDisposición de paneis&Poñer no panelPoñer no panelPaneis:ParámetroContrasinal para \\%s\%sContrasinal:Pegar a saída dunha orde externaPausa logo de executarPe&RcentilesSímbolo de porcentaxePermPermisosPermisos (octal):Selecció&N persistenteCanalización «|»Produciuse un fallo ao pechar a canalizaciónFallo na canalizaciónPor favor, prema a tecla %s
e agarde ata que esta mensaxe desapareza.

Logo, prema a tecla de novo e vexa se a mensaxe de «Conforme» aparece
a beira do seu botón 

Se quere cancelar, prema unha vez a tecla «Escape»
e agarde.MáisPolacoPortuguésFin prematuro do arquivo cpio
%sConservar &AtributosPrema todas as teclas mencionadas aquí. Una vez feito, comprobe
que as teclas non están marcados con «Aceptar». Prema espazo na
tecla que falte ou prema co rato para definila. Móvase coa tecla Tab.Prema calquera tecla para continuar...Prema calquera tecla:Prema a tecla de macro:Prema a nova tecla para a macro:PrimoMostrar as opcións de configuraciónMostrar directorio de datosMostrar información adicional sobre directorios usadosMostrar o último directorio de traballo para o ficheiro especificadoSigno de interrogaciónCambiar directorioBusca rápidaSaírComiñas (")Expresión re&Gularin&Verter só ficheirosProduciuse un fallo na lecturaGravar/repetir &AcciónsFallou o reintento, vaise a sobrescribir o ficheiroAtopouse un erro nunha expresión regularLiga&Zón simbólica relativaRepetir as últimas ordesNúmero de repeticións:SubstituírSubstituír con:Solicitar a execución a coresSolicitar execución en branco e negroRestabelecer teclas en terminais HPRealizando a ligazón simbólica...Frecha dereita«Frecha dereita» do teclado numéricoChave dereitaCorchete dereitoParéntese dereitoRomanésRotación do t&AboleiroProceder a ordenarExecutándoseRusoLigazón S&FTP...&Estabelecer marcadosConexión por &Terminal...Modelos de ter&MinalPremer só &Unha vez&Ignorari&Gnorar agochados&Revisión ortográficaS&uspender&Intercambiar paneisFicheiro de sinta&XeSFTP á máquinaConexión por &SMB...Autenticación SMBLigazón á máquina SMBSUB-DIRLIGAZÓN&Borrado seguroGardar &Como...&Modo de gardar...Gardar comoGardar comoGardar o bloqueGardar ficheiroGardar &Posición no ficheiroGardar macro&Lista de pantallasO tamaño de xanela %dx%d non esta admitido.
Verifique o valor da variábel de contorno TERM.
PantallasBuscar por co&NtidoBuscarBuscar de &NovoBusca rematadaA busca está desactivadaNon se atopa a cadea buscadaBuscandoBuscando %sBuscando %s: %3d%%SeleccionarSeleccionar &GrupoSeleccione o método de comparación:Escoller o idiomaPunto e comaAplicar &TodosAsignar &GruposAsignar &UsuariosDefinir o nivel de depuraciónIntroduza a expresión para filtrar nomes de ficheiroDefinir a liña de comezo ao abrir un ficheiro co editor internoConfiguraciónConfiguración gardada en %sLigazón á máquina do terminalMaiúsMostrar ficheiros de co&Pia de seguranzaMostrar ficheiros agoc&HadosMostrar &Tamaño dos directoriosMostrar mc co tema especificadoMostrar m&Ini-estadointercambio &Simple de paneisTamañoTamaño:       %somitir &TodosTema:Temas«/» Barra inclinadaEslovacoSíntoo, non se puido pór a tarefa en 2º planoSíntoo, as conexións con contrasinal aínda non son posíbeis.OrdenarOrdenar bloqueOrdenar«Ordenar» devolveu un erro (non cero): %sOrixeA orixe «%s» non é un directorio
%sBarra espazadoraEspañolIndicar unha configuración de coresCores estándar:
   black, gray, red, brightred, green, brightgreen, brown,
   yellow, blue, brightblue, magenta, brightmagenta, cyan,
   brightcyan, lightgray e white

Cores estendidas, cando estean dispoñíbeis 256 cores::
   color16 to color255, ou rgb000 ata rgb555 e gray0 ata gray23

Atributos:
   bold, underline, reverse, blink; engadir máis con «+»
Comezar en:Iniciando transferencia en liña...DetidoFranxa de final de re&Torno de carroSubgrupo - prema INTRO para ver a listaAsuntoSuxerirSuecoActivar/desactivar &PaneisLigazón simbólicaNome da nova ligazón simbólica:A ligazón simbólica «%s» apunta a:Sinta&Xe coreadaSintaxe de &ResalteEditar ficheiro de sintaxeDatos do sistemaTecla «tabulador»Tamaño de tabulacións:TabulaciónDestinoO ficheiro destino xa existe!Asignar unha teclaOs ficheiros temporais crearanse en %s
Non se crearán ficheiros temporais
Opcións de terminalA macro %%var non ten valor predeterminadoA macro %%var non contén variábeisMidnight Commander non pode cambiar ao directorio
que o terminal di que é o directorio actual
Seica borrou vostede o directorio? ou deulle outros
permisos coa orde «su»?O Midnight CommanderA variábel de contorno TERM está sen definir!
O ficheiro esta a ser modificado por outros. Desexa gardar aínda así?O ficheiro a gardar non remata nunha liña nova.O formato do ficheiro %s ha cambiou coa versión 3.0. Pode facer unha copia de %smc.ext ou empregalo como modelo.O formato do ficheiro %smc.ext cambiou coa versión 3.0. Parece que está mal instalado. Por favor, tente conseguir unha copia intacta dende o paquete Midnight Commander.O terminal xa esta executando unha ordeO terminal aínda está activo. Saír de todos xeitos?Esa función non está implementadaTilTempo: %sTempo: %s %sTempo: %s %s (%s)Tempo: %s (%s)Atraso para a liberación de VFS (seg):Tempo de espera:ParaPara executar en terminais lentosAlter&Nar marcadosAlternar a Sinta&Xe de resalteGrupo principalTentar usar o ronsel do rato co antigo resaltadoTentar utilizar «termcap» no canto de «terminfo»Verdadeiro:Son precisos dous ficheiros para compararPrecísanse dous ficheiros para invocar o visor de diferenzas.Axuste de má&Quina de escribirEscriba «exit» para volver ao Midnight CommanderTipo:         %sDesmarcar g&RrupoUIDDIR--ANTUcraínoNon foi posíbel crear a acción «%s»!Non foi posíbel crear o grupo «%s» para accións!Non foi posíbel cargar o tema «%s».
Cargouse o tema predeterminado.Non foi posíbel analizar o tema «%s».
Cargouse o tema predeterminado.Non foi posíbel gardar a configuración en %sNon foi posíbel gardar o ficheiroNon é posíbel empregar o tema «%s» con compatibilidade
para 256 colores en terminais sen esta característica.
Cargouse o tema predeterminadoRecuperar ficheiros dun sistema de ficheiros ext2SubliñadoGuión baixoFin de ficheiro (EOF) inesperadoFin de ficheiro inesperado
%sProduciuse un erro en select() lendo os datos para o proceso fillo:
%sProduciuse un erro non agardado en waitpid():
%sProduciuse un erro descoñecido no proceso filloEtiqueta descoñecida no formato de pantalla:Desmarca&RDesmarcarFrecha arriba«Frecha arriba» do teclado numéricousar modo &PasivoTama&Ños en unidades SIUsar ed&Itor interno&Usar visor internoUsar o m&Odo de orden do panelUsar modo pasivo sobre pro&XyUsar caracteres simples para recadros&Mini-estado de usuarioDatos do usuarioMenú de usuarioNome de usuarioO formato semella non ser correcto. Recuperando o predeterminado.Usuario:Empregando a biblioteca S-Lang coa base de datos terminfo
O uso do «cargado rápido» pode ocasionar que o contido
do panel non sempre reflicta o contido do directorio. Nese
caso terá que recargar manualmente o directorio.
Vexa a páxina do manual para obter máis información.Empregando a biblioteca ncurses
Empregando a biblioteca ncursesw

Engadidos e scripts VFSve&R ficheiro...Ver ficheiroVista: Configuración do sistema de ficheiros virtual(VFS) Sistema de ficheiros virtual:&Lapelas visíbeisAgardando antes de volver tentar... %d (Ctrl-G para cancelar)AtenciónAviso -- ignorando o ficheiroCoidado: Non é posíbel cambiar a %s.
Atención: marca %c incorrecta en %s:
%s
Atención: liña incorrecta en %s:
%s
Aviso: non é posíbel cargar a lista de codificaciónsAviso: non é posíbel abrir o directorio %s
GalésQue ficheiro de extensión desexa editar?Que ficheiro de resaltes desexa editar?Que ficheiro de menú desexa editar?Que ficheiro de sintaxe desexa editar?Busca por como&DínsEditor de texto propio incluído
Compatibilidade para internacionalización
Compatibilidade para rato en xterm
Compatibilidade para rato en xterm e consola Linux
Compatibilidade para cambio de xogos de caracteres
Con compatibilidade opcional coa subterminal
Con compatibilidade predeterminada coa subterminal
Compatibilidade para accións X11
Compatibilidade para operacións en 2º plano
Lonxitude do axuste de liña:Axuste de parágrafoVostede escribiu «%s»Ten que ir ao directorio antes de extraer ficheirosÉ necesario seleccionar primeiro un bloque de textoA configuración previa foi trasladada de %s
a %s
A configuración antiga foi trasladada de %s
cara os directorios recomendados por Freedesktop.
Para obter máis detalles consulte
http://standards.freedesktop.org/basedir-spec/basedir-spec-latest.html[SenNome][disp][Este_directorio] [outro_directorio _de_panel]cdcolumnasdirectoriosdirectorioe&Xecutado/buscado polo propietarioedite a ligazón simbólica, non é posíbel eliminar %s: %seditar ligazón simbólica: %sexecu&Tado/buscado polo propietarioexecutado/&Buscado por outrosficheiroficheirosficheiros/directoriosfish: desconectando de %sfish: obtendo información do servidor...fish: negociando versión...fish: fallo local de lectura, enviando cerosfish: precisase contrasinal para %sfish: lendo o directorio %s...fish: enviando liña de inicio...fish: enviando contrasinal de usuario...fish: esperando liña de inicio...fish: gardar %s: enviando orde...fish: gardando ficheiroftpfs: %sftpfs: produciuse un fallo ao executar CWDftpfs: desconectando de %sftpfs: nome de máquina incorrecto.ftpfs: denegada autorización ao usuario %s ftpfs: lendo vía FTP o directorio %s... %s%sftpfs: produciuse un erro ao interromper: %sftpfs: fracasou a interrupciónftpfs: interrompendo a transferencia.ftpfs: conexión interrompida polo usuarioftpfs: fracasou a conexión ao servidor: %sftpfs: non é posíbel crear socket: %sftpfs: non é posíbel aplicar o «modo pasivo»ftpfs: non é posíbel realizar a ligazón simbólicaftpfs: produciuse un fallo; non hai onde repregarseftpfs: familia de enderezos incorrectaftpfs: autorizadosftpfs: estabelecendo conexión con %sftpfs: enviando nome de usuarioftpfs: enviando conta de usuarioftpfs: enviando contrasinal de usuarioftpfs: gardando ficheirogrupoligar: %scorreo -s <asunto> -c <cc> <para>esgotouse toda a memoria mentres se recolocaba a matrizVFS non-localnon hai memoria abondoopen_inode_scan: %doutrospropietarioli&Do polo grupolido por o&UtrosProduciuse un fallo na reconexión con %sestabelecer o ID do &Grupo na execuciónestabelecer o ID do &Ususrio na execuciónsftp: %ssftp: (Ctrl-G interrompe) Listado... %ssftp: introduza a frase de paso para %s sftp: introduza o contrasinal para %s sftp: nome de máquina incorrecto.sftp: Feito o listado.sftp: Sen datos del descritor do ficheiro para lelo.sftp: a frase de paso está baleirasftp: o contrasinal está baleiro.sftp: Non é posíbel obter o nome do usuario actual.sftp: produciuse un erro ao ler %s: %ssftp: conexión interrompida polo usuariosftp: fracasou a conexión ao servidor: %ssftp: estabelecendo conexión con %ssort|asort|esort|csort|isort|msort|nsort|tsort|ssort|vbit pega&Ñentoligazón simbólica: %sa:undelfs: erroundelfs: cargando información de ficheiros eliminados %d nodos-iundelfs: lendo mapa de bloques...undelfs: lendo mapa de nodos-i...vfs_info non é fs!ao reservar búfer de bloqueao chamar a ext2_block_iterate %dmentres se executaba o rastrexo de nodos-i %dao repetir entre bloquesao iniciar rastrexo de nodo-i %descr&Ito por outrosescrito polo gru&PoOs permisos de ~/.netrc non son os apropiados.
Elimine o contrasinal ou cambie os permisos.PK�m�\�x��ccLC_MESSAGES/acl.monu�[�����2�C<HI]q��)�)��$7�B(lk��']	'�	�	$�	�	&
2.
3a
/�
/�
=�
3%N2t�$�&�+'7,_&�'�*�+
2
I
a
s
�
�
&�
�

�
�
0xK����)+)U��b�N��3��6M;�"�(�5$0Z?�>�:
OE�*�7�+/1[7�6�?�9<>v,�1�"#7[o'��-��-E '$/+1*0-)	%2.&(

"!,#	%s -B pathname...
	%s -D pathname...
	%s -R pathname...
	%s -b acl dacl pathname...
	%s -d dacl pathname...
	%s -l pathname...	[not IRIX compatible]
	%s -r pathname...	[not IRIX compatible]
	%s acl pathname...
      --set=acl           set the ACL of file(s), replacing the current ACL
      --set-file=file     read ACL entries to set from file
      --mask              do recalculate the effective rights mask
  -R, --recursive         recurse into subdirectories
  -L, --logical           logical walk, follow symbolic links
  -P, --physical          physical walk, do not follow symbolic links
      --restore=file      restore ACLs (inverse of `getfacl -R')
      --test              test mode (ACLs are not modified)
  -d, --default           display the default access control list
  -m, --modify=acl        modify the current ACL(s) of file(s)
  -M, --modify-file=file  read ACL entries to modify from file
  -x, --remove=acl        remove entries from the ACL(s) of file(s)
  -X, --remove-file=file  read ACL entries to remove from file
  -b, --remove-all        remove all extended ACL entries
  -k, --remove-default    remove the default ACL
  -n, --no-mask           don't recalculate the effective rights mask
  -d, --default           operations apply to the default ACL
%s %s -- get file access control lists
%s %s -- set file access control lists
%s: %s in line %d of file %s
%s: %s in line %d of standard input
%s: %s: %s in line %d
%s: %s: Cannot change owner/group: %s
%s: %s: Malformed access ACL `%s': %s at entry %d
%s: %s: Malformed default ACL `%s': %s at entry %d
%s: %s: No filename found in line %d, aborting
%s: %s: Only directories can have default ACLs
%s: No filename found in line %d of standard input, aborting
%s: Option -%c incomplete
%s: Option -%c: %s near character %d
%s: Removing leading '/' from absolute path names
%s: Standard input: %s
%s: access ACL '%s': %s at entry %d
%s: cannot get access ACL on '%s': %s
%s: cannot get access ACL text on '%s': %s
%s: cannot get default ACL on '%s': %s
%s: cannot get default ACL text on '%s': %s
%s: cannot set access acl on "%s": %s
%s: cannot set default acl on "%s": %s
%s: error removing access acl on "%s": %s
%s: error removing default acl on "%s": %s
%s: malloc failed: %s
%s: opendir failed: %s
Duplicate entriesInvalid entry typeMissing or wrong entryMultiple entries of same typeTry `%s --help' for more information.
Usage:
Usage: %s %s
Usage: %s [-%s] file ...
preserving permissions for %ssetting permissions for %sProject-Id-Version: acl-2.2.43.1
Report-Msgid-Bugs-To: acl-devel@nongnu.org
POT-Creation-Date: 2018-06-18 23:10-0400
PO-Revision-Date: 2007-03-16 18:52+0100
Last-Translator: Antonio Trueba <atrueba@users.sourceforge.net>
Language-Team: Galician
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: 8bit
X-Poedit-Language: Galician
	%s -B rota...
	%s -D rota...
	%s -R rota...
	%s -b nome de ruta ACL DACL..
	%s -d rota ó ACL...
	%s -l rota...	[non compatible con IRIX]
	%s -r rota...	[non compatible con IRIX]
	%s nome de rota do ACL...
      --set=ACL           estableceé-lo ACL de ficheiro(s), substituindo ó ACL actual
      --set-file=fich     ler entradas ACL a establecer dende ficheiro
      --mask              recalculá-la máscara de dereitos efectiva
  -R, --recursive         recorrer subdirectorios recursivamente
  -L, --logical           percorrido lóxico, seguindo enlaces simbólicos
  -P, --physical          percorrido físico, non seguir enlaces simbólicos
      --restore=fich      restaurar ACLs (inverso de 'getfacl -R')
      --test              modo de proba (os ACLs non son modificados)
  -d, --default           amosá-la lista de control de acceso predeterminada
  -m, --modify=ACL        modificá-lo ACL actual de ficheiro(s)
  -M, --modify-file=fich  ler entradas ACL a modificar dende ficheiro
  -x, --remove=ACL        borrar entradas do ACL de ficheiro(s)
  -X, --remove-file=fich  ler entradas dACL a borrar dende ficheiro
  -b, --remove-all        borrar tódalas entradas de ACL extendidas
  -k, --remove-default    borrar ó ACL predeterminado
  -n, --no-mask           non recalculá-la máscara de dereitos efectiva
  -d, --default           as operacións afectan ó ACL predeterminado
%s %s -- obter listas de control de acceso a ficheiro
%s %s -- establecer listas de control de acceso a ficheiro
%s: %s na liña %d do ficheiro %s
%s: %s na liña %d da entrada estándar
%s: %s: %s na liña %d
%s: %s: Non se pode cambiá-lo propietario/grupo: %s
%s: %s: ACL incorrecto `%s': %s na posición %d
%s: %s: ACL predeterminado incorrecto `%s': %s na posición %d
%s: %s: Non se atopou nome de ficheiro na liña %d, abortando
%s: %s: Só os directorios poden ter ACLs predeterminados
%s: Non se atopou nome de ficheiro na liña %d da entrada estándar, abortando
%s: Opción -%c incompleta
%s: Opción -%c: %s preto do carácter %d
%s: Eliminando '/' iniciais en nomes de ruta absolutos
%s: Entrada estándar: %s
%s: ACL de acceso '%s': %s en posición %d
%s: non se puido obter ACL de acceso en '%s': %s
%s: non se puido obter texto ACL de acceso en '%s': %s
%s: non se puido obter ACL predeterminado en '%s': %s
%s: non se puido obter texto de ACL predeterminado en '%s': %s
%s: non se puido establecé-lo ACL de acceso en "%s": %s
%s: non se puido establecé-lo ACL predeterminado en "%s": %s
%s: erro borrando ACL de acceso en "%s": %s
%s: erro borrando ACL predeterminado en "%s": %s
%s: a chamada a malloc fallou: %s
%s: a chamada a opendir fallou: %s
Entradas duplicadasTipo de entrada non válidoFalta un atributo, ou está mal formadoVarias entradas do mesmo tipoEscriba "%s --help" para máis información.
Uso:
Uso: %s %s
Uso: %s [-%s] ficheiro ...
mantendo permisos de %sestablecendo permisos para %sPK�m�\�Y�����LC_MESSAGES/dpkg.monu�[�������<�!?�!a�!=S"&�"-�".�"#.&#U# q#4�#�#5�#-$.G$0v$1�$$�$4�$/3%c%({%$�%�%�%:	&6D&1{&1�&!�&('*'6'U')m'9�'.�''(&((3O(5�(�(�(�(�(�())#)8)I)X)-o)H�)Q�)A8*ez*f�*7G+<+B�+�+,
1, ?,`,5y,1�,�,�,#-!0-R-Ko-5�--�-!.A.5[.�.,�..�../4/HT/6�/(�/>�/<0�H0-�01[61g�1�240)43Z41�4�4�4*�425�75-�6/
7]:7�7G�78�7,8K8(j8:�8 �8-�89�59�:��:��;�b<�-=�=��= |>5�>,�>$?%?-?9?E?6R?!�?.�?,�?@%&@L@%k@"�@&�@�@�@;
A3IA}AA�A�A&�A""BEEB,�B"�B-�B5	C,?CGlC�C*�C"�C D:D"RDuD�D*�DJ�DE"E=EUE-tE)�E%�E�EF)&FPFoF!�F!�F�F%�F%G;GXG!mG�G �G-�G#�G+H%KH$qH�H �H�H:�H!I;IWItI$�I�I�I�I�IJ/J!OJqJ5�J �J2�J%K@K0`K*�K/�K6�KV#L.zL(�L+�L)�L4(M4]M;�M<�M:N7FN0~N;�N?�N$+OAPO$�O!�O�Oc�O[P:yP<�P�P'�P4%Q)ZQ�Q	�Qk�Q/R"AR^dR@�R!S&S@SXSOqS8�S*�S%T7=T5uT!�T�T�T5U"6U4YU
�U �U%�UG�U?+V#kV7�V2�VY�VfTW4�WF�W17X;iX�X.�X.�X "YDCY�Y&�Y-�Y�Y.�Y'ZCZXZ)oZ�Z&�Z�Z�ZH[0Q[6�[4�[�[%\%4\Z\+o\+�\4�\F�\@C],�]R�]'^	,^Z6^4�^2�^�^G_Y]_+�_%�_1	`+;`Ng`3�`*�`a2/a+ba,�a�a"�a$�a*bIb*eb&�b3�b4�b5 c)Vc,�cD�c*�c4d&Rd#yd#�d%�d(�d.e9?e'ye*�e.�e�e!f4:f4of[�f,g4-g#bg,�g/�g+�g-h=hXh2ph&�hB�h.
i1<i3ni*�i6�i&j4+j1`j�j�j"�j�j�j(k:kSVkM�k(�k"!lDl`\l��l@Qn��nEo'Yo0�o*�o�o5�o'pFp3dp�p7�p:�p5$q/Zq)�q'�q1�q,r;r7Rr-�r$�r�rF�r>Cs5�s.�s%�s'
t5tAt at?�tB�t2u?8u0xu4�u4�uvv$v9vEv^v
ov}v�v�v�v4�vT�v^MwJ�wq�w~ix7�x@ yHay�y&�y�yz#zC?z9�z!�z*�z3
{(>{g{V�{G�{8%| ^||8�|�|2�|@(}4i},�}J�}J~7a~A�~�~��~:�������+
�9�=U�=��Bу
�"�.�:M����@c�8��]݆;�L@�?��.͇*��3'�4[�+��F�����������������w�%0��V�+�B �Ec�$��Ώ׏���@�0V�2��7���G�.X�=��(ő:�,)�V�Xt�N͒0�FM�*��=��#��R!�<t�2��7�?�/\�Z��"�3
�*>�i���4��ږ	�3��[/���&��ė!�9�K>�/��&���4��$,�$Q�#v�&����,�-
�7;�s�!��5�� ޚ9��,9�@f�*��1қ�$ �E�`Y���؜"��$�,@�m���+��"ם��$�'7�)_�O��,ٞA�&H�#o�D��:؟G�M[�i��9�-M�?{�5��C�N5�^��\�R@�N��W�Q:�]��5�\ �0}�-��2ܥ��'��A��L�M�/e�@��4֧�	"�u,�9��/ܨy�S��2ک
�&�;�_V�M��)�.�FN�;��.ѫ#�&$�HK�,��<����1�;=�ly�J�51�Mg�1��l�zT�;ϯh�Ct�u��.�7N�7��1��P�A�7R�8��	ò3Ͳ+�-�G�6c�$��N�� �/�VF�>��OܴJ,�4w�6��4��60�@g�V��?��;?�={�n��5(�	^�|h�J�M0�.~�F��X�CM�.��6��J��RB�E��3ۻ�B*�Am�<���2�->�?l� ��8ͽ+�G2�Kz�Gƾ3�5B�^x�<׿:�6O�/��+��2�8�?N�J��1�?�EK�#��-��<��< �r]�A��F�1Y�7��4��=��:6�!q���H��*��I�;g�9��F��3$�8X�,��9��6��/�%K�.q�����/��"�s&�^��>��8�!X�[z�3W{CM��rX#.v�0�v�&���)+G�orY�U`�1T:��6�dqA���`�a�X\6�����2_N�=yS����D@���hA�d����p��[������D�7B�Ii	�,f�Ue~"ER����k�<�:2�V;�|�x)@�[�3T,�/F0
<�7s���u'R]�^�9PP�q�QQi�?�I��;Kb�!�J}��bL/�(�
e���zjE�c���HBc�x$�|p%Zl-�^t Lz�{8.��S���*~W��8�$�n�o]ZK������un_9My�V���5t?wg*!�	l����'�O&����>���G�m�H(�
>���gh#f�m�5j����Y���\�+%w4FkJas��=�� �1"O
�CN�}-�4
 packages' pending triggers which are or may be unresolvable:

Configuration file '%s', does not exist on system.
Installing new config file as you requested.
     Version in package is the same as at last installation.
     not a plain file          %.255s
  %.250s (version %.250s) is present and %s.
  %.250s (version %.250s) is to be installed.
  %.250s is %s.
  %.250s is installed, but is version %.250s.
  %.250s is not installed.
  %.250s is to be deconfigured.
  %.250s is to be installed, but is version %.250s.
  %.250s is to be removed.
  %.250s is unpacked, but has never been configured.
  %.250s is unpacked, but is version %.250s.
  %.250s latest configured version is %.250s.
  %.250s provides %.250s and is present and %s.
  %.250s provides %.250s and is to be installed.
  %.250s provides %.250s but is %s.
  %.250s provides %.250s but is to be deconfigured.
  %.250s provides %.250s but is to be removed.
  %s (%s) provides %s.
  Package %s awaits trigger processing.
  Package %s is not configured yet.
  Package %s is not installed.
  Package %s is to be removed.
  Package %s which provides %s awaits trigger processing.
  Package %s which provides %s is not configured yet.
  Package %s which provides %s is not installed.
  Package %s which provides %s is to be removed.
  Version of %s on system is %s.
  Version of %s to be configured is %s.
 %d in %s:  %s (%s) breaks %s and is %s.
 %s (not a plain file)
 ==> Keeping old config file as default.
 ==> Package distributor has shipped an updated version.
 ==> Using current old file as you requested.
 ==> Using new config file as default.
 ==> Using new file as you requested.
 The default action is to install the new version.
 The default action is to keep your current version.
 and  depends on %s (subprocess): %s
%s breaks %s%s conflicts with %s%s depends on %s%s enhances %s%s pre-depends on %s%s recommends %s%s suggests %s'%s' clashes with '%s''%s' field, invalid package name '%.255s': %s'%s' field, missing package name, or garbage where package name expected'%s' field, reference to '%.255s':
 '%c' is obsolete, use '%c=' or '%c%c' instead'%s' field, reference to '%.255s':
 bad version relationship %c%c'%s' field, reference to '%.255s':
 implicit exact match on version number, suggest using '=' instead'%s' field, reference to '%.255s':
 version value starts with non-alphanumeric, suggest adding a space'%s' field, reference to '%.255s': version unterminated'%s' field, syntax error after reference to package '%.255s'(Noting disappearance of %s, which has been completely replaced.)
(Reading database ... (no description available), core dumped-%c option does not take a value-%c option takes a value--%s --pending does not take any non-option arguments--%s --recursive needs at least one path argument--%s needs <name>--%s needs <name> <path>--%s needs a .deb filename argument--%s needs a <directory> argument--%s needs a single argument--%s needs a target directory.
Perhaps you should be using dpkg --install ?--%s needs at least one package archive file argument--%s needs at least one package name argument--%s option does not take a value--%s option takes a value--%s takes at most two arguments (.deb and directory)--%s takes no arguments--%s takes only one argument (.deb filename)--auto requires exactly one part file argument--auto requires the use of the --output option--compare-versions bad relation--compare-versions takes three arguments: <version> <relation> <version>--search needs at least one file name pattern argument--split needs a source filename argument--split takes at most a source filename and destination prefix; however:
<deb> is the filename of a Debian format archive.
<cfile> is the name of an administrative file component.
<cfield> is the name of a field in the main 'control' file.

<package status and progress file descriptor>Authenticating %s ...
Commands:
  --check-supported                Check if the running dpkg supports triggers.

Commands:
  -s|--split <file> [<prefix>]     Split an archive.
  -j|--join <part> <part> ...      Join parts together.
  -I|--info <part> ...             Display info about a part.
  -a|--auto -o <complete> <part>   Auto-accumulate parts.
  -l|--listq                       List unmatched pieces.
  -d|--discard [<filename> ...]    Discard unmatched pieces.

Comparison operators for --compare-versions are:
  lt le eq ne ge gt       (treat empty version as earlier than any version);
  lt-nl le-nl ge-nl gt-nl (treat empty version as later than any version);
  < << <= = >= >> >       (only for compatibility with control file syntax).

Debian %s version %s.
Debian '%s' package archive backend version %s.
Debian '%s' package management program version %s.
Debian '%s' package split/join tool; version %s.
Deleted %s.
DescriptionErrors were encountered while processing:
File '%.250s' is not part of a multipart archive.
Format syntax:
  A format is a string that will be output for each package. The format
  can include the standard escape sequences \n (newline), \r (carriage
  return) or \\ (plain backslash). Package information can be included
  by inserting variable references to package fields using the ${var[;width]}
  syntax. Fields will be right-aligned unless the width is negative in which
  case left alignment will be used.
Installing new version of config file %s ...
Junk files left around in the depot directory:
More than one copy of package %s has been unpacked
 in this run !  Only configuring it once.
NamePackage %s is on hold, not touching it.  Use --force-hold to override.
Package %s listed more than once, only processing once.
Package '%s' does not contain any files (!)
Packages not yet reassembled:
Part %d of package %s filed (still want Processing was halted because there were too many errors.
Recorded info about %s from %s.
Replacing available packages info, using %s.
Setting up %s (%s) ...
The following packages are awaiting processing of triggers that they
have activated in other packages.  This processing can be requested using
dselect or dpkg --configure --pending (or dpkg --triggers-only):
The following packages are in a mess due to serious problems during
installation.  They must be reinstalled for them (and any packages
that depend on them) to function properly:
The following packages are only half configured, probably due to problems
configuring them the first time.  The configuration should be retried using
dpkg --configure <package> or the configure menu option in dselect:
The following packages are only half installed, due to problems during
installation.  The installation can probably be completed by retrying it;
the packages can be removed using dselect or dpkg --remove:
The following packages have been triggered, but the trigger processing
has not yet been done.  Trigger processing can be requested using
dselect or dpkg --configure --pending (or dpkg --triggers-only):
The following packages have been unpacked but not yet configured.
They must be configured using dpkg --configure or the configure
menu option in dselect for them to work:
Type 'exit' when you're done.
Type dpkg-deb --help for help about manipulating *.deb files;
Type dpkg --help for help about installing and deinstalling packages.Type dpkg-split --help for help.Type dpkg-trigger --help for help about this utility.Updating available packages info, using %s.
Usage: %s [<option> ...] <command>

Version[default=N][default=Y][no default]archive contained object '%.255s' of unknown type 0x%xarchive has no newlines in headerawaiting trigger processing by another packagebroken due to failed removal or installationbroken due to postinst failurecan't mmap package info file '%.255s'can't remove old postrm scriptcan't stat package info file '%.255s'cannot open '%.255s' (in '%.255s')cannot open archive part file '%.250s'cannot read info directorycannot remove '%.250s'cannot remove old backup config file '%.250s' (of '%.250s')cannot remove old config file '%.250s' (= '%.250s')cannot remove old files listcannot satisfy pre-dependencies for %.250s (wanted due to %.250s)cannot scan directory '%.255s'cannot scan updates directory '%.255s'cannot stat '%.255s' (in '%.255s')character '%c' not allowed (only letters, digits and characters '%s')conffile '%.250s' does not appear in packageconffile '%.250s' is not stattableconflicting actions -%c (--%s) and -%c (--%s)conflicting diversions involving '%.250s' or '%.250s'conflicting packages - not installing %.250scontrol directory has bad permissions %03lo (must be >=0755 and <=0775)couldn't open '%i' for streamdependency problems - leaving unconfigureddependency problems - not removingdiversion by %s from: %s
diversion by %s to: %s
divert-to may not contain newlinesdiverted by %s to: %s
done
duplicate awaited trigger package '%.255s'duplicate file trigger interest for filename '%.250s' and package '%.250s'duplicate path %sduplicate pending trigger '%.255s'duplicate slave link %sduplicate value for '%s' fieldduplicate value for user-defined field '%.*s'empty string from fgets reading conffilesempty trigger names are not permittedepoch in version is not numbererror closing %.250serror closing configuration file '%.255s'error closing/writing '%.255s'error creating device '%.255s'error creating directory '%.255s'error creating hard link '%.255s'error creating pipe '%.255s'error creating symbolic link '%.255s'error ensuring '%.250s' doesn't existerror opening conffiles fileerror reading %.250serror reading %s from file %.255serror reading conffiles fileerror reading from dpkg-deb pipeerror reading triggers deferred file '%.250s'error setting ownership of '%.255s'error setting ownership of symlink '%.255s'error setting permissions of '%.255s'error setting timestamps of '%.255s'error trying to open %.250serror un-catching signal %s: %s
error writing '%s'error writing to stderr, discovered before conffile promptfailed to allocate memoryfailed to chdir to '%.255s'failed to chdir to directoryfailed to chroot to '%.250s'failed to close after read: '%.255s'failed to create directoryfailed to create pipefailed to dup for fd %dfailed to dup for std%sfailed to fstat archivefailed to fstat diversions filefailed to fstat statoverride filefailed to open diversions filefailed to open package info file '%.255s' for readingfailed to open statoverride filefailed to open trigger interest list file '%.250s'failed to read '%.255s' (in '%.255s')failed to read archive '%.255s'failed to remove incorporated update file %.255sfailed to remove my own update file %.255sfailed to rewind trigger interest file '%.250s'failed to stat (dereference) existing symlink '%.250s'failed to stat (dereference) proposed new symlink target '%.250s' for symlink '%.250s'failed to write details of '%.50s' to '%.250s'fgets gave an empty string from '%.250s'field name '%.*s' must be followed by colonfile '%.250s' is corrupt - %.250s missingfile '%.250s' is corrupt - bad MD5 checksum '%.250s'file '%.250s' is corrupt - bad digit (code %d) in %sfile '%.250s' is corrupt - bad magic at end of first headerfile '%.250s' is corrupt - bad magic at end of second headerfile '%.250s' is corrupt - bad padding character (code %d)file '%.250s' is corrupt - missing newline after %.250sfile '%.250s' is corrupt - nulls in info sectionfile '%.250s' is corrupt - second member is not data memberfile '%.250s' is corrupt - size is wrong for quoted part numberfile '%.250s' is corrupt - too shortfile '%.250s' is corrupt - wrong number of parts for quoted sizesfile '%.250s' is not an archive partfile '%s' is not an archive part
file may not contain newlinesfile triggers record mentions illegal package name '%.250s' (for interest in file '%.250s'): %.250sfilename "%s" is not absolutefiles '%.250s' and '%.250s' are not parts of the same filefiles list file for package '%.250s' contains empty filenamefork failedillegal package name at line %d: %.250sillegal package name in awaited trigger '%.255s': %sillegal pending trigger name '%.255s': %sinstallation of %.250sinstalledinstalling %.250s would break %.250s, and
 deconfiguration is not permitted (--auto-deconfigure might help)installing %.250s would break existing softwareinvalid integer for --%s: '%.250s'invalid or unknown syntax in trigger name '%.250s' (in trigger interests for package '%.250s')invalid package name '%.250s' in triggers deferred file '%.250s'link %s is both primary and slavelocal diversion from: %s
local diversion to: %s
locally diverted to: %s
maintainer script '%.50s' has bad permissions %03lo (must be >=0555 and <=0775)maintainer script '%.50s' is not a plain file or symlinkmaintainer script '%.50s' is not stattablemay not be empty stringmismatch on divert-to
  when removing '%s'
  found '%s'mismatch on package
  when removing '%s'
  found '%s'name %s is both primary and slaveneed an action optionnewline in field name '%.*s'newlines prohibited in update-alternatives files (%s)no package information in '%.255s'no package named '%s' is installed, cannot configurenot installednot installed but configs remainnothing after colon in version numberold version of package has overly-long info file name starting '%.250s'open component '%.255s' (in %.255s) failed in an unexpected wayout of memory for new cleanup entryout of memory for new cleanup entry with many argumentspackage %.250s is already installed and configuredpackage %.250s is not ready for configuration
 cannot configure (current status '%.250s')package %.250s is not ready for trigger processing
 (current status '%.250s' with no pending triggers)package architecture (%s) does not match system (%s)package contains overly-long control info file name (starting '%.50s')package control info contained directory '%.250s'package control info rmdir of '%.250s' didn't say not a dirpackage diverts others to: %s
package has status %s but triggers are awaitedpackage has status %s but triggers are pendingpackage may not contain newlinespackage name has characters that aren't lowercase alphanums or '-+.'part %d is missingpart file '%.250s' is not a plain filepart size is far too large or is not positivepassed
pre-dependency problem - not installing %.250spriority must be an integerread error in %.250sread error in '%.250s'read error in configuration file '%.255s'read error on standard inputread error on stdin at conffile promptreassembled package fileremoval of %.250srename involves overwriting '%s' with
  different file '%s', not allowedrequested operation requires superuser privilegesearched, but found no packages (files matching *.deb)several package info entries found, only one allowedslave link same as main link %ssource file '%.250s' not a plain filestatoverride file contains empty linestripping trailing /subprocess %s returned error exit status %dsyntax error in file triggers file '%.250s'target is directory - cannot skip control file checkthere are several versions of part %d - at least '%.250s' and '%.250s'there is no script in the new version of the package - giving uptoo-long line or missing newline in '%.250s'trigger interest file '%.250s' syntax error; illegal package name '%.250s': %.250strigger name contains invalid charactertriggeredtriggers ci file '%.250s' contains illegal trigger syntax in trigger name '%.250s': %.250striggers ci file contains unknown directive '%.250s'triggers ci file contains unknown directive syntaxtriggers looping, abandonedtrying to overwrite '%.250s', which is the diverted version of '%.250s'trying to overwrite '%.250s', which is the diverted version of '%.250s' (package: %.100s)unable to (re)open input part file '%.250s'unable to check existence of '%.250s'unable to check for existence of archive '%.250s'unable to chown backup symlink for '%.255s'unable to clean up mess surrounding '%.255s' before installing another versionunable to close new triggers deferred file '%.250s'unable to close updated status of '%.250s'unable to create '%.255s'unable to create triggers state directory '%.250s'unable to delete control info file '%.250s'unable to delete used-up depot file '%.250s'unable to discard '%.250s'unable to fill %.250s with paddingunable to flush %.250s after paddingunable to flush updated status of '%.250s'unable to fstat source fileunable to fsync updated status of '%.250s'unable to install '%.250s' as '%.250s'unable to install (supposed) new info file '%.250s'unable to install new info file '%.250s' as '%.250s'unable to install new triggers deferred file '%.250s'unable to install new version of '%.255s'unable to install updated status of '%.250s'unable to make backup link of '%.255s' before installing new versionunable to make backup symlink for '%.255s'unable to move aside '%.255s' to install new versionunable to open new depot file '%.250s'unable to open output file '%.250s'unable to open source file '%.250s'unable to open temp control directoryunable to open triggers ci file '%.250s'unable to open triggers deferred file '%.250s'unable to open/create new triggers deferred file '%.250s'unable to read depot directory '%.250s'unable to read file triggers file '%.250s'unable to read filedescriptor flags for %.250sunable to read link '%.255s'unable to read part file '%.250s'unable to remove newly-extracted version of '%.250s'unable to remove newly-installed version of '%.250s'unable to remove newly-installed version of '%.250s' to allow reinstallation of backup copyunable to remove obsolete info file '%.250s'unable to rename new depot file '%.250s' to '%.250s'unable to reopen part file '%.250s'unable to restore backup version of '%.250s'unable to seek to start of %.250s after paddingunable to set close-on-exec flag for %.250sunable to set execute permissions on '%.250s'unable to stat %s '%.250s'unable to stat '%.250s'unable to stat current installed conffile '%.250s'unable to stat other new file '%.250s'unable to stat restored '%.255s' before installing another versionunable to stat triggers deferred file '%.250s'unable to truncate for updated status of '%.250s'unable to write new triggers deferred file '%.250s'unable to write updated status of '%.250s'unexpected data after package and selection at line %dunexpected end of file in %s in %.255sunexpected end of line after package name at line %dunexpected end of line in package name at line %dunknown argument '%s'unknown compression type '%s'!unknown force/refuse option '%.*s'unknown option -%cunknown option --%sunknown wanted status at line %d: %.250sunpacked but not configuredupdates directory contains file '%.250s' whose name is too long (length=%d, max=%d)updates directory contains files with different length names (both %d and %d)user-defined field name '%.*s' too shortversion string has embedded spacesversion string is emptyyou must specify packages by their own names, not by quoting the names of the files they come inProject-Id-Version: dpkg 1.17.0
Report-Msgid-Bugs-To: debian-dpkg@lists.debian.org
PO-Revision-Date: 2015-04-07 09:49+0200
Last-Translator: mvillarino <mvillarino@users.sourceforge.net>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Generator: KBabel 1.11.4
Plural-Forms: nplurals=2; plural=n != 1;

 disparadores pendentes que son ou poderían ser irresolubles:

O ficheiro de configuración "%s" non existe no seu sistema.
A instalar o novo ficheiro de configuración pola súa petición.
     A versión do paquete é a mesma que a da última instalación.
     non é un ficheiro normal  %.255s
  %.250s (versión %.250s) está presente e %s.
  %.250s (versión %.250s) hase instalar.
  %.250s está %s.
  %.250s está instalado, pero é a versión %.250s.
  %.250s non está instalado.
  %.250s hase desconfigurar.
  %.250s hase instalar, pero é a versión %.250s.
  %.250s hase eliminar.
  %.250s está desempaquetado, pero non se configurou.
  %.250s está desempaquetado, pero é a versión %.250s.
  %.250s ten de última versión configurada %.250s.
  %.250s fornece %.250s e está presente e %s.
  %.250s fornece %.250s e hase instalar.
  %.250s fornece %.250s pero está %s.
  %.250s fornece %.250s pero hase desconfigurar.
  %.250s fornece %.250s pero hase eliminar.
  %s (%s) fornece %s.
  O paquete %s espera o procesamento dos disparadores.
  O paquete %s aínda non está configurado.
  O paquete %s non está instalado.
  Hase eliminar o paquete %s.
  O paquete %s que fornece %s espera o procesamento dos disparadores.
  O paquete %s, que fornece %s, aínda non está configurado.
  O paquete %s, que fornece %s, non está instalado.
  Hase eliminar o paquete %s, que fornece %s.
  A versión de %s no sistema é %s.
  A versión de %s a configurar é %s.
 %d en %s:   %s (%s) rompe %s e está %s.
 %s (non é un ficheiro normal)
 ==> Gárdase o ficheiro de configuración antigo por defecto.
 ==> O distribuidor do paquete fornece unha versión actualizada.
 ==> Emprégase o ficheiro actual como solicitou.
 ==> Emprégase o novo ficheiro de configuración por defecto.
 ==> Emprégase o novo ficheiro como solicitou.
 A acción por defecto é instalar a nova versión.
 A acción por defecto é gardar a versión actual.
 e  depende de %s (subproceso): %s
%s rompe %s%s ten conflictos con %s%s depende de %s%s mellora %s%s pre-depende de %s%s recomenda %s%s suxire %s"%s" choca con "%s"campo "%s", nome de paquete "%.255s" non válido: %scampo "%s", falla o nome do paquete, ou hai lixo onde se esperaba o nome dun paquetecampo "%s", referencia a "%.255s":
 "%c" está obsoleto, empregue "%c=" ou "%c%c" no seu cantocampo "%s", referencia a "%.255s":
 relación de versións %c%c incorrectacampo "%s", referencia a "%.255s":
 coincidencia exacta implícita no número de versión, suxírese empregar "="campo "%s", referencia a "%.255s":
 o valor da versión comeza por un carácter non alfanumérico, suxírese engadir un espazocampo "%s", referencia a "%.255s": versión sen rematarcampo "%s", erro de sintaxe trala referencia ao paquete "%.255s"(Tense en conta a desaparición de %s, que foi substituido totalmente).
(A ler a base de datos ... (non hai unha descrición dispoñible), verqueuse a memoriaa opción -%c non toma un valora opción -%c toma un valor--%s --pending non toma ningún argumento que non sexa unha opción--%s --recursive precisa de alomenos un argumento de ruta--%s precisa do argumento de nome--%s precisa dos argumentos de nome e ruta--%s precisa dun argumento de nome de ficheiro .deb--%s precisa dun argumento de directorio--%s precisa dun só argumento--%s precisa dun directorio destino.
¿Pode ser que teña que empregar dpkg --install?--%s precisa de alomenos un argumento de ficheiro de arquivo de paquete--%s precisa de alomenos un argumento de nome de paquetea opción --%s non toma un valora opción --%s toma un valor--%s toma como moito dous argumentos (.deb e directorio)--%s non toma ningún argumento--%s toma só un argumento (nome de ficheiro .deb)--auto precisa de exactamente un argumento de ficheiro de partes--auto precisa de que se empregue a opción --outputrelación incorrecta para --compare-versions--compare-versions toma tres argumentos: <versión> <relación> <versión>--search precisa de alomenos un argumento de patrón de nomes de ficheiros--split precisa dun argumento de nome de ficheiro orixe--split toma como moito un ficheiro orixe e un prefixo de destino; nembargantes:
<deb> é o nome dun arquivo de formato Debian.
<ficheiroc> é o nome dun compoñente de ficheiro administrativo.
<campoc> é o nome dun campo do ficheiro "control" principal.

<descriptor do ficheiro de estado e progreso dos paquetes>A autenticar %s ...
Ordes:
  --check-supported                Comproba se a versión actual de dpkg
                                     ten soporte de disparadores.

Ordes:
  -s|--split <ficheiro> [<prefixo>]
                                   Parte un arquivo.
  -j|--join <parte> <parte> ...    Une varias partes.
  -I|--info <parte> ...            Amosa información dunha parte.
  -a|--auto -o <completo> <parte>  Autoacumula partes.
  -l|--listq                       Lista de anacos perdidos.
  -d|--discard [<ficheiro>]        Omite os anacos perdidos.

Os operadores de comparación para --compare-versions son:
  lt le eq ne ge gt       (tratan a versión baleira coma anterior a calquera);
  lt-nl le-nl ge-nl gt-nl (tratan a versión baleira coma posterior a calquera);
  < << <= = >= >> >       (só por compatibilidade cos ficheiros de control).

%s de Debian, versión %s.
Backend de arquivos de paquetes "%s" de Debian, versión %s.
Programa de xestión de paquetes "%s" de Debian versión %s.
Ferramenta para partir/unir paquetes de Debian "%s", versión %s.
Borrouse %s.
DescriciónApareceron erros ao procesar:
O ficheiro "%.250s" non é parte dun arquivo multipartes.
Sintaxe do formato:
  Un formato é unha cadea que se ha amosar por cada paquete. O formato pode
  incluír as secuencias de escape estándar \n (salto de liña), \r (retorno de
  carro) ou \\ (barra invertida). Pódese incluír información dos paquetes
  inserindo referencias variables aos campos do paquete empregando a sintaxe
  ${var[;ancho]}. Os campos van aliñados á dereita a menos que a anchura sexa
  negativa; neste caso hase empregar aliñamento á esquerda.
A instalar a nova versión do ficheiro de configuración %s ...
Ficheiros de lixo que quedan no directorio de armacén:
Desempaquetouse máis dunha copia do paquete %s nesta execución.
Só se configura unha vez.
NomeO paquete %s está retido, non se toca. Empregue --force-hold para o facer.
O paquete %s aparece máis dunha vez, só se procesa unha vez.
O paquete %s non contén ningún ficheiro (!)
Paquetes que aínda non se reensamblaron:
Arquivouse a parte %d do paquete %s (aínda quedan O procesamento deteuse porque houbo erros de máis.
Rexistrouse a información sobre %s de %s.
A substituír a información de paquetes dispoñibles, empregando %s.
A configurar %s (%s) ...
Os seguintes paquetes están a agardar o procesamento de disparadores que
activaron noutros paquetes. Este procesamento pódese solicitar empregando
dselect ou dpkg --configure --pending (ou dpkg --triggers-only):
Os seguintes paquetes están embarullados debido a problemas graves durante
a instalación. Teñen que se reinstalar para que eles (e outros paquetes
que dependan deles) funcionen correctamente:
Os seguintes paquetes están só configurados a medias, seguramente debido
a problemas ao configuralos a primeira vez. Debería volverse tentar a
configuración empregando dpkg --configure <paquete> ou a opción de menú
"configurar" de dselect:
Os seguintes paquetes están só instalados a medias, debido a problemas
durante a instalación. Seguramente se poida completar a instalación
se se volve tentar; os paquetes pódense eliminar empregando dselect
ou dpkg --remove:
Disparáronse os seguintes paquetes, pero aínda non se realizou o procesamento
dos disparadores. Pódese solicitar o procesamento dos disparadores empregando
dselect ou dpkg --configure --pending (ou dpkg --triggers-only):
Os seguintes paquetes desempaquetáronse pero non están configurados.
Deben configurarse empregando dpkg --configure ou a opción de menú
"configurar" de dselect para que funcionen:
Escriba "exit" cando teña rematado.
Escriba dpkg-deb --help para axuda sobre a manipulación de ficheiros *.deb;
Escriba dpkg --help para axuda sobre instalación e desinstalación de paquetes.Escriba dpkg-split --help para obter axuda.Escriba dpkg-trigger --help para obter axuda sobre esta utilidade.A actualizar a información de paquetes dispoñibles, empregando %s.
Emprego: %s [<opción> ...] <orde>

Versión[por defecto=N][por defecto=Y][non hai opción por defecto]o arquivo contiña un obxecto "%.255s" de tipo 0x%x descoñecidoo arquivo non ten retornos de carro na cabeceiraa agardar a que outro paquete procese disparadoresroto debido a unha eliminación ou instalación fallidaroto por un fallo no postinstnon se pode facer mmap do ficheiro de información de paquetes "%.255s"non se pode eliminar o antigo script de postrmnon se atopou o ficheiro de información de paquetes "%.255s"non se pode abrir "%.255s" (en "%.255s")non se pode abrir o ficheiro de partes do arquivo "%.250s"non se pode ler o directorio de informaciónnon se pode eliminar "%.250s"non se pode eliminar a copia do antigo ficheiro de configuración "%.250s" (de "%.250s")non se pode eliminar o antigo ficheiro de configuración "%.250s" (= "%.250s")non se pode eliminar a antiga lista de ficheirsonon se poden satisfacer as predependencias de %.250s (debido a %.250s)non se pode explorar o directorio "%.255s"non se pode explorar o directorio de actualizacións "%.255s"non se atopa "%.255s" (en "%.255s")non se admite o carácter "%c" (só se admiten letras, números e caracteres "%s")o ficheiro de configuración "%.250s" non aparece no paquetenon se atopa o ficheiro de configuración "%.250s"as accións -%c (--%s) e -%c (--%s) teñen un conflictohai desvíos en conflicto que involucran a "%.250s" ou "%.250s"paquetes con conflictos - non se instala %.250so directorio de control ten uns permisos %03lo incorrectos (deben estar entre 0755 e 0775)non se puido abrir "%i" para fluxoproblemas de dependencias - déixase sen configurarproblemas de dependencias - non se eliminadesvío feito por %s desde: %s
desvío feito por %s a: %s
o destino do desvío non pode conter saltos de liñadesviado por %s a: %s
rematado
paquete cun disparador en espera duplicado "%.255s"disparador de interese nun ficheiro duplicado para o ficheiro "%.250s" e o paquete "%.250s"ruta %s duplicadadisparador pendente "%.255s" duplicadoligazón escrava %s duplicadavalor duplicado para o campo "%s"valor duplicado para o campo definido polo usuario "%.*s"recibiuse unha cadea baleira de fgets ao ler os ficheiros de configuraciónnon se admiten disparadores con nomes en brancoa época na versión non é un númeroerro ao pechar %.250serro ao pechar o ficheiro de configuración "%.255s"erro ao pechar ou gravar en "%.255s"erro ao crear o dispositivo "%.255s"erro ao crear o directorio "%.255s"erro ao crear a ligazón dura "%.255s"erro ao crear a canle "%.255s"erro ao crear a ligazón simbólica "%.255s"erro ao asegurarse de que "%.250s" non existeerro ao abrir o ficheiro de ficheiros de configuraciónerro ao ler %.250serro ao ler %s do ficheiro %.255serro ao ler o ficheiro de ficheiros de configuraciónerro ao ler da canle de dpkg-deberro ao ler o ficheiro de disparadores pospostos "%.250s"erro ao establecer o propietario de "%.255s"erro ao establecer o propietario da ligazón simbólica "%.255s"erro ao establecer os permisos de "%.255s"erro ao establecer as marcas de tempo de "%.255s"erro ao tentar abrir %.250serro ao des-capturar o sinal %s: %s
erro ao gravar "%s"erro ao gravar no erro estándar, descubriuse antes de preguntar polo ficheiro de configuraciónnon se puido reservar memorianon se puido cambiar a "%.255s"non se puido cambiar ao directorionon se puido facer chroot a "%.250s"non se puido pechar despois de ler: "%.255s"non se puido crear o directorionon se puido crear unha canlea chamada a dup2 fallou para o descritor %da chamada a dup2 fallou para std%snon se atopou o arquivonon se atopou o ficheiro de desvíosnon se atopou o ficheiro "statoverride"non se puido abrir o ficheiro de desvíosnon se puido abrir o ficheiro de información de paquetes "%.255s" para lecturanon se puido abrir o ficheiro "statoverride"non se pode abrir o ficheiro de disparadores de interese "%.250s"non se pode ler "%.255s" (en "%.255s")non se puido ler o arquivo "%.255s"non se puido borrar o ficheiro de actualizacións incorporado %.255snon se puido eliminar o ficheiro de actualizacións %.255snon se pode retroceder no ficheiro de disparadores de interese "%.250s"non se puido atopar (desreferenciar) a ligazón simbólica existente "%.250s"non se puido atopar (desreferenciar) o novo destino proposto "%.250s" para a ligazón simbólica "%.250s"non se puideron gravar os detalles de "%.50s" en "%.250s"fgets devolveu unha cadea baleira de "%.250s"o nome de campo "%.*s" debe ir seguido dun signo de dous puntoso ficheiro "%.250s" está corrompido - falla "%.250s"o ficheiro "%.250s" está corrompido - suma MD5 "%.250s" incorrectao ficheiro "%.250s" está corrompido - díxito incorrecto (código %d) en "%s"o ficheiro "%.250s" está corrompido - número máxico incorrecto na fin da primeira cabeceirao ficheiro "%.250s" está corrompido - número máxic incorrecto na fin da segunda cabeceirao ficheiro "%.250s" está corrompido - carácter de recheo incorrecto (código %d)o ficheiro "%.250s" está corrompido - falla un retorno de carro tras "%.250s"o ficheiro "%.250s" está corrompido - hai caracteres nulos na sección de informacióno ficheiro "%.250s" está corrompido - o segundo membro non é un membro de datoso ficheiro "%.250s" está corrompido - o tamaño é incorrecto para o número de parte citadoo ficheiro "%.250s" está corrompido - curto de máiso ficheiro "%.250s" está corrompido - número de partes incorrecto para os tamaños citadoso ficheiro "%.250s" non é unha parte do arquivoo ficheiro "%s" non é unha parte do arquivo
o nome do ficheiro non pode conter saltos de liñao rexistro de disparadores de ficheiro menciona o paquete de nome non válido "%.250s" (para un interese no ficheiro "%.250s"): %.250so nome de ficheiro "%s" non é absolutoos ficheiros "%.250s" e "%.250s" non son partes do mesmo ficheiroa lista de ficheiros do paquete "%.250s" contén un nome de ficheiro baleiroa chamada a fork fallounome de paquete non válido na liña %d: %.250snome de paquete non válido no disparador en espera "%.255s": %snome de disparador pendente "%.255s" non válido: %sinstalación de %.250sinstaladoa instalación de %.250s había romper %.250s, e
 non se permite a desconfiguración (--auto-deconfigure pode axudar)a instalación de %.250s había romper software existentenúmero enteiro non válido para --%s: "%.250s"sintaxe non válida ou descoñecida no nome do disparador "%.250s" (nos disparadores de interese para o paquete "%.250s")nome de paquete "%.250s" non válido no ficheiro de disparadores pospostos "%.250s"a ligazón %s é primaria e escrava ao mesmo tempodesvío local desde: %s
desvío local a: %s
desviado localmente a: %s
o script de mantedor "%.50s" ten uns permisos %03lo incorrectos (deben estar entre 0555 e 0775)o script de mantedor "%.50s" non é un ficheiro normal ou ligazón simbólicanon se atopa o script de mantedor "%.50s"non pode ser unha cadea baleiraincongruencia no destino do desvío
  ao eliminar "%s"
  atopouse "%s"incongruencia no paquete
  ao eliminar "%s"
  atopouse "%s"o nome %s é primario e escravo ao mesmo tempoprecísase dunha opción de acciónsalto de liña no nome de campo "%.*s"non se admiten saltos de liña nos ficheiros de update-alternatives (%s)non hai información de paquetes en "%.255s"non hai ningún paquete chamado "%s", non se pode configurarsen instalarsen instalar pero hai ficheiros de configuraciónnon hai hada despois dos dous puntos no número de versióna antiga versión do paquete ten un nome de ficheiro de información longo de máis, que comeza por "%.250s"a apertura do compoñente "%.255s" (en %.255s) fallou dun xeito inesperadoesgotouse a memoria para unha nova entrada de limpezaesgotouse a memoria para unha nova entrada de limpeza con argumentos de máiso paquete %.250s xa está instalado e configuradoo paquete %.250s non está listo para a súa configuración
 non se pode configurar (estado actual "%.250s")o paquete %.250s non está listo para o procesamento dos disparadores
 (estado actual "%.250s" sen disparadores pendentes)a arquitectura do paquete (%s) non coincide co sistema (%s)o paquete contén un nome de ficheiro de información de control longo de máis (que comeza por "%.50s")a información de control do paquete contiña o directorio "%.250s"a proba de borrar o ficheiro de control do paquete "%.250s" coma directorio non deu un erro por non ser un directorioo paquete desvía outros a: %s
o paquete ten estado %s pero hai disparadores en esperao paquete ten estado %s pero hai disparadores pendenteso nome do paquete non pode conter saltos de liñao nome do paquete ten caracteres que non son alfanuméricos minúsculos ou "-+."falla a parte %do ficheiro de partes "%.250s" non é un ficheiro normalo tamaño da parte é grande de máis ou non é positivoaprobado
problema de predependencias - non se instala %.250sa prioridade ten que ser un número enteiroerro de lectura en %.250serro de lectura en "%.250s"erro de lectura no ficheiro de configuración "%.255s"erro de lectura na entrada estándarerro de lectura na entrada estándar na pregunta do ficheiro de configuraciónficheiro de paquete reensambladoeliminación de %.250so cambio de nome supón sobrescribir "%s" co
  ficheiro diferente "%s", non se permitea operación solicitada precisa de privilexios de superusuariobuscouse, pero non se atopou ningún paquete (ficheiros que encaixan con *.deb)atopáronse varias entradas de información do paquete, só se admite unhaa ligazón escrava é igual á ligazón principal %so ficheiro de orixe "%.250s" non é un ficheiro normalo ficheiro "statoverride" contén unha liña baleiraomítese o "/" ao finalo subproceso %s devolveu o estado de saída de erro %derro de sintaxe no ficheiro de disparadores de ficheiro "%.250s"o destino é un directorio - non se pode omitir a comprobación do ficheiro de controlhai varias versións da parte %d - alomenos "%.250s" e "%.250s"non hai un script na nova versión do paquete - abandónaseliña longa de máis ou falla un retorno de carro en "%.250s"erro de sintaxe no ficheiro de disparadores de interese "%.250s"; nome de paquete "%.250s" non válido: %.250so nome do disparador contén un carácter non válidodisparadoo ficheiro ci de disparadores "%.250s" contén unha sintaxe de disparador non válida no nome de disparador "%.250s": %.250so ficheiro ci de disparadores contén unha directiva descoñecida "%.250s"o ficheiro ci de disparadores contén unha sintaxe de directiva non coñecidaos disparadores están nun ciclo, abandónanseténtase sobrescribir "%.250s", que é a versión desviada de "%.250s"téntase sobrescribir "%.250s", que é a versión desviada de "%.250s" (paquete: %.100s)non se pode (volver) abrir o ficheiro de partes de entrada "%.250s"non se pode comprobar a existencia de "%.250s"non se pode comprobar a existencia do arquivo "%.250s"non se pode cambiar o propietario da copia da ligazón simbólica "%.255s"non se pode limpar o barullo que rodea a "%.255s" antes de instalar outra versiónnon se pode pechar o novo ficheiro de disparadores pospostos "%.250s"non se pode pechar o estado actualizado de "%.250s"non se pode crear "%.255s"non se pode crear o directorio de estado dos disparadores "%.250s"non se pode borrar o ficheiro de información de control "%.250s"non se pode borrar o ficheiro de armacén empregado "%.250s"non se pode descartar "%.250s"non se pode encher %.250s con caracteres de recheonon se pode baleirar %.250s despois do recheonon se pode baleirar o buffer co estado actualizado de "%.250s"non se atopa o ficheiro de orixenon se pode sincronizar o estado actualizado de "%.250s"non se pode instalar "%.250s" coma "%.250s"non se pode instalar o (suposto) novo ficheiro de información "%.250s"non se pode instalar o novo ficheiro de información "%.250s" coma "%.250s"non se pode instalar o novo ficheiro de disparadores pospostos "%.250s"non se pode instalar unha nova versión de "%.255s"non se pode instalar o estado actualizado de "%.250s"non se pode facer unha copia da ligazón simbólica "%.255s" antes de instalar a nova versiónnon se pode facer unha copia da ligazón simbólica "%.255s"non se pode apartar "%.255s" para instalar a nova versiónnon se pode abrir o novo ficheiro de armacén "%.250s"non se pode abrir o ficheiro de saída "%.250s"non se pode abrir o ficheiro orixe "%.250s"non se pode abrir o directorio de control temporalnon se pode abrir o ficheiro ci de disparadores "%.250s"non se pode abrir o ficheiro de disparadores pospostos "%.250s"non se pode abrir/crear o novo ficheiro de disparadores pospostos "%.250s"non se pode ler o directorio de armacén "%.250s"non se pode ler o ficheiro de disparadores de ficheiro "%.250s"non se puido ler os modificadores do descritor de ficheiros de %.250snon se pode ler a ligazón "%.255s"non se pode ler o ficheiro de partes "%.250s"non se pode eliminar a versión recén extraída de "%.250s"non se pode eliminar a versión recén instalada de "%.250s"non se pode eliminar a versión recén instalada de "%.250s" para permitir a reinstalación da copia de seguridadenon se pode eliminar o ficheiro de información obsoleto "%.250s"non se pode cambiar o nome do ficheiro de armacén "%.250s" a "%.250s"non se pode reabrir o ficheiro de partes "%.250s"non se pode recuperar a copia de seguridade de "%.250s"non se pode ir ao comezo de %.250s despois do recheonon se puido establecer o modificador close-on-exec de %.250snon se poden establecer permisos de execución en "%.250s"non se pode atopar o %s "%s.250s"non se atopa "%.250s"non se atopa o ficheiro de configuración instalado actualmente "%.250s"non se atopou outro ficheiro novo "%.250s"non se pode atopar o "%.255s" restaurado antes de instalar outra versiónnon se atopou o ficheiro de disparadores pospostos "%.250s"non se pode truncar para o estado actualizado de "%.250s"non se pode gravar no novo ficheiro de disparadores pospostos "%.250s"non se pode gravar o estado actualizado de "%.250s"datos inesperados tralo paquete e selección na liña %dfin de ficheiro inesperado en "%s" en %.255sfin de liña inesperada tralo nome do paquete na liña %dfin de liña inesperada no nome do paquete na liña %dargumento "%s" descoñecidotipo de compresión "%s" descoñecidoopción de forzar/rexeitar "%.*s" descoñecidaopción -%c descoñecidaopción --%s descoñecidaestado desexado non válido na liña %d: %.250sdesempaquetado pero sen configuraro directorio de actualizacións contén o ficheiro "%.250s", que ten un nome longo de máis (lonxitude=%d, máx=%d)o directorio de actualizacións contén ficheiros con nomes de lonxitudes diferentes (%d e %d)o nome do campo definido polo usuario "%.*s" é curto de máisa cadea de versión ten espazosa cadea de versión está baleiradebe especificar os paquetes polos seus nomes, non polos nomes dos ficheiros nos que viñanPK�m�\���$�$LC_MESSAGES/gettext-runtime.monu�[�����+t;��B�!��9MI�,��,�,+	'X	-�	 �	(�	(�	!
A
a
�n
ef:��!
���*�1�&=L"a9�I�������� F�-.%\A�X�!0? p6�5�,�1+#]-�-�%�%)�6b07������ ("="6U"2�"1�"�"#*#7H#I�#��#l$}$�$�$�$�$�$#$	(
 )!'*
"&%+  -V, --version               output version information and exit
  -d, --domain=TEXTDOMAIN   retrieve translated message from TEXTDOMAIN
  -e                        enable expansion of some escape sequences
  -E                        (ignored for compatibility)
  -h, --help                display this help and exit
  -V, --version             display version information and exit
  [TEXTDOMAIN]              retrieve translated message from TEXTDOMAIN
  MSGID MSGID-PLURAL        translate MSGID (singular) / MSGID-PLURAL (plural)
  COUNT                     choose singular/plural form based on this value
  -d, --domain=TEXTDOMAIN   retrieve translated messages from TEXTDOMAIN
  -e                        enable expansion of some escape sequences
  -E                        (ignored for compatibility)
  -h, --help                display this help and exit
  -n                        suppress trailing newline
  -V, --version             display version information and exit
  [TEXTDOMAIN] MSGID        retrieve translated message corresponding
                            to MSGID from TEXTDOMAIN
  -h, --help                  display this help and exit
  -v, --variables             output the variables occurring in SHELL-FORMAT
%s: invalid option -- '%c'
%s: option '%c%s' doesn't allow an argument
%s: option '%s' is ambiguous
%s: option '%s' is ambiguous; possibilities:%s: option '--%s' doesn't allow an argument
%s: option '--%s' requires an argument
%s: option '-W %s' doesn't allow an argument
%s: option '-W %s' is ambiguous
%s: option '-W %s' requires an argument
%s: option requires an argument -- '%c'
%s: unrecognized option '%c%s'
%s: unrecognized option '--%s'
Bruno HaibleCopyright (C) %s Free Software Foundation, Inc.
License GPLv3+: GNU GPL version 3 or later <http://gnu.org/licenses/gpl.html>
This is free software: you are free to change and redistribute it.
There is NO WARRANTY, to the extent permitted by law.
Display native language translation of a textual message whose grammatical
form depends on a number.
Display native language translation of a textual message.
If the TEXTDOMAIN parameter is not given, the domain is determined from the
environment variable TEXTDOMAIN.  If the message catalog is not found in the
regular directory, another location can be specified with the environment
variable TEXTDOMAINDIR.
Standard search directory: %s
If the TEXTDOMAIN parameter is not given, the domain is determined from the
environment variable TEXTDOMAIN.  If the message catalog is not found in the
regular directory, another location can be specified with the environment
variable TEXTDOMAINDIR.
When used with the -s option the program behaves like the 'echo' command.
But it does not simply copy its arguments to stdout.  Instead those messages
found in the selected catalog are translated.
Standard search directory: %s
In normal operation mode, standard input is copied to standard output,
with references to environment variables of the form $VARIABLE or ${VARIABLE}
being replaced with the corresponding values.  If a SHELL-FORMAT is given,
only those environment variables that are referenced in SHELL-FORMAT are
substituted; otherwise all environment variables references occurring in
standard input are substituted.
Informative output:
Operation mode:
Report bugs to <bug-gnu-gettext@gnu.org>.
Substitutes the values of environment variables.
Try '%s --help' for more information.
Ulrich DrepperUnknown system errorUsage: %s [OPTION] [SHELL-FORMAT]
Usage: %s [OPTION] [TEXTDOMAIN] MSGID MSGID-PLURAL COUNT
Usage: %s [OPTION] [[TEXTDOMAIN] MSGID]
or:    %s [OPTION] -s [MSGID]...
When --variables is used, standard input is ignored, and the output consists
of the environment variables that are referenced in SHELL-FORMAT, one per line.
Written by %s.
error while reading "%s"memory exhaustedmissing argumentsstandard inputtoo many argumentswrite errorProject-Id-Version: gettext-runtime 0.19.4.73
Report-Msgid-Bugs-To: bug-gnu-gettext@gnu.org
POT-Creation-Date: 2016-06-11 22:08+0900
PO-Revision-Date: 2015-09-09 16:05+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Poedit 1.5.4
  -V, --version               Mostra a información da versión e sae
  -d, --domain=DOMINIO      obter a mensaxe traducida do DOMINIO
  -e                        permitir a expansión de algunhas secuencias de escape
  -E                        (ignorada por compatibilidade)
  -h, --help                mostrar esta axuda e saír
  -V, --version             mostrar a información da versión e saír
  [DOMINIO]                 obter a mensaxe traducida do DOMINIO
  MSGID MSGID-PLURAL        traducir MSGID (singular) / MSGID-PLURAL (plural)
  NÚMERO                    escoller a forma singular/plural segundo este valor
  -d, --domain=DOMINIO      obter as mensaxes traducidas do DOMINIO
  -e                        permitir a expansión de algunhas secuencias
                            de escape
  -E                        (ignorado por compatibilidade)
  -h, --help                mostrar esta axuda e saír
  -n                        suprimir o carácter final de nova liña
  -V, --version             mostrar a información da versión e saír
  [DOMINIO] MSGID           obter a mensaxe traducida correspondente a
                            MSGID do DOMINIO
  -h, --help                  Mostra esta mensaxe de axuda e sae
  -v, --variables             escribe na saída as variábeis atopadas en FORMATO-SHELL
%s: opción incorrecta -- «%c»
%s: a opción «%c%s» non permite un argumento
%s: a opción «%s» é ambigua
%s: a opción «%s» é ambigua; as posibilidades son:%s: a opción «--%s» non permite ningún argumento
%s: a opción «--%s» require un argumento
%s: a opción «-W %s» non permite un argumento
%s: a opción «-W %s» é ambigua
%s: a opción «-W %s» require un argumento
%s: a opción require un argumento -- «%c»
%s: opción «%c%s» non recoñecida
%s: opción «--%s» non recoñecida
Bruno HaibleCopyright (C) %s Free Software Foundation, Inc.
Licenza GPLv3+: GNU GPL versión 3 ou posterior <http://gnu.org/licenses/gpl.html>
Isto é software libre: ten a liberdade para cambialo e redistribuílo.
Non hai GARANTÍAS, ata onde o permita a lei.
Mostra a tradución a un idioma dunha mensaxe de texto cuxa forma gramatical depende dun número.
Mostra a tradución nun idioma dunha mensaxe de texto.
Se non se indica o parámetro DOMINIO, o dominio determínase a partir da
variábel de ambiente TEXTDOMAIN. Se o catálogo de mensaxes non está no
directorio habitual, pódese especificar outro mediante a variábel de
ambiente TEXTDOMAINDIR.
Directorio estándar de busca: %s
Se non se indica o parámetro DOMINIO, o dominio determínase a partir da
variábel de ambiente TEXTDOMAIN. Se o catálogo de mensaxes non está no
directorio habitual, pódese especificar outro mediante a variábel
TEXTDOMAINDIR.
Cando se usa a opción -s, o programa compórtase como a orde «echo». Pero
non só copia os argumentos á saída, senón que traduce as mensaxes que atopa
no catálogo escollido.
Directorio estándar de busca: %s
No modo de operación normal, a entrada estándar cópiase á saída estándar,
con referencias ás variábeis de ambiente da forma $VARIABLE ou ${VARIABLE}
substituíndoas cos valores correspondentes. se se fornece un FORMATO-SHELL,
só se substitúen aquelas variábeis referidas en FORMATO-SHELL; senón
substitúense todas as referencias a variábeis que se atopen na entrada
estándar.
Saída informativa:
Modo de funcionamento:
Envíe informes de fallo a <bug-gnu-gettext@gnu.org>.
Substitúe os valores das variábeis de ambiente.
Use «%s --help» para obter máis información.
Ulrich DrepperErro de sistema descoñecidoModo de uso: %s [OPCIÓN] [FORMATO-SHELL]
Uso: %s [OPCIÓN] [DOMINIO] MSGID MSGID-PLURAL NÚMERO
Uso:   %s [OPCIÓN] [[DOMINIO] MSGID]
ou:    %s [OPCIÓN] -s [MSGID]...]
Cando se emprega --variables, ignórase a entrada estándar, e a saída consiste
nas variábeis de ambiente que se referencian en FORMATO-SHELL, unha por liña.
Escrito por %s.
erro ao ler "%s"memoria esgotadafaltan argumentosentrada estándardemasiados argumentoserro de escrituraPK�m�\ԊhM]]LC_MESSAGES/man-db-gnulib.monu�[�����-�=�����
,),V,�'�-� ('(Py����$
/As\����#2Mafn������-�)=Nd*y���

�
�
!�
5�
65J,�6�#�--6%d%�&�#��)
A
^
�}
$,6#c"�"�����#7KZ9_&����7%	! ("'%#
+-,)*
&$  or:  [OPTION...]%s: Too many arguments
%s: invalid option -- '%c'
%s: option '%c%s' doesn't allow an argument
%s: option '%s' is ambiguous; possibilities:%s: option '--%s' doesn't allow an argument
%s: option '--%s' requires an argument
%s: option '-W %s' doesn't allow an argument
%s: option '-W %s' is ambiguous
%s: option '-W %s' requires an argument
%s: option requires an argument -- '%c'
%s: unrecognized option '%c%s'
%s: unrecognized option '--%s'
Invalid character class nameInvalid collation characterInvalid content of \{\}Invalid preceding regular expressionInvalid range endInvalid regular expressionMandatory or optional arguments to long options are also mandatory or optional for any corresponding short options.Memory exhaustedNAMENo matchNo previous regular expressionPremature end of regular expressionRegular expression too bigReport bugs to %s.
SECSSuccessTrailing backslashUnknown system errorUnmatched ( or \(Unmatched ) or \)Unmatched [ or [^Unmatched \{Usage:failed to return to initial working directorygive a short usage messagegive this help listmemory exhaustedprint program versionset the program nameunable to record current working directoryProject-Id-Version: gnulib 3.0.0.6062.a6b16
Report-Msgid-Bugs-To: bug-gnulib@gnu.org
POT-Creation-Date: 2016-12-12 12:10+0000
PO-Revision-Date: 2012-11-11 13:26+0200
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8-bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=(n != 1);
  ou:  [OPCIÓN...]%s: Demasiados argumentos
%s: opción incorrecta -- «%c»
%s: a opción «%c%s» non permite ningún argumento
%s: a opción «%s» é ambigua; as posibilidades son:%s: a opción «--%s» non permite ningún argumento
%s: a opción «--%s» require un argumento
%s: a opción «-W %s» non permite ningún argumento
%s: a opción «-W %s» é ambigua
%s: a opción «-W %s» require un argumento
%s: a opción require un argumento -- «%c»
%s: opción «%c%s» non recoñecida
%s: opción «--%s» non recoñecida
Nome da clase de caracteres incorrectoCarácter de ordenación incorrectoContido de \{\} non válidoExpresión regular precedente non válidaFin de intervalo non válidoExpresión regular non válidaOs argumentos obrigatorios ou opcionais das opcións longas son tamén obrigatorios ou opcionais para calquera opción curta que se corresponda.Memoria esgotadaNOMESen coincidenciasNon hai ningunha expresión regular anteriorFin prematura da expresión regularExpresión regular grande de máisEnvíe os informes de fallo a %s.
SECSÉxitoBarra invertida ao finalErro do sistema descoñecido( ou \( sen parella) ou \) sen parella[ ou [^ sen parella\{ sen parellaUso:non foi posíbel volver ao directorio de traballo inicialdevolve unha mensaxe curta sobre o usodevolve esta lista de axudamemoria esgotadamostra a versión do programadefine o nome do programanon foi posíbel gravar o directorio de traballo actualPK�m�\���(Y(YLC_MESSAGES/iso_639-2.monu�[�������(	(($(*(2(A(F(	O(Y(p(u(z(�(�(�(�(�(�(�(�(	�(�(�(�(%)')<)&E)l)�)�)�)�)�)�)�)�)�)�)�)**#*(*0*7*G*
W*b*h*p*�*�*�*	�*�*�*!�*%�*++++	$+.+5+=+C+V+j+r+!�+
�+�+�+�+�+�+�+�+�+,,',>,PF,�,�,3�,�,�,�,�,-
--"$-!G-%i-�-�-�-�-�-�-�-�-�-�-...0.6.T.c.i.r.�.�.�.�.�.�.�.�.	�.�.//
/// /'/:/B/Y/]/d/�/�/�/�/�/�/�/�/�/�/�/�/�/#0(0H0
[0f0	l0v0}0�0�0�0�0�0�0�0�0�0�01
1-1@1	F1P1X1	d1n1s1	x1�1�1
�1�1
�1�1�1
�1�1:�12	72A2I2[2a2z2�2�2�2�2�2
�2	�2�2�2�2
33%3-343@3P3Y3i3	r3|3�3�3�3�3�3�3�3�3�3�3�3�34
4
4"454;4C4J4R4Y4`4f4{44�4�4 �4�4
�4�4.�4
555
 5+5	35=5C5\5c5
�5�5�5�5�5�5�5	�5�5�5�5�5�5�5�56	66%6*666>6D6T6Z6j6	v6�6�6�6�6	�6�6�6�6�6�6�6�67%7C7
J7U7i7p7u7�7�7%�7�7
�7�78
8	%8%/8U8f8o8x8~8>�8�8�8�8�8�8�89999
+969
G9R9c9�9�9�9
�9	�9�9
�9�9�9:

:: :?:V:h:p:w:}:�:�:�:�:�:�:�:�:	�:�:�:�:�:;;;!;';9;B;I;X;`;g;z;�;
�;�;�;�;	�;�;�;�;<<<-<
<<J<]<j<q<	z<�<�<�<�<!�<�<�<�<
�<�<�<�<�<=	====#=)=2=8=<=	D=N=
V=d=	z=�=�=�=�=�=�=�=�=�=�=�=�=�=		>>>->
:>H>M>S>W>
]>h>q>w>�>�>�>�>�>�>�>�>�>�>�>�>�>�>?.?7?>?M?R?�W?	AAA&A.A5A:A	CAMAdAiAoAvA	A�A�A�A�A�A�A	�A�A�A�A�AB'B'/BWBkB�B�B	�B�B�B�B�B�B�B�B�B
�BC
CC
"C0C
=CHCNC_CqCzC�C	�C�C�C!�C'�C�C
DDD&D/D7D?DEDZDnDvD$�D
�D�D�D�D�D�D�D�D�DEE'E?EcGE�E�E4�E�E
FF#F)F.F4F/OF0F1�F,�FGG&G,G3G@GSGdGjG�G�G�G�G!�G �G
�GHH!H&H7H>HFHNHkH�H	�H�H�H�H�H�H�H�H�H�H�H�H�H!�HI:ICIHIKIgIwI~I�I�I�I	�I�I%�I�I�I
JJ	JJ#J)JAJWJ	`JjJ|J�J�J�J�J�J�J.�J�J	�JKKK#K(K	-K7K;K@KLK
RK]KmK	�K
�K:�K�K	�K�K�KL-LKLfLxL�L�L�L�L
�L�L�L�L
�L�L�LMMM	(M
2M@MIMZM_MfMlM�M�M�M	�M�M�M	�M�M�M	�M�M�M�MNNN!N)NINPNVNiNrNyN	�N�N�N�N�N:�N
�N�N�N
	OO	O&O,ODO
KO	YOcOlOsO|O�O�O�O�O�O�O�O	�O�O�O�O�O�OP
P!P)P
/P=PCPSP	_PiPpPwP�P�P�P�P
�P�P�P�P�P�PQQ
#Q.QBQKQPQlQ�Q*�Q�Q�Q"�Q�Q
�Q

R'R@RORXRaRgR<mR�R�R�R�R�R�R�R�R�R�RSS
S%S5SRS XSyS�S
�S�S
�S�S�S�S�S�S!�ST$T4T=TETTTYTlT~T�T�T�T
�T�T�T�T�T�T�T�T�T�T�T�T	UU!U3UFU	MUWUnU
�U�U�U�U�U�U�U�U�U�U�UVVV1V>VEV	MVWV\VdVjV%pV�V�V	�V�V�V�V�V�V�V�V�V�V�V�V
WWWW	W'W
0W>W	RW\W	cWmW
uW�W�W	�W�W	�W�W�W
�W�W�W�W�WX
XX X'X+X
1X<XEXKX\XcXiXoXvX�X�X�X�X�X�X�X
�X
�X�X.�XYYY#Y���������#�4"��v� mA�L���g%.����0��9�l$V���u��-Ou)@_�F��������d]D�8KX�_�^�;�$�:[��J�P���~��H�����:B�t�z�cSp��1�����A\�E1ZsY�|���@h�f�K/�2��8H"!6M%/���	���?��2T���ykwg��^�;E������x&('�3kw
��s�<C�77���GN�e�*,�~b��&�)e���pD3o
�	n]r�+xU�j�L��h{l�`�v���j�4��U9�f���iy��=�(V����*
�0����X�-,><br.��F�a���T��=W�OQ��NZ?�����n��}qo��Jm��I�P5�i5�`B�R����G�{!W���>�Y
��+����q��S����[c��I� ���}��CaQ�����'����|��\6t�����dR�#����Mz���AbkhazianAchineseAcoliAdangmeAdyghe; AdygeiAfarAfrihiliAfrikaansAfro-Asiatic languagesAinuAkanAkkadianAlbanianAleutAlgonquian languagesAltaic languagesAmharicAngikaApache languagesArabicAragoneseArapahoArawakArmenianAromanian; Arumanian; Macedo-RomanianArtificial languagesAssameseAsturian; Bable; Leonese; AsturleoneseAthapascan languagesAustralian languagesAustronesian languagesAvaricAvestanAwadhiAymaraAzerbaijaniBalineseBaltic languagesBaluchiBambaraBamileke languagesBanda languagesBasaBashkirBasqueBatak languagesBeja; BedawiyetBelarusianBembaBengaliBerber languagesBhojpuriBihari languagesBikolBini; EdoBislamaBlin; BilinBlissymbols; Blissymbolics; BlissBokmål, Norwegian; Norwegian BokmålBosnianBrajBretonBugineseBulgarianBuriatBurmeseCaddoCatalan; ValencianCaucasian languagesCebuanoCeltic languagesCentral American Indian languagesCentral KhmerChagataiChamic languagesChamorroChechenCherokeeCheyenneChibchaChichewa; Chewa; NyanjaChineseChinook jargonChipewyan; Dene SulineChoctawChurch Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church SlavonicChuukeseChuvashClassical Newari; Old Newari; Classical Nepal BhasaClassical SyriacCopticCornishCorsicanCreeCreekCreoles and pidginsCreoles and pidgins, English basedCreoles and pidgins, French-basedCreoles and pidgins, Portuguese-basedCrimean Tatar; Crimean TurkishCroatianCushitic languagesCzechDakotaDanishDargwaDelawareDinkaDivehi; Dhivehi; MaldivianDogriDogribDravidian languagesDualaDutch, Middle (ca. 1050-1350)Dutch; FlemishDyulaDzongkhaEastern FrisianEfikEgyptian (Ancient)EkajukElamiteEnglishEnglish, Middle (1100-1500)English, Old (ca. 450-1100)ErzyaEsperantoEstonianEweEwondoFangFantiFaroeseFijianFilipino; PilipinoFinnishFinno-Ugrian languagesFonFrenchFrench, Middle (ca. 1400-1600)French, Old (842-ca. 1400)FriulianFulahGaGaelic; Scottish GaelicGalibi CaribGalicianGandaGayoGbayaGeezGeorgianGermanGerman, Middle High (ca. 1050-1500)German, Old High (ca. 750-1050)Germanic languagesGilberteseGondiGorontaloGothicGreboGreek, Ancient (to 1453)Greek, Modern (1453-)GuaraniGujaratiGwich'inHaidaHaitian; Haitian CreoleHausaHawaiianHebrewHereroHiligaynonHimachali languages; Western Pahari languagesHindiHiri MotuHittiteHmong; MongHungarianHupaIbanIcelandicIdoIgboIjo languagesIlokoInari SamiIndic languagesIndo-European languagesIndonesianIngushInterlingua (International Auxiliary Language Association)Interlingue; OccidentalInuktitutInupiaqIranian languagesIrishIrish, Middle (900-1200)Irish, Old (to 900)Iroquoian languagesItalianJapaneseJavaneseJudeo-ArabicJudeo-PersianKabardianKabyleKachin; JingphoKalaallisut; GreenlandicKalmyk; OiratKambaKannadaKanuriKara-KalpakKarachay-BalkarKarelianKaren languagesKashmiriKashubianKawiKazakhKhasiKhoisan languagesKikuyu; GikuyuKimbunduKinyarwandaKirghiz; KyrgyzKlingon; tlhIngan-HolKomiKongoKonkaniKoreanKosraeanKpelleKru languagesKuanyama; KwanyamaKumykKurdishKurukhKutenaiLadinoLahndaLambaLand Dayak languagesLaoLatinLatvianLezghianLimburgan; Limburger; LimburgishLingalaLithuanianLojbanLow German; Low Saxon; German, Low; Saxon, LowLower SorbianLoziLuba-KatangaLuba-LuluaLuisenoLule SamiLundaLuo (Kenya and Tanzania)LushaiLuxembourgish; LetzeburgeschMacedonianMadureseMagahiMaithiliMakasarMalagasyMalayMalayalamMalteseManchuMandarMandingoManipuriManobo languagesManxMaoriMapudungun; MapucheMarathiMariMarshalleseMarwariMasaiMayan languagesMendeMi'kmaq; MicmacMinangkabauMirandeseMohawkMokshaMon-Khmer languagesMongoMongolianMossiMultiple languagesMunda languagesN'KoNahuatl languagesNauruNavajo; NavahoNdebele, North; North NdebeleNdebele, South; South NdebeleNdongaNeapolitanNepal Bhasa; NewariNepaliNiasNiger-Kordofanian languagesNilo-Saharan languagesNiueanNo linguistic content; Not applicableNogaiNorse, OldNorth American Indian languagesNorthern FrisianNorthern SamiNorwegianNorwegian Nynorsk; Nynorsk, NorwegianNubian languagesNyamweziNyankoleNyoroNzimaOfficial Aramaic (700-300 BCE); Imperial Aramaic (700-300 BCE)OjibwaOriyaOromoOsageOssetian; OsseticOtomian languagesPahlaviPalauanPaliPampanga; KapampanganPangasinanPanjabi; PunjabiPapiamentoPapuan languagesPedi; Sepedi; Northern SothoPersianPersian, Old (ca. 600-400 B.C.)Philippine languagesPhoenicianPohnpeianPolishPortuguesePrakrit languagesPushto; PashtoQuechuaRajasthaniRapanuiRarotongan; Cook Islands MaoriReserved for local useRomance languagesRomanshRomanyRundiRussianSalishan languagesSamaritan AramaicSami languagesSamoanSandaweSangoSanskritSantaliSardinianSasakScotsSelkupSemitic languagesSerbianSererShanShonaSichuan Yi; NuosuSicilianSidamoSign LanguagesSiksikaSindhiSinhala; SinhaleseSino-Tibetan languagesSiouan languagesSkolt SamiSlave (Athapascan)Slavic languagesSlovakSlovenianSogdianSomaliSonghai languagesSoninkeSorbian languagesSotho, SouthernSouthern AltaiSouthern SamiSpanish; CastilianSranan TongoSukumaSumerianSundaneseSusuSwahiliSwatiSwedishSwiss German; Alemannic; AlsatianSyriacTagalogTahitianTai languagesTajikTamashekTamilTatarTeluguTerenoTetumThaiTibetanTigreTigrinyaTimneTivTlingitTok PisinTokelauTonga (Nyasa)Tonga (Tonga Islands)TsimshianTsongaTswanaTumbukaTupi languagesTurkishTurkish, Ottoman (1500-1928)TurkmenTuvaluTuvinianTwiUdmurtUgariticUighur; UyghurUkrainianUmbunduUncoded languagesUndeterminedUpper SorbianUrduUzbekVaiVendaVietnameseVolapükVoticWakashan languagesWalloonWarayWashoWelshWestern FrisianWolofXhosaYakutYaoYapeseYiddishYorubaYupik languagesZande languagesZapotecZaza; Dimili; Dimli; Kirdki; Kirmanjki; ZazakiZenagaZhuang; ChuangZuluZuniProject-Id-Version: iso_639-2
Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues
POT-Creation-Date: 2018-01-17 22:10+0100
PO-Revision-Date: 2010-10-02 07:52+0200
Last-Translator: Fran Diéguez <frandieguez@ubuntu.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n!=1);
AbxazianoAchinésAcolíAdangmeAdigueAfarAfrihiliAfrikaansIdiomas afroasiáticosAinuAkánAcadioAlbanésAleutianoIdiomas algonquinosIdiomas altáicosAmáricoAngikaIdiomas apachesÁrabeAragonésArapahoArawakArmenioArmenio; Macedonio romanésIdiomas artificiaisAsamésAsturiano; Bable; Leonés; AsturleonésIdiomas atabascanasIdiomas australianosIdiomas austronesiosAvarAvésticoAwadhiAimaráAzeríBalinésIdiomas bálticosBaluchiBambaraIdiomas bamilekeIdiomas bandaBasaaBashkirBasco; ÉuscaroIdiomas batakBeja; BedawiBielorrusoBembaBengalí; BanglaIdiomas bereberesBhojpuriIdiomas bihariBicolanoBini; EdoBislamaBilín; BilénBlissymbols; Blissymbolics; BlissBokmål, noruegués; Noruegués BokmålBosnioBrij; BrajBretónBugi; BuginésBúlgaroBuriatoBirmanoCaddoCatalán; ValencianoIdiomas caucasianosCebuanoIdiomas celtasIdiomas dos indios centro americanosXemer centralChagataiIdiomas chámicosChamorroChechenoCherokeeCheyenneChibchaChichewa; Chewa; NyanjaChinésChinookChipewyano; Dene SulineChoctawEslavo eclesiástico; Eslavo antigo; Búlgaro antigo; Macedonio antigo; Antigo eslavo eclesiásticoChuukésChuvache; ChuvashNewari Clásico; Newari Antigo; Nepal Bhasa ClásicoSiríaco clásicoCopto; CoptaCórnicoCorsoCreeCreekCrioulos e idiomas francosCrioulos e idiomas francos, baseados no inglésCrioulos e idiomas francos, baseados no francésCrioulos e idiomas francos, baseados no portugésTártaro da Crimea; Crimeano; Turco crimeanoCroataIdiomas cusitasChecoDacotaDinamarquésDarxínico; DargwaDelaware; LenapeDinkaDivehi; Dhivehi; Mahl; MaldivioDogriDogribIdiomas drávidasDualaHolandés medieval (ca.1050-1350)Neerlandés; Holandés; FlamengoDioula; DyulaDzonga; ButanésFrisio orientalEfikExipcio (antigo)EkajukElamitaInglésInglés medieval (1100-1500)Inglés, Antigo (ca. 450-1100)ErzyaEsperantoEstonioEweEwondoFangFantiFeroésFixianoFilipinoFinésIdiomas fino-ugriasFonFrancésFrancés medieval (ca. 1400-1600)Francés antigo (842-ca. 1400)FriulanoFulaGaGaélico; Gaélico escocésCaribe; GalibíGalegoGandaGayoGbayaGe'ezXeorxianoAlemánAlemán, alto medievo (ca. 1050-1500)Alemán, antigo (ca. 750-1050)Idiomas xermánicosXilbertésGondiGorontaloGóticoGreboGrego antigo (ata 1453)Grego moderno (1453-)GuaraníGuxaratíGwich'in; KutchinHaidaHaitiano; Crioulo haitianoHaúsaHawaianoHebreoHereróHiligainónIdiomas Himachali; Idiomas Pahari occidentalesHindiHiri MotuHititaHmong; MongHúngaroHupaIbanIslandésIdoIgboIdiomas ijoIlokoInari SamiIdiomas indicosIdiomas indo-europeosIndonesioIngushetioInterlingua (Asociación da Lingua Auxiliar Internacional)Interlingua: OccidentalInuktitutInupiaqIdiomas iranianosIrlandés; Gaélico irlandésIrlandés medieval (900-1200)Irlandés antigo (ata 900)Idiomas iroquesesItalianoXaponésXavanésXudeu-ÁrabeXudeu-PersaKabardianoKabyleKachin; JingphoKalaallisut; GroenlandésKalmyk; OiratKambaCanarésKanuriKara-KalpakKarachay-BalkarCarelianoIdiomas KarenCachemirCaxubio; CasubioKawiKazaxoKhasiIdiomas khoisán ou capoideKikuyu; GikuyuKimbunduQuiñaruandaQuirguizoKlingonKomiCongolésKonkaniCoreanoKosraeanoKpelleIdiomas KruKuanyama; KwanyamaKumykKurdoKurukhKutenaiLadino; Xudeoespañol; SefardíLahndaLambaIdiomas Land DayakLaosianoLatínLituanoLezghianoLimburguésLingalaLituanoLojbanBaixo alemán; Baixo saxón; Alemán, baixo; Saxón, baixoBaixo SorabioLoziLuba-KatangaLuba-LuluaLuisenoLule SamiLundaLuo (Quenia e Tanzania)LushaiLuxemburguésMacedonioMadurésMagahiMaithiliMakasarMalgacheMalaioMalaioMaltésManchúMandarMandingoManipuríIdiomas manoboGaélico manésMaoríMapuche; MapudungunMaratiMari; CheremísMarshalésMarwariMasaiIdiomas maiasMendeMi'kmaq; MicmacMinangkabauMirandésMohawkMokshaIdiomas Mon-KhmerMongoMongolMossiVarios idiomasIdiomas mundaN'KoIdiomas nahuatlNaurúNavajo; NavahoNdebele, Norte; Norte NdebeleNdebele, Sur; Sur NdebeleNdongaNapolitanoNepal Bhasa; NewariNepalésNiasIdiomas Niger-KordofanianosIdiomas Nilo-SaharianosNiuésSen contexto lingüístico; Non aplicábelNogaiNórdico antigoIdiomas indios de America do norteFrisio do norteSami do norteNorueguésNoruegués Nynorsk; Nynorsk, norueguésIdiomas nubiosNyamweziNyankoleNyoroNzimaArameo oficial (700-300 BCE); Arameo imperial (7700-300 BCE)OjibwaOrixaOromoOsageOsetioIdiomas otomíPahlaviPalauanoPaliPampanga; KapampanganPangasinánPunxabíPapiamentoIdiomas papúesPedi; Sepedi; Sotho do NortePersaPersa, antigo (ca. 600-400 B.C.)Idiomas filipinosFenicioPohnpeianoPolacoPortuguésIdiomas PrakritPushto; PachtuQuechúaRaxastanRapanuiRarotongan; Maorí das illas CookReservado para uso localIdiomas romacesRomancheRomanóRundi; KurundiRusoIdiomas SalishanosArameo samaritanoIdiomas SamiSamoanoSandaweSangoSánscritoSantaliSardoSasakEscocésSelkupIdiomas semíticosSerbioSererShanShonaYi Sinchuáni; NuosuSicilianoSidamoLinguas de signosSiksika; Pé-NegroSindhiCingalésIdiomas Sino-TibetanosIdiomas dos SiouxSami skoltSlave (Atabascano)Idiomas eslavosEslovacoEslovenoSogdianSomalíIdiomas SonghaiSoninkeIdiomas sorbosSotho do surAltai do SurSami do SurEspañol; CastelánSranan TongoSukumaSumerioSundanésSusuSuahiliSwaziSuecoAlemán suízo; Alemánico; AlsacianoSirioTagaloTahitianoIdiomas TaiTaxicoTamashekTamilTártaroTeluguTerenoTetumThaiTibetanoTigreTigriñésTimneTivTlingitTok PisinToquelauTonga (Nyasa)Tonga (Illas Tonga)TsimshianTsongaSetchwanaTumbukaIdiomas tupíTurcoTurco otomano (1500-1928)TurcomanoTuvaluTuvinianoTwiUdmurtUgaríticoUigurUcraínoUmbunduIdiomas sen codificarSen determinarAlto SorboUrduUzbecoVaiVendaVietnamitaVolapükVoticIdiomas WakashanValónWarayWashoGalésFrisio occidentalWolofXosaYakutYaoYapeseYiddishIorubaIdiomas YupikIdiomas zandeZapotecaZaza; Dimili; Dimli; Kirdki; Kirmanjki; ZazakiZenagaZhuang; ChuangZulúZuniPK�m�\��vˠ�LC_MESSAGES/initscripts.monu�[�����-�=�����*�%EM^
m { ����
+8Cd3���YW["�/�$(+(T(}"�.���1Nj!�7�4�F	6_	/�	&�	�	�
���3�+JRcz)�/�2� 
5
P
!k
0�
L�
-9@S\P�214%f*�*�&�(	02cl/���1�6*3aF�6�@)T!~	#,+"
!(&
 %'-*$) done. failed.$*$0: Usage: daemon [+/-nicelevel] {program}$0: configuration for ${1} not found.$STRING$base $killlevel$base shutdown$base startup${base} (pid $pid) is running...${base} dead but pid file exists${base} dead but subsys locked${base} is stoppedBringing up interface $i: Configured devices:Currently active devices:Determining IP information for ${DEVICE}...Device ${DEVICE} has different MAC address than expected, ignoring.Error occurred while calculating the IPv6to4 prefixFAILEDFailed to bring up ${DEVICE}.Global IPv6 forwarding is disabled in configuration, but not currently disabled in kernelGlobal IPv6 forwarding is enabled in configuration, but not currently enabled in kernelMissing config file $PARENTCONFIG.Missing parameter 'IPv4-tunnel address' (arg 2)Missing parameter 'IPv6 MTU' (arg 2)Missing parameter 'IPv6-address' (arg 2)Missing parameter 'IPv6-gateway' (arg 2)Missing parameter 'IPv6-network' (arg 1)Missing parameter 'device' (arg 1)Missing parameter 'local IPv4 address' (arg 2)PASSEDShutting down interface $i: Usage: $0 {start|stop|status|restart|condrestart}Usage: ifup <configuration>Usage: pidfileofproc {program}Users cannot control this device.error in $FILE: IPADDR_START and IPADDR_END don't agreeerror in $FILE: IPADDR_START greater than IPADDR_ENDerror in $FILE: already seen device $parent_device:$DEVNUM in $devseenerror in $FILE: already seen ipaddr $IPADDR in $ipseenerror in $FILE: didn't specify device or ipaddrerror in ifcfg-${parent_device}: filesusage: ifdown <configuration>Project-Id-Version: PACKAGE VERSION
Report-Msgid-Bugs-To: 
POT-Creation-Date: YEAR-MO-DA HO:MI+ZONE
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
PO-Revision-Date: 2015-03-13 03:01-0400
Last-Translator: Copied by Zanata <copied-by-zanata@zanata.org>
Language-Team: Galician (http://www.transifex.com/projects/p/fedora/language/gl/)
Language: gl
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Zanata 3.9.6
 feito. fallou.$*$0: Uso: daemon [+/-nivel de prioridade] {programa}$0: non se atopou a configuración de ${1}.$STRING$base $killlevelFinalización de $baseinicialización de $base${base} (pid $pid) está a se executar...${base} está morto, pero o ficheiro pid existe${base} está morto, pero o subsys está bloqueado${base} está paradoActivando a interface $i: Dispositivos configurados:Dispositivos activos actualmente:Determinando a información IP para ${DEVICE}...O dispositivo ${DEVICE} ten un enderezo MAC distinto do agardado, ignorando.Ocorreu un erro ao calcular o prefixo IPv6to4FALLOUFallo ao activar ${DEVICE}.O forwarding IPv6 global está deshabilitado na configuración, pero non no núcleoO forwarding IPv6 global está habilitado na configuración, pero non no núcleoFalla o ficheiro de configuración $PARENTCONFIG. Falla o parámetro 'IPv4-enderezo_túnel' (arg 2)Falla o parámetro 'IPv6 MTU' (arg 2)Falla o parámetro 'IPv6-enderezo' (arg 2)Falla o parámetro 'IPv6-pasarela' (arg 2)Falla o parámetro 'IPv6-rede' (arg 1)Falla o parámetro 'dispositivo' (arg 1)Falla o parámetro 'IPv4 enderezo local' (arg 2)SUPERADODesactivando a interface $i: Uso: $0 {start|stop|status|restart|condrestart}Uso: ifup <nome de dispositivo>Uso: pidfileofproc {programa}Os usuarios non poden controlar este dispositivo.erro en $FILE: IPADDR_START e IPADDR_END non concordanerro en $FILE: IPADDR_START é maior que IPADDR_ENDerro en $FILE: dispositivo $parent_device:$DEVNUM xa visto en $devseenerro en $FILE: enderezo ip $IPADDR xa visto en $ipseenerro en $FILE: non se especificou o dispositivo ou o enderezo IPerro en ifcfg-${parent_device}: ficheirosuso: ifdown <nome de dispositivo>PK�m�\�#2��LC_MESSAGES/iso_4217.monu�[�����/�C(:JY
iw
�
�
�����
��,8H
Uct����
�����&5BNeq~�
�	����aq�������		#	;	H	X	d	w	
�	�	�	�	�	�	�	
�	



$
6
E
V

b
p
�
�
�
�
�
�

(DTcs'%/-,(*
. $"	
)!#&+Algerian DinarAustralian DollarBahamian DollarBahraini DinarBarbados DollarBelize DollarBermudian DollarBrunei DollarBulgarian LevBurundi FrancCanadian DollarCayman Islands DollarChilean PesoColombian PesoCuban PesoDjibouti FrancDominican PesoEgyptian PoundFiji DollarGibraltar PoundGuinea FrancGuyana DollarHong Kong DollarIndian RupeeIranian RialIraqi DinarJordanian DinarKenyan ShillingKuwaiti DinarLiberian DollarLibyan DinarMexican PesoMoroccan DirhamNew Zealand DollarNorth Korean WonPound SterlingRwanda FrancSaudi RiyalSolomon Islands DollarSwiss FrancSyrian PoundTrinidad and Tobago DollarTunisian DinarUAE DirhamUS DollarZimbabwe DollarProject-Id-Version: iso_4217
Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues
POT-Creation-Date: 2018-01-17 22:10+0100
PO-Revision-Date: 2004-08-09 20:51+0100
Last-Translator: Jesús Bravo Álvarez <jba@pobox.com>
Language-Team: Galician <gpul-traduccion@ceu.fi.udc.es>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Dinar alxerianoDólar de AustraliaDólar das BahamasDinar de BahrainDólar das BarbadosDólar de BeliceDólar das BermudasDólar de BruneiLev búlgaroFranco de BurundiDólar canadianoDolar das illas caimánPeso chilenoPeso colombianoPeso cubanoFranco de DjiboutiPeso dominicanoLibra exipciaDólar das fijiLibra de XibraltarFranco guineanoDólar da GüianaDólar de Hong KongRupia indiaRial iranianoDinar iraquíDinar xordanoShilling quenianoDinar kuwaitíDólar liberianoDinar libioPeso mexicanoDirham marroquíDólar de Nova CelandiaWon de Corea do NorteLibra esterlina do Reino UnidoFranco ruandésRial de Arabia SaudíDólar das Illas SalomónFranco suízoLibra siriaDólar de Trinidad e TobagoDinar tunicianoDirham dos EUADólar dos EEUUDólar de CimbabuePK�m�\=����D�DLC_MESSAGES/sudo.monu�[������,�<
�

�
!�
(�
!6O#i��$��6�,9B+Iu��I��!#?8c�3�3� $>'c{�7.?n �����,#F)j>��
�(�&O@6�C�/);,e,�7�4�3,/`5�+�.�!! Cd'�7�-�./C^=�)�&
1+H"t7�&�*�2!)T5~>��+E \}&�!�J�>-l�#���� #52&h�1�"��%'Mi�/� �'/Jb~!�$��� +&  R s !� #� (� � !%7!]!}!�!�!(�!�!*"(,"U"o""�"�"1�"+�"%$#!J#)l#�#�#<�#2�#2&$6Y$#�$��$�&)�&+�&�&�&'9'0W'"�'�'6�' �'A(V(e(n(;u(�(�(�(G)L)^)-q)2�)P�))#*9M*:�*"�*'�*.
+�<+B�+>,P,*i,%�,3�,'�,'-->-,l-0�-0�-O�-!K.m...&�.q�.EG/U�/9�/302Q0:�0>�0;�07:12r1G�1P�14>2*s22�2 �2)�2R39o3"�3=�3g
4\r4*�4/�4*5<E5)�5B�50�5' 6?H60�64�64�6!#7)E7 o7�7'�7%�7.�7(*8[S8V�8 9'90F9!w9�9(�90�9:K-:8y:'�:F�:4!;V;u;5�;.�;�;'<:<8X<-�<6�<%�< =)==g=<�=3�=�=/>.C>Dr>.�>'�>;?4J?B?0�?4�?9(@/b@'�@2�@$�@.AAA1aA1�A�A*�A/B%<B@bB:�B/�BC.-C\CsCH�CE�CED@`D*�D/KIm�:4Hz)� 5;C7i\�
6�M��R
�E[�{2o��3N�]�'P��>c*VaA~�8j1��_W�f?0�Fn�T|("B�b9$h�%�<�k+�}ug=S	ld^,.!XD@Jy#Oxsv��QUt��`-Z�wpqeL&��rY��G�
Options:
%s - edit files as another user

%s - execute a command as another user

%s changed labels%s is group writable%s is not a regular file%s is not a valid context%s is owned by uid %u, should be %u%s is world writable%s left unmodified%s must be only be writable by owner%s must be owned by uid %d%s must be owned by uid %d and have the setuid bit set%s unchanged%s%s: %s%s: %s%s: editing symbolic links is not permitted%s: not a regular file%s: short writeConfigure options: %s
Only one of the -e, -h, -i, -K, -l, -s, -v or -V options may be specifiedSudo version %s
Unknown signalclose all file descriptors >= numcontents of edit session left in %scould not bind to default resource pool for project "%s"could not join project "%s"create SELinux security context with specified rolecreate SELinux security context with specified typedisplay help message and exitdisplay version information and exitedit files instead of running a commandeffective uid is not %d, is %s on a file system with the 'nosuid' option set or an NFS file system without root privileges?effective uid is not %d, is sudo installed setuid root?error in %s, line %d while loading plugin `%s'error in event looperror initializing I/O plugin %serror reading from pipeerror reading from signal pipeerror reading from socketpairfailed to get old_contextfailed to set new role %sfailed to set new type %sfatal error, unable to load pluginsin list mode, display privileges for userincompatible plugin major version %d (expected %d) found in %sinternal error, %s overflowinvalid valueinvalid value for %s `%s' in %s, line %uinvalidate timestamp filelist user's privileges or check a specific command; use twice for longer formatno askpass program specified, try setting SUDO_ASKPASSno resource pool accepting default bindings exists for project "%s"no tty present and no askpass program specifiednon-interactive mode, no prompts are usedonly a single policy plugin may be specifiedplugin error: missing file list for sudoeditpolicy plugin %s does not include a check_policy methodpolicy plugin %s does not support listing privilegespolicy plugin %s does not support the -k/-K optionspolicy plugin %s does not support the -v optionpolicy plugin %s is missing the `check_policy' methodpolicy plugin failed session initializationpreserve user environment when running commandread password from standard inputremove timestamp file completelyrequires at least one argumentresource control limit has been reachedrun command (or edit file) as specified user name or IDrun command as the specified group name or IDrun command in the backgroundrun command with the specified BSD login classrun login shell as the target user; a command may also be specifiedrun shell as the target user; a command may also be specifiedsesh: internal error: odd number of pathssesh: unable to create temporary filessesh: unknown error %dset HOME variable to target user's home dirsetproject failed for project "%s"specified resource pool does not exist for project "%s"stop processing command line argumentssudoedit is not supported on this platformthe `-A' and `-S' options may not be used togetherthe `-E' option is not valid in edit modethe `-U' option may only be used with the `-l' optionthe argument to -C must be a number greater than or equal to 3the invoking task is finalunable to add event to queueunable to allocate memoryunable to allocate ptyunable to change directory to %sunable to change root to %sunable to change to runas uid (%u, %u)unable to change uid to root (%u)unable to copy some of the temporary files back to their original locationunable to copy temporary files back to their original locationunable to create pipeunable to create socketsunable to determine enforcing mode.unable to dup2 stdinunable to execute %sunable to fgetfilecon %sunable to find symbol `%s' in %sunable to forkunable to get current tty context, not relabeling ttyunable to get default type for role %sunable to get group vectorunable to get new tty context, not relabeling ttyunable to initialize policy pluginunable to load %s: %sunable to open %sunable to open %s, not relabeling ttyunable to open audit systemunable to open userdbunable to read temporary fileunable to read the clockunable to remove PRIV_PROC_EXEC from PRIV_LIMITunable to restore context for %sunable to restore handler for signal %dunable to restore registryunable to restore stdinunable to restore tty labelunable to run %sunable to run %s as a login shellunable to save handler for signal %dunable to save stdinunable to send audit messageunable to set controlling ttyunable to set effective gid to runas gid %uunable to set exec context to %sunable to set gid to %uunable to set gid to runas gid %uunable to set handler for signal %dunable to set key creation context to %sunable to set new tty contextunable to set process priorityunable to set supplementary group IDsunable to set tty context to %sunable to set uid to %uunable to set user contextunable to stat %sunable to switch to registry "%s" for %sunable to write to %sunexpected child termination condition: %dunexpected reply type on backchannel: %dunexpected sudo mode 0x%xunknown login class %sunknown policy type %d found in %sunknown uid %u: who are you?update user's timestamp without running a commanduse a helper program for password promptinguse specified BSD authentication typeuse the specified password promptuser "%s" is not a member of project "%s"value too largevalue too smallwarning, resource control assignment failed for project "%s"you may not specify both the `-i' and `-E' optionsyou may not specify both the `-i' and `-s' optionsyou may not specify environment variables in edit modeyou must specify a role for type %sProject-Id-Version: sudo 1.8.15b1
Report-Msgid-Bugs-To: http://www.sudo.ws/bugs
PO-Revision-Date: 2015-09-15 10:41+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
X-Bugs: Report translation errors to the Language-Team address.
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Poedit 1.5.4

Opcións:
%s - edita ficheiros como outro usuario

%s - executa unha orde como outro usuario

%s etiquetas cambiadas%s é escribíbel polo grupo%s non é un ficheiro normal%s non é un contexto válido%s é propiedade de uid %u, pero debería ser %u%s é escribíbel por todo o mundo%s sen modificar%s só debe ter permisos de escritura polo propietario%s debe ser propiedade do uid %d%s debe ser propiedade do uid %d e debe ter definido o bit setuid%s sen cambios%s%s: %s%s: %s%s: a edición de ligazóns simbólicas non está permitida%s: non é un ficheiro regular%s: escritura curtaOpcións de configuración: %s
Só pode especificar unha das opcións -e, -h, -i, -K, -l, -s, -v ou -VSudo versión %s
Sinal descoñecidopecha todos os descritores de ficheiro >= numos contidos de edición de sesión déixanse en %snon é posíbel ligar ao fondo de recursos predeterminado para o proxecto «%s»non é posíbel unirse ao proxecto «%s»crea un contexto de seguranza SELinux co rol especificadocrea un contexto de seguranza SELinux co tipo especificadomostra esta mensaxe de axuda e saemostra a información da versión e saeedita ficheiros no lugar de executar unha ordeo uid efectivo non é %d, é %s nun sistema de ficheiros coa opción «nosuid» definida ou nun sistema de ficheiros NFS sen privilexios de root?o uid efectivo non é %d, está sudo instalado con setuid de root?produciuse un erro en %s, liña %d ao cargar o engadido «%s»erro no bucle de eventoserro ao inicializar os engadidos de E/S %sproduciuse un erro ao ler da tuberíaproduciuse un erro ao ler desde a tubería do sinalproduciuse un erro ao ler de socketpairproduciuse un erro ao obter old_contextproduciuse un erro ao definir a nova regra %sproduciuse un erro ao definir o novo tipo %serro fatal, non foi posíbel cargar os engadidosen modo lista, mostrar os privilexios do usuarioversión principal %d do engadido incompatíbel (agardábase %d) atopouse en %serro interno, desbordamento en %svalor non válidovalor non válido para %s `%s' en %s, liña %uinvalidar o ficheiro de marca de tempolistar os privilexios do usuario ou comprobar unha orde específica; usar dúas veces para un formato máis longonon hai programa askpass especificado, tente estabelecer SUDO_ASKPASSnon hai fondo de recursos aceptando as asignacións existentes par ao proxecto «%s»sen tty presente e non se especificou un programa askpassmodo non interactivo, non se preguntará ao usuariosó se pode especificar unha política de engadidoerro do engadido: falta a lista de ficheiros para sudoedita política do engadido %s non inclúe un método check_policya política do engadido %s non admite listar os privilexiosa normativa do engadido %s non admite as opcións -k/-Ka política do engadido %s non admite a opción -va política do engadido %s non inclúe ningún método «check_policy»produciuse un erro durante a inicialización de sesión do engadido de políticaconserva o ambiente de usuario ao executar unha ordele o contrasinal desde a entrada estándarretira completamente un ficheiro de marca de temporequire cando menos un argumentoacadouse o límite de control de recursosexecuta unha orde (ou edita un ficheiro) como o nome ou ID de usuario especificadoexecuta unha orde como o nome ou ID de grupo especificadoexecuta unha orde en segundo planoexecuta unha orde coa clase de inicio de sesión especificadaexecutar un intérprete de ordes de inicio como o usuario destino; tamén se pode especificar unha ordeexecutar o intérprete de ordes como o usuario destino; tamén se pode especificar unha ordesesh: erro interno: número impar de rutassesh: non é posíbel crear ficheiros temporaissesh: erro descoñecido %ddefine a variábel HOME como o cartafol de inicio do usuarioconfiguración do proxecto fallada «%s»o fondo de recursos especificado non existe para o proxecto «%s»detén o proceso de argumentos da liña de ordessudoedit non se admite nesta plataformaas opcións «-A» e «-S» non se poden empregar conxuntamentea opción «-E» non é válida no modo edicióna opción «-U» só se pode usar coa opción «-l»o agumento -C debe ser un número maior ou igual a 3a tarefa que invoca é definitivanon foi posíbel engadir o evento á colanon foi posíbel asignar memorianon foi posíbel asignar ptynon foi posíbel cambiar ao cartafol %snon foi posíbel cambiar de root a %snon foi posíbel cambiar as runas uid (%u, %u)non foi posíbel cambiar uid a root (%u)non foi posíbel copiar algúns ficheiros temporais de volta á súa localización orixinalnon foi posíbel copiar os ficheiros temporais de volta á súa localización orixinalnon foi psosíbel crear tuberíanon foi posíbel crear socketsnon foi posíbel determinar o método de forzadonon foi posíbel facer dup2 stdinnon é posíbel executar %snon foi posíbel executar fgetfilecon %s non foi posíbel atopar o símbolo «%s» en %snon é posíbel realizar forknon foi posíbel obter o contexto actual de tty, non se volve etiquetar ttynon foi posíbel obter o tipo de regra predeterminada %snon é posíbel obter o vector de gruponon foi posíbel obter o novo contexto tty, non volver a etiquetar ttynon foi posíbel inicializar a normativa do engadidonon foi posíbel cargar %s: %snon foi posíbel abrir %snon foi posíbel abrir %s, non volver a etiquetar ttynon foi posíbel abrir o sistema de auditoríanon foi posíbel abrir userdbnon é posíbel ler o ficheiro temporalnon foi posíbel ler o reloxonon foi posíbel retirar PRIV_PROC_EXEC desde PRIV_LIMITnon foi posíbel restaurar o contexto para %snon foi posíbel restaurar o manexador para o sinal %dnon foi posíbel restaurar o rexistronon foi posíbel restaurar stdinnon foi posíbel restaurar a etiqueta ttynon foi posíbel executar %snon foi posíbel executar %s como shell de inicio de sesiónnon foi posíbel gardar o manexador para o sinal %dnon foi posíbel gardar stdinnon foi posíbel enviar a mensaxe de auditoríanon foi posíebl estabelecer o controlador ttynon foi posíbel estabelcer o gid efectivo para executar como gid %unon foi posíbel o contexto de execución a %snon foi posíbel estabelecer o gid a %unon foi posíbel estabelcer o gid para executar como gid %unon foi posíbel definir o manexador para o sinal %dnon foi posíbel estabelecer a chave de creación de contexto a %snon foi posíbel estabelecer o novo contexto ttynon foi posíbel estabelecer a prioridade de procesonon foi posíbel estabelecer o grupo suplementario de IDsnon foi posíbel definir o contexto tty para %snon foi posíbel estabelecer o uid a %unon foi posíbel estabelecer o contexto do usuarionon foi posíbel executar stat en %snon foi posíbel ir ao rexistro «%s» para %snon foi posíbel escribir en %sterminación de condición filla non agardada: %dtipo de resposta inesperada en canles alternos %dmodo sudo 0x%x non agardadoclase de inicio de sesión descoñecida %stipo de política descoñecida %d atopado en %suid descoñecido %u: quen é vostede?actualiza a marca de tempo do usuario sen executar ningunha ordeusar un programa auxiliar para a solicitude de contrasinalusar tipo de autenticación especificado en BSDusa o contrasinal especificadoo usuario «%s» non é membro do grupo «%s»valor demasiado grandevalor demasiado pequenoaviso, o control de asignación de recuros fallou para o proxecto «%s»non se deben especificar as opcións «-i» e «-E» simultáneamentenon se deben especificar as opcións «-i» e «-s» simultáneamentenon se deben especificar variábeis de ambiente no modo edicióndébese especificar unha regra por tipo %sPK�m�\t)5Œ�LC_MESSAGES/usermode.monu�[�����?Ypq�\�� 4;Kg���	���� �

-9Nc:���������
��	$	A7	y	�	4�	_�	D
M
\

o
}
�
z�
z��}�.
6
=
O
^
w
�
J	i\s)�*�%.I#h�!��
���&/DSfs�!�K�(C^f|��#5A
`-n�8�O�>\;wl�
 +>^t �w�w%{�{���	2<D^o�
+.7
 8'(*;&-903)4/>2%$	,65!?":<=1#(current) UNIX password: About MyselfAre you sure you want to format this disk?  You will destroy any data it currently contains.BAD PASSWORD: it is too shortBAD PASSWORD: it's WAY too shortCancelCannot fork().
Change personal informationChange your login passwordChanging login shell.Changing personal information.DeviceDirectoryDisk ManagementErrorExitFailed to find selected program.FilesystemFull Name:Home Phone Number:InformationInformation updated.Insufficient rights.Invalid call to subprocess.Launch system-wide configuration tools without a password.Login Shell:Mount and unmount filesystemsNew UNIX password: OKOffice Phone Number:Office:One or more of the changed fields is invalid.
This is probably due to either colons or commas in one of the fields.
Please remove those and try again.Out of memory.PasswordPassword unchangedPassword: Retype new UNIX password: Run UnprivilegedSelect a _filesystem type to create:Some systems files are locked.
Please try again in a few moments.Sorry, passwords do not matchThe exec() call failed.The password you typed is invalid.
Please try again.There are no filesystems which you are allowed to mount or unmount.
Contact your administrator.Un_mountUnknown error.Unknown exit code.Unknown user.User InformationUser Mount ToolYou are attempting to run "%s" which requires administrative
privileges, but more information is needed in order to do so.You are attempting to run "%s" which requires administrative privileges, but more information is needed in order to do so.You are attempting to run a command which requires administrative
privileges, but more information is needed in order to do so.You are attempting to run a command which requires administrative privileges, but more information is needed in order to do so.You don't exist.  Go away.
Your current shell is not listed in /etc/shells.
You are not allowed to change your shell.
Consult your system administrator._Format_Mount_Run Unprivilegeddup2() error.
execl() error, errno=%d
login: Project-Id-Version: PACKAGE VERSION
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2012-08-21 00:32+0200
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
PO-Revision-Date: 2015-03-21 02:44-0400
Last-Translator: Copied by Zanata <copied-by-zanata@zanata.org>
Language-Team: Galician (http://www.transifex.com/projects/p/fedora/language/gl/)
Language: gl
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Zanata 3.9.6
Contrasinal de UNIX (actual): Sobre Min¿Está seguro de que desexa formatar este disco?  Vai destruír tódolos datos que contén.CONTRASINAL INCORRECTO: é curto de máisCONTRASINAL INCORRECTO: é DEMASIADO curtoCancelarNon se pode facer fork().
Cambiar a información persoalCambie o seu contrasinal de entradaCambiando a shell de entrada.Cambiando a información persoal.DispositivoDirectorioAdministración de DiscosErroSaírNon se atopou o programa seleccionado.Sistema de ficheirosNome completo:Teléfono da casa:InformaciónInformación actualizada.Permisos insuficientes.Chamada incorrecta ó subproceso.Executar sen contrasinal ferramentas de configuración para todo o sistema.Shell:Montar e desmontar sistemas de ficheirosNovo contrasinal de UNIX: AceptarTeléfono da oficina:Oficina:Un ou máis dos campos modificados non son válidos.
Isto é probablemente por mor dalgunha coma ou dous puntos nalgún dos campos.
Quíteos e tente de novo.Memoria esgotada.ContrasinalContrasinal sen modificaciónsContrasinal: Volva introducir o novo contrasinal de UNIX: Executar sen privilexiosSeleccionar un tipo de sistema de _ficheiros para crear:Algúns ficheiros de sistema están bloqueados.
Tente de novo dentro dun intre.Os contrasinais non coincidenA chamada a exec() fallou.O contrasinal que introduciu non é válido.
Tente de novo.Non hai ningún sistema de ficheiros que o usuario poida montar ou desmontar.
Contacte co seu administrador._DesmontarErro descoñecido.Código de saída descoñecido.Usuario descoñecido.Información de UsuarioFerramenta de Montaxe de UsuarioEstá tentando executar "%s" o cal require privilexios
administrativos, pero para facelo é precisa máis información.Está tentando executar "%s" o cal require privilexios administrativos, pero para facelo é precisa máis información.Está tentando executar un comando que require privilexios
administrativos, pero para facelo é precisa máis información.Está tentando executar un comando que require privilexios administrativos, pero para facelo é precisa máis información.Non existe.  Vaiase.
A súa shell actual non está listada en /etc/shells.
Non lle está permitido mudar a shell.
Consulte co administrador do seu sistema._Formatar_Montar_Executar sen privilexiosErro de dup2().
Erro de execl(), errno=%d
login: PK�m�\Z���3 3 LC_MESSAGES/p11-kit.monu�[�����R�m<��<\)s!�(�2�2N%e�(�2�2	$7	\	"m	#�	�	+�	�	

7
H
$e
�
$�
,�
-�
/ P%j�'�&��#/6f&��-�3�%
 ?
`
~
�
'�
$�
'#* No�� ��+$Jo���!�*�"@Z%y+���/08
iw��o"�$�!��&
)16[B�=�#97/q6�A�?)Z!�)� �$�7N[s�,�;�%169h8�?�!)=g3�7�0�+7J&�$��,�0F b��!�,�2Db!����"�#$33X'����& /G(w�!�6�6Pn<�<�  E	LM2*B4)@R<?OJ
3Q810=#!HD(.AG:5,>6-+
IP"&'9F%N7;$K/ CA key is neededA read-only session existsAn administrator session existsAn error occurred on the deviceAn open session existsAnother operation is already taking placeAnother user is already logged inCannot export because the key is invalidCannot export because the key is of the wrong sizeCannot export because the key is of the wrong typeCannot export this keyCannot import a key of the wrong sizeCannot import an invalid keyCannot import because the key is invalidCannot import because the key is of the wrong sizeCannot import because the key is of the wrong typeCannot include the key in the digestCannot lock dataCertain fields have invalid valuesCertain required fields are missingInsufficient memory availableInsufficient memory available on the deviceInternal errorInvalid argumentsInvalid value for fieldNo key is neededNo operation is taking placeNo random number generator availableNo user has logged inNot enough space to store the resultThe crypto mechanism has an invalid argumentThe crypto mechanism has an invalid parameterThe crypto mechanism is invalid or unrecognizedThe data cannot be lockedThe data is not valid or unrecognizedThe data is too longThe device is invalid or unrecognizableThe device is not present or unpluggedThe device is write protectedThe device was removed or unpluggedThe encrypted data is not valid or unrecognizedThe encrypted data is too longThe field is invalid or does not existThe field is read-onlyThe field is sensitive and cannot be revealedThe information is sensitive and cannot be revealedThe key cannot be wrappedThe key is different than beforeThe key is missing or invalidThe key is of the wrong typeThe key is the wrong sizeThe module cannot create needed threadsThe module cannot lock data properlyThe module has already been initializedThe module has not been initializedThe object is missing or invalidThe operation failedThe operation was cancelledThe password or PIN has expiredThe password or PIN is incorrectThe password or PIN is invalidThe password or PIN is lockedThe password or PIN is of an invalid lengthThe request was rejected by the userThe saved state is invalidThe session is closedThe session is invalidThe session is read-onlyThe signature is bad or corruptedThe signature is unrecognized or corruptedThe specified slot ID is not validThe state cannot be savedThe user is of an invalid typeThe user's password or PIN is not setThis operation cannot be done with this keyThis operation is not supportedToo many sessions are activeToo many users of different types are logged inUnable to initialize the random number generatorUnknown errorYou are already logged inProject-Id-Version: p11-kit
Report-Msgid-Bugs-To: https://bugs.freedesktop.org/enter_bug.cgi?product=p11-glue
POT-Creation-Date: 2018-01-31 16:48+0100
PO-Revision-Date: 2017-09-23 18:09+0000
Last-Translator: Fran Diéguez <frandieguez@ubuntu.com>
Language-Team: Galician (http://www.transifex.com/freedesktop/p11-kit/language/gl/)
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Language: gl
Plural-Forms: nplurals=2; plural=(n != 1);
Precísase unha chaveExiste unha sesión de só lecturaExiste unha sesión de administradorProduciuse un erro no dispositivoExiste unha sesión abertaXa se esta executando outra operaciónXa hai outro usuario coa sesión iniciadaNon é posíbel exportar a chave porque non é válidaNon é posíbel exportar a chave porque ten un tamaño incorrecto Non é posíbel exportar a chave porque é do tipo incorrectoNon é posíbel exportar esta chaveNon é posíbel importar unha chave de tamaño incorrectoNon é posíble importar unha chave non válidaNon é posíbel importar porque a chave non é válidaNon é posíbel importar a chave xa que ten un tamaño incorrectoNon é posíbel importar porque a chave ten un tipo non válidoNon é posíbel incluir a chave no digestNon é posíbel bloquear os datosCertos campos teñen valores non válidosFaltan algúns campos requiridosNon hai memoria dispoñíbel dabondoA memoria dispoñíbel no dispositivo non é suficienteErro internoArgumentos non válidosValor non válido para o campoNon se precisa chaveNon se está levando a cabo outra operaciónNon hai ningún xerador de números aleatorios dispoñíbelNon hai usuarios coa sesión iniciadaNon hai espazo dabondo para almacenar o resultadoO mecanismo de criptografía ten un argumento non válidoO mecanismo criptográfico ten un parámetro non válidoO mecanismo de criptografía non é válido ou non se recoñeceNon é posíbel bloquear os datosO dato non é válido ou non se recoñeceO dato é demasiado longoO dispositivo non é válido ou non está conectadoO dispositivo non está presente ou non está conectadoO dispositivo está protexido contra a escrituraO dispositivo foi extraído ou desconectadoOs datos cifrados non son válidos ou non se recoñecenOs datos cifrados son demasiado longosO campo non é válido ou non existeO campo é de só lecturaO campo é sensíbel e non pode ser reveladoA información é sensíbel e non pode revelarseA chave non pode envolverseA chave é diferente da anteriorFalta a chave ou non é válidaA chave é dun tipo incorrectoA chave ten un tamaño incorrectoO módulo non pode crear os fíos necesariosO módulo non pode bloquear os datos correctamenteO módulo xa foi inicializadoO módulo non foi inicializadoO obxecto falta ou non é válidoOperacción falladaCancelouse a operaciónO contrasinal ou PIN expirouO contrasinal ou PIN é incorrectoO contrasinal ou PIN non é válidoO contrasinal ou PIN está bloqueadoO contrasinal ou PIN ten unha lonxitude non válidaA solicitude foi rexeitada polo usuarioO estado gardado non é válidoA sesión está pechadaA sesión non é válidaA sesión é e só lecturaA sinatura é mala ou está corrompidaA sinatura non se recoñece ou está corrompidaO ID do slot especificado non é válidoNon é posíbel gardar o estadoO usuario ten un tipo non válidoO contrasinal ou PIN do usuario non está estabelecidoEsta operación non pode levarse a cabo con esta chaveEsta operación non se admiteDemasiadas sesións activasHai varios usuarios de tipos diferentes coa sesión iniciadaNon é posíbel inicializar o xerador de números aleatoriosErro descoñecidoXa ten unha sesión iniciadaPK�m�\���ܵo�oLC_MESSAGES/coreutils.monu�[������3���#{�t�7),a5����T
�����u����P� �� C�!�"��#L%
k&y&�&�&�& �&�&�&'>',X'$�'8�'�'((-(@([(y("�()�(�(1�('))Q)j)�)�)�)�).�)"�)**
(*3*8*	>*H*Q*
X*c*i*o*u*z*�*�*�*�*�*
�*�*�*2�*	+*+6+>+$C+h+m+'�+�+&�+"�+", 5,'V,Z~,�,�,�,	�,--
-<-Z-`-f-*h-�-�-�-�-#�-*�-%.,E.0r.#�.�.�.(�.%/5@/v/�/8�/&�/!0#0<0U0l0�0�0�0�0	�0"�0�01# 1D1Y1.^1�1�1�1�1=�1:;2v2�2*�2-�2
�2
3373"O3r3 �3�3�3�3
�3/�3-'4&U4$|4�4"�47�4=5Q5-d5	�54�5&�5�56$6:6>R6
�6�6�6�6	�6�6�6777+7:7S7c7o7�7J�7
�7�78H08?y8=�8>�8369(j9>�9/�9:3:H<:2�:=�:,�:7#;
[;3f;5�;j�;;<G<7T<��<�C>X�>NV@��ADkC+�C9�CD�F4H�FI�+J��J�lK�OL��L��M��NI�O��O��Q&�S�T�T�T-U1U#NU&rU�U�UK�UVV1gVB�V"�V&�V&WBWXW4wW�W%�W.�W XE9X9X�X�X�XYYY34Y%hY�Y�Y	�Y�Y�Y	�Y�Y�Y
�Y�Y�Y�Y�Y�Y
ZZZZ/Z
@ZKZNZKUZ
�Z+�Z�Z�Z)�Z[[(4[ ][)~[)�[+�[#�[("\UK\�\�\�\�\�\�\�\=�\,]2]:]#<]`]}]�]�]1�]=�]%-^8S^<�^4�^!�^) _?J_!�_N�_&�_"`K@`;�`%�`�`$a(aAa`aoa �a"�a
�a(�a
�a	b)bFbabFfb �b�b&�b"cP8cA�c�c�c5d87dpd�d&�d�d'�d%�d&%eLeie|e�e3�e7�e2
f3=fqf&�f>�f[�fOg0dg�gA�g$�ghh=hXhKnh�h�h�h�h	i"i/iIigini}i!�i�i(�i/�ijR;j�j'�j0�jI�j;Ek9�kA�k?�k'=lFel7�l�l6�lM!m/om7�m2�m0
n;n@MnB�n��nTofo<xo}��t��D�s�P4n*/��'�c��2�B9��$�S�H|�m��5��YA�����V���le��"�a80Z�KR��7�,M��-�bj!<)
�1(\�W�3	o���#����y���NT&��X��F`�w�%p�EG~
g:fzi[���^xQ��qJ�����;�6��u=Ld�UO_����vC?>@�I]����+{ k���������h�.�r���
As a special case, cp makes a backup of SOURCE when the force and backup
options are given and SOURCE and DEST are the same name for an existing,
regular file.

Beware that many operators need to be escaped or quoted for shells.
Comparisons are arithmetic if both ARGs are numbers, else lexicographical.
Pattern matches return the string matched between \( and \) or null; if
\( and \) are not used, they return the number of characters matched or 0.

Handle the tty line connected to standard input.  Without arguments,
prints baud rate, line discipline, and deviations from stty sane.  In
settings, CHAR is taken literally, or coded as in ^c, 0x37, 0177 or
127; special values ^- or undef used to disable special characters.

SETs are specified as strings of characters.  Most represent themselves.
Interpreted sequences are:

  \NNN            character with octal value NNN (1 to 3 octal digits)
  \\              backslash
  \a              audible BEL
  \b              backspace
  \f              form feed
  \n              new line
  \r              return
  \t              horizontal tab

With no FILE, or when FILE is -, read standard input.
      --help     display this help and exit
      --version  output version information and exit
  -D, --date-format=FORMAT
                    use FORMAT for the header date
  -e[CHAR[WIDTH]], --expand-tabs[=CHAR[WIDTH]]
                    expand input CHARs (TABs) to tab WIDTH (8)
  -F, -f, --form-feed
                    use form feeds instead of newlines to separate pages
                    (by a 3-line page header with -F or a 5-line header
                    and trailer without -F)
  -W, --word-regexp=REGEXP       use REGEXP to match each keyword
  -b, --break-file=FILE          word break characters in this FILE
  -f, --ignore-case              fold lower case to upper case for sorting
  -g, --gap-size=NUMBER          gap size in columns between output fields
  -i, --ignore-file=FILE         read ignore word list from FILE
  -o, --only-file=FILE           read only word list from this FILE
  -a, --across      print columns across rather than down, used together
                    with -COLUMN
  -c, --show-control-chars
                    use hat notation (^G) and octal backslash notation
  -d, --double-space
                    double space the output
  -b, --before             attach the separator before instead of after
  -r, --regex              interpret the separator as a regular expression
  -s, --separator=STRING   use STRING as the separator instead of newline
  -b, --bytes         count bytes rather than columns
  -s, --spaces        break at spaces
  -w, --width=WIDTH   use WIDTH columns instead of 80
  -d, --delimiters=LIST   reuse characters from LIST instead of TABs
  -s, --serial            paste one file at a time instead of in parallel
  -n, --digits=DIGITS        use specified number of digits instead of 2
  -s, --quiet, --silent      do not print counts of output file sizes
  -z, --elide-empty-files    remove empty output files
  -q, --quiet, --silent    never print headers giving file names
  -v, --verbose            always print headers giving file names
  -r, --references               first field of each line is a reference
  -t, --typeset-mode               - not implemented -
  -w, --width=NUMBER             output width in columns, reference excluded
  -s, --only-delimited    do not print lines not containing delimiters
      --output-delimiter=STRING  use STRING as the output delimiter
                            the default is to use the input delimiter
  -t                       equivalent to -vT
  -T, --show-tabs          display TAB characters as ^I
  -u                       (ignored)
  -v, --show-nonprinting   use ^ and M- notation, except for LFD and TAB
  -w, --check-chars=N   compare no more than N characters in lines
  [:graph:]       all printable characters, not including space
  [:lower:]       all lower case letters
  [:print:]       all printable characters, including space
  [:punct:]       all punctuation characters
  [:space:]       all horizontal or vertical whitespace
  [:upper:]       all upper case letters
  [:xdigit:]      all hexadecimal digits
  [=CHAR=]        all characters which are equivalent to CHAR
  \v              vertical tab
  CHAR1-CHAR2     all characters from CHAR1 to CHAR2 in ascending order
  [CHAR*]         in SET2, copies of CHAR until length of SET1
  [CHAR*REPEAT]   REPEAT copies of CHAR, REPEAT octal if starting with 0
  [:alnum:]       all letters and digits
  [:alpha:]       all letters
  [:blank:]       all horizontal whitespace
  [:cntrl:]       all control characters
  [:digit:]       all digits
  excl      fail if the output file already exists
  nocreat   do not create the output file
  notrunc   do not truncate the output file
  noerror   continue after read errors
  fdatasync  physically write output file data before finishing
  fsync     likewise, but also write metadata
 (backup: %s) groups= old %s -> %s (unbackup)
%s and %s are the same file%s exists but is not a directory%s has unknown file type%s is too large%s: %s:%s: disorder: %s: can make relative symbolic links only in current directory%s: cannot shred append-only file descriptor%s: couldn't reset non-blocking mode%s: equivalence class operand must be a single character%s: expected a numeric value%s: file has negative size%s: file too long%s: file truncated%s: input contains a loop:%s: input file is output file%s: invalid pattern%s: invalid regular expression: %s%s: line number must be greater than zero%s: line number out of range%s: no properly formatted %s checksum lines found%s: no size information for this device%s: pass %lu/%lu (%s)...%s: pass %lu/%lu (%s)...%s%s: read error%s: removed%s: removing%s: replace %s? %s: unable to perform all requested operations%s: value not completely converted',  load average: %.2f<internal>???
AvailAvailableCapacityFAILEDFilesystemIFreeIUse%IUsedIdleIn real life: InodesLINELoginLogin name: Memory exhaustedMounted onOKPlan:
Print CRC checksum and byte counts of each FILE.

Project: Set LC_ALL='C' to work around the problem.Shell: SizeThe strings compared were %s and %s.TypeUnknown system errorUsage: %s [FILE]...
  or:  %s [OPTION]
Usage: %s [OPTION] [FILE]...
Usage: %s [OPTION]... FILE PATTERN...
Usage: %s [OPTION]... FILE1 FILE2
Usage: %s [OPTION]... SET1 [SET2]
Usage: %s [OPTION]... [FILE]...
Usage: %s [OPTION]... [INPUT [OUTPUT]]
Usage: %s [OPTION]... [INPUT]...   (without -G)
  or:  %s -G [OPTION]... [INPUT [OUTPUT]]
Use%UsedValid arguments are:Warning: WhenWhereWritten by %s.
[=c=] expressions may not appear in string2 when translating^[nN]^[yY]`a command must be given with an adjustmentambiguous argument %s for %sbackup typeblock special fileblocksboth files cannot be standard inputcannot both summarize and show all entriescannot change permissions of %scannot convert U+%04X to local character setcannot convert U+%04X to local character set: %scannot copy cyclic symbolic link %scannot create directory %scannot determine hostnamecannot make both hard and symbolic linkscannot open %s for readingcannot print only names or real IDs in default formatcannot read realtime clockcannot set datecannot set hostname; this system lacks the functionalitycannot skip past end of combined inputcannot split in more than one waychanging ownership of %scharacter offset is zerocharacter out of rangecharacter special fileclose failedclosing %s (fd=%d)closing output file %scouldn't get boot timedirectoryerror in regular expression searcherror reading %serror writing %sfailed to change group of %s to %s
field number is zerofifofile system type %s both selected and excludedgetting new attributes of %sgroup of %s retained as %s
iconv function not availableiconv function not usableignoring invalid tab size in environment variable TABSIZE: %signoring invalid width in environment variable COLUMNS: %sinput disappearedinvalid argument %s for %sinvalid conversion specifier in suffix: %cinvalid conversion specifier in suffix: \%.3oinvalid groupinvalid numberinvalid number at field startinvalid number of bytesinvalid number of bytes to compareinvalid number of bytes to skipinvalid number of fields to skipinvalid number of linesinvalid usermemory exhaustedmessage queuemisaligned [:upper:] and/or [:lower:] constructmissing %% conversion specification in suffixmissing conversion specifier in suffixmissing hexadecimal number in escapemissing list of fieldsmode of %s retained as %04lo (%s)
neither symbolic link %s nor referent has been changed
no SHELL environment variable, and no shell type option givenno files remainingno type may be specified when dumping stringsnot a ttyonly one [c*] repeat construct may appear in string2only one type of list may be specifiedopen failedownership of %s retained as %s
page width too narrowpreserving times for %sprinting all duplicated lines and repeat counts is meaninglessread errorread failedregular empty fileregular filesemaphoreseparator cannot be emptysetting times of %sshared memory objectsocketstandard errorstandard inputstandard input is closedstandard outputstat failedstray character in field specstring comparison failedsuppressing non-delimited lines makes sense
	only when operating on fieldssymbolic linktab size cannot be 0tab sizes must be ascendingthe --binary and --text options are meaningless when verifying checksumsthe --status option is meaningful only when verifying checksumsthe --warn option is meaningful only when verifying checksumsthe [c*] construct may appear in string2 only when translatingthe [c*] repeat construct may not appear in string1the delimiter must be a single characterthe options to print and set the time may not be used togethertoo many %% conversion specifications in suffixtotalunparsable value for LS_COLORS environment variablewarning: %s: character(s) following character constant have been ignoredwarning: --pid=PID is not supported on this systemwarning: PID ignored; --pid=PID is useful only when followingwarning: invalid width %lu; using %d insteadwarning: summarizing is the same as using --max-depth=0weird filewhen not truncating set1, string2 must be non-emptywhen specifying an output style, modes may not be setwhen translating with complemented character classes,
string2 must map all characters in the domain to onewrite errorwrite failedyou must specify a list of bytes, characters, or fieldsProject-Id-Version: textutils 2.0.22
Report-Msgid-Bugs-To: bug-coreutils@gnu.org
POT-Creation-Date: 2018-07-01 17:59-0700
PO-Revision-Date: 2002-07-23 03:07+0200
Last-Translator: Jacobo Tarrio <jtarrio@trasno.net>
Language-Team: Galician <gpul-traduccion@ceu.fi.udc.es>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8-bit
X-Bugs: Report translation errors to the Language-Team address.

Como caso especial, o cp fai unha copia de seguridad da ORIXE cando se usan
as opcións `force' e `backup', e ORIXE e DESTINO teñen o mesmo nome que un
ficheiro regular xa existente.

Teña en conta que moitos dos operadores necesitan caracteres de escape ou
comiñas para as shells.
As comparacións son aritméticas se ambos ARGs son números, doutro xeito serán
lexicográficas.
Os encaixes dos patróns devolven a cadea entre \( e \), ou nada; se non
se usan \( e \), devólvese o número de caracteres coincidintes ou 0.

Manexar a liña tty conectada á entrada estándar.  Sen argumentos,
escribi-la tasa de baudios, a disciplina da liña, e as desviacións respecto
a stty sane.  Nos parámetros, CARAC tómase literalmente, ou codificado
coma en ^c, 0x37, 0177 ou 127; os valores especiais ^- ou undef úsanse para
desactiva-los caracteres especiais.

Os CONXuntos especifícanse coma cadeas de caracteres. A maioría represéntanse
a si mesmos. As secuencias interpretadas son:

  \NNN            carácter co valor octal NNN (1 a 3 díxitos octais)
  \\              barra invertida
  \a              campá audible
  \b              retroceso dun carácter
  \f              salto de páxina
  \n              salto de liña
  \r              retorno de carro
  \t              tabulación horizontal

Sen FICHEIRO, ou cando o FICHEIRO é -, lese da entrada estándar.
      --help     amosar esta axuda e saír
      --version  amosar información da versión e saír
  -D, --date-format=FORMATO
                    emprega-lo FORMATO para a data da cabeceira
  -e[CAR[ANCHO]], --expand-tabs[=CAR[ANCHO]]
                    expandi-los CARacteres de entrada (tabulacións) ao
                      ANCHO de tabulación (8)
  -F, -f, --form-feed
                    empregar saltos de páxina no canto de saltos de liña para
                      separa-las páxinas (cunha cabeceira de páxina de tres
                      liñas con -F ou unha cabeceira e pé de 5 liñas sen -F)
  -W, --word-regexp=EXPREG       emprega-la EXPREG para compara-las claves
  -b, --break-file=FICHEIRO      caracteres que parten palabras neste FICHEIRO
  -f, --ignore-case              converte-las minúsculas a maiúsculas
                                   para ordear
  -g, --gap-size=NÚMERO          tamaño do oco entre campos de saída
  -i, --ignore-file=FICHEIRO     le-la lista de palabras ignoradas do FICHEIRO
  -o, --only-file=FICHEIRO       le-la lista de palabras únicas do FICHEIRO
  -a, --across      separar en filas horizontais no canto de en columnas
                      verticais; emprégase con -COLUMNA
  -c, --show-control-chars
                    emprega-la notación do circunflexo (^G) e da barra octal
  -d, --double-space
                    amosa-la saída a doble espacio
  -b, --before             incluí-lo separador antes e non despois
  -r, --regex              interpreta-lo separador como unha expresión regular
  -s, --separator=CADEA    usa-la CADEA coma separador na vez de salto de liña
  -b, --bytes         contar bytes no canto de columnas
  -s, --spaces        partir nos espacios
  -w, --width=ANCHO   empregar ANCHO columnas no canto de 80
  -d, --delimiters=LISTA  utilizar carácters da LISTA no canto de tabulacións
  -s, --serial            pegar un ficheiro de cada vez no canto de en paralelo
  -n, --digits=CIFRAS         usa-lo número de cifras indicado no canto de 2
  -s, --quite, --silent       non amosa-los tamaños dos ficheiros de saída
  -z, --elide-empty-files     elimina-los ficheiros de saída baleiros
  -q, --quiet, --silent    non amosa-las cabeceiras cos nomes dos ficheiros
  -v, --verbose            amosar sempre as cabeceiras cos nomes dos ficheiros
  -r, --references               o primeiro campo de cada liña é unha
                                   referencia
  -t, --typeset-mode               - sen implementar -
  -w, --width=NÚMERO             ancho da saída, excluíndo referencias
  -s, --only-delimited    non amosa-las liñas que non conteñan delimitadores
      --output-delimiter=CADEA  emprega-la CADEA coma delimitador de saída
                            por defecto emprégase o delimitador de entrada
  -t                       equivalente a -vT
  -T, --show-tabs          amosa-los caracteres TAB coma ^I
  -u                       (ignorado)
  -v, --show-nonprinting   usar notación de ^ e M-, excepto en LFD e TAB
  -w, --check-chars=N   non comparar máis de N caracteres en cada liña
  [:graph:]       tódolos caracteres imprimibles, sen incluí-los espacios
  [:lower:]       tódalas letras minúsculas
  [:print:]       tódolos caracteres imprimibles, incluíndo os espacios
  [:punct:]       tódolos caracteres de puntuación
  [:space:]       tódolos espacios en branco horizontais e verticais
  [:upper:]       tódalas letras maiúsculas
  [:xdigit:]      tódolos díxitos hexadecimais
  [=CAR=]         tódolos caracteres equivalentes a CAR
  \v              tabulación vertical
  CAR1-CAR2       tódolos caracteres entre CAR1 e CAR2 en orde ascendente
  [CAR*]          en CONX2, copias do CARácter ata a lonxitude de CONX1
  [CAR*REPET]     REPETir copias do CARácter, REPET é octal se comeza por 0
  [:alnum:]       tódalas letras e díxitos
  [:alpha:]       tódalas letras
  [:blank:]       tódolos espacios en branco horizontais
  [:cntrl:]       tódolos caracteres de control
  [:digit:]       tódolos díxitos
  excl      fail if the output file already exists
  nocreat   do not create the output file
  notrunc   non trunca-lo ficheiro de saída
  noerror   continuar se hai erros de lectura
  fdatasync  physically write output file data before finishing
  fsync     likewise, but also write metadata
 (copia de seguridade: %s) grupos= antigo %s -> %s (restaurado da copia de seguridade)
%s e %s son o mesmo ficheiro%s existe pero non é un directorio%s é un tipo de ficheiro descoñecido%s é grande de máis%s: %s:%s: desorde: %s: só se poden facer ligazóns simbólicas relativas no directorio actual%s: non se pode facer un borrado seguro dun descriptor de ficheiro
de tipo só-engadir%s: non se pode restablece-lo modo de non bloqueo%s: o operando de clases de equivalencia debe ser un só carácter%s: agardábase un valor numérico%s: o ficheiro ten un tamaño negativo%s: ficheiro longo de máis%s: ficheiro truncado%s: a entrada contén un lazo:%s: o ficheiro de entrada é o mesmo que o de saída%s: patrón incorrecto%s: expresión regular incorrecta: %s%s: o número de liña debe ser maior que cero%s: número de liña inexistente%s: non se atoparon liñas de suma de comprobación %s ben formatadas%s: non hai información de tamaño para este dispositivo%s: pasada %lu/%lu (%s)...%s: pasada %lu/%lu (%s)...%s%s: erro de lectura%s: borrado%s: borrando%s: ¿substituír %s?%s: non se poden facer tódalas operacións pedidas%s: valor non convertido por completo",  carga media: %.2f<interno>???
DispDispoñibCapacidFALLASist. FichILibresIUso%IUsadosInactivoNa vida real: InodosLIÑALoginNome de usuario: Memoria esgotadaMontado enOKPlan:
Amosa-la suma de comprobación CRC e o número de bytes de cada FICHEIRO.

Proxecto: Estabreza LC_ALL='C' para palia-lo problemaShell: TamañoAs cadeas que se compararon foron %s e %sTipoErro do sistema descoñecidoUso: %s [FICHEIRO]...
 ou: %s [OPCIÓN]
Uso: %s [OPCIÓN] [FICHEIRO]...
Uso: %s [OPCIÓN]... FICHEIRO PATRÓN...
Uso: %s [OPCIÓN]... FICHEIRO1 FICHEIRO2
Uso: %s [OPCIÓN]... CONXUNTO1 [CONXUNTO2]
Uso: %s [OPCIÓN]... [FICHEIRO]...
Uso: %s [OPCIÓN]... [ENTRADA [SAÍDA]]
Uso: %s [OPCIÓN]... [ENTRADA]...   (sen -G)
 ou: %s -G [OPCIÓN] [ENTRADA [SAÍDA]]
Uso%UsadoOs parámetros correctos son:Aviso: CandoOndeEscrito por %s.
as expresións [=c=] non poden aparecer na cadea2 ao traducir^[nN]^[sSyY]"ten que se dar un comando co axusteargumento %s ambiguo para %stipo de copia de seguridadeficheiro especial de bloquebloquesos dous ficheiros non poden ser entrada estándarnon se pode resumir e amosar tódalas entradas ao mesmo temponon se pode cambia-los permisos de %snon se pode converter U+%04X ao xogo de caracteres localnon se pode converter U+%04X ao xogo de caracteres local: %snon se pode copia-la ligazón simbólica cíclica %snon se pode crea-lo directorio %snon se pode determina-lo nome da máquinanon se poden facer ligazóns duras e simbólicas ao mesmo temponon se pode abrir %s para lecturanon se pode escribir só o nome ou o identificador real no formato por defectonon se pode le-lo reloxo coa hora realnon se pode establece-la datanon se pode establece-lo nome de máquina; o sistema non ten esa capacidadenon se pode saltar máis aló do final da entrada combinadanon se pode partir en máis dun xeitomudando o dono de %so desprazamento do carácter é cerocarácter fóra de rangoficheiro especial de caráctero peche falloupechando %s (fd=%d)pechando o ficheiro de saída %snon se pode obte-la data de iniciodirectorioerro ao buscar por expresións regulareserro lendo %serro escribindo %snon foi posible mudar o grupo de %s a %s
o número do campo é cerofifoo sistema de ficheiros tipo %s foi escollido e exluído ao mesmo tempoobtendo os novos atributos de %smantense o grupo de %s como %s
a función iconv non está dispoñiblea función iconv non é utilizableignorando o tamaño de tabulador non válido na variable de ambiente TABSIZE: %signorando o ancho non válido na variable de ambiente COLUMNS: %sa entrada desapareceuargumento incorrecto %s para %sespecificador de conversión do sufixo incorrecto: %cespecificador de conversión do sufixo incorrecto: \%.3ogrupo incorrectonúmero incorrectonúmero non válido ao comezo do camponúmero de bytes incorrectonúmero de bytes a comparar non válidonúmero de bytes a omitir non válidonúmero de campos a omitir non válidonúmero de liñas incorrectousuario incorrectomemoria esgotadacola de mensaxesconstrucción [:upper:] e/ou [:lower:] mal aliñadaespecificación de conversión %% non atopada no sufixoespecificador de conversión non atopado no sufixofalta un número hexadecimal na secuencia de escapelista de campos non atopadao modo de %s mantense como %04lo (%s)
non se mudou a ligazón simbólica %s nin o ficheiro referido
non existe a variable de ambiente SHELL, e non se indicou ningunha opción
de tipo de shellnon quedan ficheirosnon se pode especificar un tipo ao volcar cadeasnon é unha ttysó pode aparecer una construcción de repetición [c*] na cadea2só se pode indicar un tipo de listaa apertura falloumantense o dono de %s como %s
páxina demasiado estreitamantense a data de %samosar tódalas liñas duplicadas e a conta de repeticións non ten sentidoerro de lecturaerro de lecturaficheiro normal baleiroficheiro normalsemáforoo separador non pode estar baleiroestablecendo a data de %sobxecto de memoria compartidasocketerro estándarentrada estándara entrada estándar está pechadasaída estándara obtención de datos do ficheiro falloucarácter de sobras na especificación do campoa comparación de cadeas fallouelimina-las liñas sen delimitadores ten sentido
	só cando se traballa con camposligazón simbólicao tamaño da tabulación non pode ser 0os tamaños das tabulacións deben ser crecentesas opcións --binary e --text non teñen sentido cando se comproban sumasa opción --status ten sentido só cando se verifican sumasa opción --warn ten sentido só cando se verifican sumasa construcción [c*] pode aparecer na cadea2 só cando se traducea construcción de repetición [c*] non pode aparecer na cadea1o delimitador debe ser un só carácteras opcións para imprimir e establece-la data non se poden usar xuntasdemasiadas especificacións de conversión %% no sufixototala variable de ambiente LS_COLORS ten un valor ilexibleaviso: %s: os caracteres que seguen á constante de carácter foron ignoradosaviso: --pid=PID non é soportado neste sistemaaviso: PID ignorado; --pid=PID é útil só cando segueaviso: ancho %lu incorrecto; usando %d na súa vezaviso: resumir é o mesmo que usar --max-depth=0ficheiro estrañocando non se trunca o conxunto1, a cadea2 non debe estar baleiracando se indica un estilo de saída, non se poden establecer modoscando se traduce con clases de caracteres complementarias,
a cadea2 debe facer corresponder tódolos caracteres do dominio nun sóerro de escrituraerro de escrituradebe especificarse unha lista de bytes, caracteres ou camposPK�m�\��+i$$LC_MESSAGES/elinks.monu�[������t��
`ag
t
����
�
���	*7?
N\ar@�"����

"0=	V`rx�����	�-<Tco
����	�
����� 
,:
?Mbhx��
�
�	�
���
��
)7@O\iy��	��	���
��'8ELin#�����	�
�	
(:G
N\!h��������
���

 &-2AJR
alr
����	���	���
���&,4�;	�����0J\m%�����	���� %8=H��	�����!8Kch~"���
�	�2"Gj������	
$?Wrx��
����
���"'7
F
Q%_�������4A	`j�����
�
���  $ 8 K %T z � 
� ,� � � !!
0!>!M!Z!^!o!�!�!
�!
�!*�!�!�!"
"$"8"@"F"N"`"#o"
�"�"�"�"
�"�"�"	�"�"�"
�"	###	-#7#
>#I#Q#X#
a#l#	�#�#�#�#�#�#�#�#$
$$H��9V��&8x?C!^/�O�5 m<�|��s�lR+~g�>�*v6$Y@G�]#�NI(DU4\��j-�h%c�{�X�S'A�	z,wW:���EtkB�K�;e��rb)F�u�7��dyZ�.i��`nQ�=��qP��3T�J��[fp2oM"�
L1a0_
}AboutAdd bookmarkAverage speedBad FTP loginBad FTP responseBad HTTP responseBad URL syntaxBad numberBad stringBookmark managerCan't get socket stateCheckboxCloseCodepageColorConnectionsContent-TypeCopyingC~haracter setData modifiedDateDelete extensionDisplay ~usemapDo you really want to exit ELinks (and terminate all downloads)?Do you really want to exit ELinks?Document ~infoDownloadDownload errorDownload ima~geEditEdit bookmarkElapsed timeEmpty string not allowedEnter URLEnter link numberErrorError opening fileError reading from socketError while posting formError writing to fileError writing to socketExit ELinksExtensionExtension(s)E~xitFTP PORT command failedFTP file errorFTP service unavailableFile not foundFile uploadFile ~extensionsFind ~nextFind ~previousFrame at ~full-screenGetting headersGo to URLGo to linkGo ~backHeader infoHost not foundH~eader infoImageInfoInternal errorInterruptedKOI8-R framesKeysLast modifiedLinux or OS/2 framesLoginLooking up hostMaking connectionMemory cacheNameNo contentNo extensionsNo framesNo historyNo link selectedNo previous searchNo programNumber expected in fieldOKOpen in new ~windowOut of memoryPasswordPassword fieldPost form toRadio buttonReceive timeoutReceivedRequest must be restartedRequest sentResourcesRestrict frames in cp850/852SSL errorSaveSave URLSave errorSave to fileSearchSearch backwardSearch for textSearch ~backwardSelect fieldServerServer is processing requestSizeSocket exceptionSpeedSubmit form and open in new ~windowSubmit form and ~downloadSubmit form toTerminal optionsText WWW browserText areaText fieldTransferringURLUnknown errorUnknown file typeUnknown typeUsemapVT 100 framesV~iew imageWaiting for redirect confirmationWaiting in queueWarningWelcomeWhat to do?You are nowhere!assumedavgcurcurrent speedestimated timeignoring server settingincompletenameofvalue~About~Add~BeOS terminal~Copying~Delete~Download link~Downloads~File~Follow link~Full screen~Go to URL~Help~History~Keys~Language~Link~Modify~OS shell~Reload~Reset form~Save options~Screen~Search~Setup~Submit form~Terminal options~View~Window~XtermProject-Id-Version: ELinks 0.5pre0.CVS
Report-Msgid-Bugs-To: elinks-users@linuxfromscratch.org
POT-Creation-Date: 2012-10-28 14:13+0200
PO-Revision-Date: 2003-01-03 03:41+0100
Last-Translator: Alberto Garc�a <berto@gpul.org>
Language-Team: Galician <gpul-traduccion@ceu.fi.udc.es>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=ISO-8859-1
Content-Transfer-Encoding: 8bit
Acerca deEngadir marcadorVelocidade mediaLogin FTP err�neoResposta FTP incorrectaResposta HTTP incorrectaSintaxe de URL incorrectaN�mero non v�lidoCadea non v�lidaXestor de marcadoresNon se puido saber o estado do socketCaixa de selecci�nPecharT�boa de c�digosCorConexi�nsTipo de contidoLicencia~Xogo de caracteresDatos modificadosDataEliminar extensi�nMostrar ~Usemap�Realmente quere sair de Links (e rematar t�dalas descargas)?�Realmente quere sair de Links?~Informaci�n do documentoDescargarErro de descargaDescargar ~imaxeEditarEditar marcadorTempo transcorridoNon se permite unha cadea baleiraIntroduza unha URLIntroduce n� de ligaz�nErroErro abrindo ficheiroErro lendo dun socketErro durante o env�o do formularioErro escribindo a ficheiroErro escribindo nun socketSair de LinksExtensi�nExtensi�n(s)~SairFallou o comando FTP PORTErro FTP de ficheiroO servicio FTP non est� dispo�ibleNon se atopou o ficheiroEnviar ficheiro~Extensi�ns de ficheirosAtopar ~seguinteAtopar ~anterior~Marco en pantalla completaObtendo as cabeceirasIr a URLIr a ligaz�n~Voltar atr�sInformaci�n das cabeceirasNon se atopou a m�quinaInformaci�n das cabeceirasImaxeInformaci�nErro internoInterrumpidoMarcos KOI8-RTeclasUltima modificaci�nMarcos Linux ou OS/2ID de usuarioBuscando m�quinaEstablecendo conexi�nCach� en memoriaNomeNon hai contidoSen extensi�nsSen marcosSen historialNon hai ningunha ligaz�n seleccionadaNon hai b�squeda anteriorSen programaAgard�base un n�mero no campoAceptarAbrir en nova fiestraSen memoriaContrasinalCampo de contrasinalEnviar (por Post) formulario aBot�n radialPrazo de recepci�n sobrepasadoRecibidosA petici�n debe ser reiniciadaPetici�n enviadaRecursosRestrinxir marcos en cp850/852erro SSLGardarGardar URLErro � gardarGardar � ficheiroBuscarBuscar hacia atr�sBuscar textoBuscar hacia a~tr�sCampo de selecci�nServidorO servidor est� procesando a petici�nTama�oExcepci�n de socketVelocidadeEnviar formulario e abrir nunha fiestra novaEnviar formulario e ~descargarEnviar formulario aOpci�ns de terminalNavegador WWW en modo textoArea de textoCampo de textoTransferindoURLErro desco�ecidoTipo de ficheiro desco�ecidoTipo desco�ecidoUsemapMarcos VT 100~Ver imaxeAgardando pola confirmaci�n da redirecci�nAgardando na colaAvisoBenvido�Qu� fago?�Vostede non est� en ningunha parte!asumidomediaactuaisvelocidade actualtempo estimadoignorando configuraci�n do servidorincompletonomedevalor~Acerca deEng~adirTerminal de ~BeOS~LicenciaBorrarDescargar ~ligaz�n~Descargas~Ficheiro~Seguir ligaz�nPantalla completa~Ir a URL~Axuda~Historial~TeclasLingua~Ligaz�n~ModificarInt�rprete de ~comandos do S.O.~Recargar~Restablecer formulario~Gardar opci�nsPantalla~Buscar~Configuraci�nEnviar formularioOpci�ns de ~terminal~VerFiestra~XtermPK�m�\�*����LC_MESSAGES/pulseaudio.monu�[�������! ,!,;,?R,�,�,
�,�,�,	�,��-��.)/B/E/
L/
Z/e/r/	�/�/	�/	�/	�/�/�/	�/S�/9
41n>	s>$}>&�>(�>2�>'%?M?(m?q�?#@#,@'P@#x@+�@!�@'�@A/A0FB
wC��C=D?PD	�D�D�D�D�D
�D
�D�D
EE2EFEZEnE�E�E�E�E�E�E�EFF)F5FBFOF\FiFvF�F�F�F�F�F�F�F�F�F�FGGG+G8GEGQG^GkGwG�G�G�G�G	�G
�G�G�G�G)�G>HXHgHtH�H_�HIIZIC^I.�I�I;�I
J'J29JlJ�J�J�J�J�J+�J-KDKncK�K�KL<LVLgLL�L�L�L�L!�LM!9M![M}M�M�M�M�M�M
N
NN4NHNbNsN�N�N�N!�N�N�NO6O3PO�O�O)�O�O1�O0P"EP$hP�P�P$�P$�P$
Q"/Q(RQ${Q+�Q�Q!�QR%RAR%\R�R�R �R�R�RS4S1QS�S.�S�S �S�	T-�T�TU/UGUSU
`UkU�U�U�U/�U�U�U	VV'V=VRV	eV	oV
yV�V�V�V�V�V�V#�V"W2>WqW#�W�W
�W�W�W�W�WX'X"@XcX|wXq�XfY)�Y'�Y�Y�YZ$Z3Z&LZsZ)�Z�Z�Z�Z[[[
.[9[P[HV[�[�[�[�[�[�[	\
\\)\9\E\M\Y\l\~\�\�\
�\	�\�\�\
�\]?]L]b] j]�]�]�]
�]�]�]�]�]___H"_k_z_	�_�_S�_;�_#`$<`a`j`�`�`�`�`�`�`	�`�`
a+a8a4Ra>�a4�a:�a�6b�bx�bpc	|c
�c�c�d	�e �e�fhhh"h!Ahch
jh#xh�h�h�h.�hi"i4iQi	dini{i�i�i�iU�i.j4js;jN�j%�j$k	,k6k
JkUkfkuk�k
�k�kK�k�kll/lDlWl
ol�zl:)mHdm)�m�m�m�m�m"n/7n4gn3�n<�n:
o-HoYvo��o8�pG�p*q0>q)oq+�qT�qLr1gr3�r�rK�r59s2os!�sM�s7t4JtOt6�t6uL=uN�u!�u#�uv ?v `v)�v%�v�v%�v#w!8w!Zw|w	�w0�w
�w�w�w�w
�w
�w
�wx
x#x/x5x=xNxUxYx]x`x
expxwx�x�x�x�xyy5yOyjy"�y'�y%�y�y&z5zPz)lz�z;�z;�z;+{Ag{�{�{
�{�{
�{	�{�{�{
||%|
*|�5|h�}'%�jM����nm�t܄#Q�u�
|����$�
,�:�M�Y�(n������4�N�Cf�����ы	݋
�������5S�������������	юێ	�	��	��
�	(��2��ِ��ß(П*��,$�6Q�+��#��,ؠ��'��'á+�'�9?�%y�+��ˢ9Ϣ?	�I��Y�@�@$�e�r�������Ӧ����/�I�c�}�����˧����3�
E�P�
p�
{�����������¨Ψڨ��
��	��!�-�9�E�Q�]�i�u�
������
��
��
��
ũ
Щ
۩���
��3�-?�Cm�
����+Ѫ4��k2�S��
�V��;T���L�����:�S�$m�$����˭ޭ>�B)�/l�w���0�(G�Mp���ϯ���7�!Q�#s���#��%ٰ��/�/D�2t�!��ɱֱ���� '� H�i���-��1��2�(�(E�3n�'��Kʳ)�-@�=n�/��Jܴ#'�:K�?��%Ƶ4�?!�7a�@��?ڶJ�=e�@��8�;�#Y�1}�/��7߸'�6?�9v�1��8�2�6N�>��8ĺM��8K�9�����E��*�$+�$P�u�������Ƚ۽�8�;�J�j�y�����ʾݾ��!�� �76�9n�����(ƿ+�@�*\�.������$����)� >�!_�-��!�����x�)	�33�5g���+��$���'�:G�&��9����*�$.�S�d�t�
������M��1�9�
>�I�\�o�������������������
��,�H�	X�b�#s�����a���	?�7I�����*��������&�F�^�f�So�����	��	��h��Jd�$��8��	
��1�Q�l�������������?��(*�DS�N��D��\,���� K��l�

��,�:<�Dw���C��E
�
S�^�j�"w�#������,��%�"+�N�7n�����#����	�
��(�7�F�yU�=��
�s�b��'��
�"�2�
I�W�p���������e��X�j�y�"����$������<��X*�D��
��������!�23�8f�K��]��LI�D��c���?�?2�hr�4��4�2E�0x�h��\�Bo�2��&��V�>c�7��(��d�<h�5��_��?;�:{�U��U�)b�/��,��.��/�2H�3{�!��,��,��++�+W���
��;��
��������
��
�
�.�
M�X�d�l� x�����������
����/��(��)�/H�%x�)��*��)��*�,H�2u�7��5���6,�*c�+��9��,��=!�:_�=��C��/�
L�
W�)b�
����������+�����������Mp�����D������#.�R�X��e�
�
�"(�K�W�-l������P-v�|�����;.$�>Z�_z��t��������@�����H�41�7���\���9 r([���u�������������}��,��**�Eok��u�b�~��+��G=��:3	#���"MXJghijk����W��5p��g�
��ABxNUs���2;'QtR#�����dA�c0 ���6�!�\����?@�X1bSnL�<�w"n��l��/a�����v�!�O��,5����sB��������8�-����������^L�y�cf���/����������K�>��EF~����0���+2����i9��?�Q�
��q��|��
���
�D'�CD�`�(4	{{�������y�����$%w��z�I������deJMpFY:���o�h�q��)NOP6STUVWmV�YZ[&]^_`a�&�K���)�3��f�x�=��8������e�]���}�rC�������<7%�.����	GH�m�T��
�l��j�
R�I�			Part of profile(s): %s			Properties:
				%s
		%s: %s (sinks: %u, sources: %u, priority: %u, available: %s)
	Active Port: %s
	Active Profile: %s
	Formats:
	Ports:
	Profiles:

  -h, --help                            Show this help
      --version                         Show version

  -s, --server=SERVER                   The name of the server to connect to
  -n, --client-name=NAME                How to call this client on the server

  -h, --help                            Show this help
      --version                         Show version
When no command is given pacmd starts in the interactive mode.

The special names @DEFAULT_SINK@, @DEFAULT_SOURCE@ and @DEFAULT_MONITOR@
can be used to specify the default sink, source and monitor.
### Read from configuration file: %s ###
#N#N 1|0#N 1|0|toggle#N FORMATS#N KEY=VALUE#N SINK|SOURCE#N VOLUME#N VOLUME [VOLUME ...]%0.1f GiB%0.1f KiB%0.1f MiB%s %uch %uHz%s Input%s Output%s [-D display] [-S server] [-O sink] [-I source] [-c file]  [-d|-e|-i|-r]

 -d    Show current PulseAudio data attached to X11 display (default)
 -e    Export local PulseAudio data to X11 display
 -i    Import PulseAudio data from X11 display to local environment variables and cookie file.
 -r    Remove PulseAudio data from X11 display
%s [options]

COMMANDS:
  -h, --help                            Show this help
      --version                         Show version
      --dump-conf                       Dump default configuration
      --dump-modules                    Dump list of available modules
      --dump-resample-methods           Dump available resample methods
      --cleanup-shm                     Cleanup stale shared memory segments
      --start                           Start the daemon if it is not running
  -k  --kill                            Kill a running daemon
      --check                           Check for a running daemon (only returns exit code)

OPTIONS:
      --system[=BOOL]                   Run as system-wide instance
  -D, --daemonize[=BOOL]                Daemonize after startup
      --fail[=BOOL]                     Quit when startup fails
      --high-priority[=BOOL]            Try to set high nice level
                                        (only available as root, when SUID or
                                        with elevated RLIMIT_NICE)
      --realtime[=BOOL]                 Try to enable realtime scheduling
                                        (only available as root, when SUID or
                                        with elevated RLIMIT_RTPRIO)
      --disallow-module-loading[=BOOL]  Disallow user requested module
                                        loading/unloading after startup
      --disallow-exit[=BOOL]            Disallow user requested exit
      --exit-idle-time=SECS             Terminate the daemon when idle and this
                                        time passed
      --scache-idle-time=SECS           Unload autoloaded samples when idle and
                                        this time passed
      --log-level[=LEVEL]               Increase or set verbosity level
  -v  --verbose                         Increase the verbosity level
      --log-target={auto,syslog,stderr,file:PATH,newfile:PATH}
                                        Specify the log target
      --log-meta[=BOOL]                 Include code location in log messages
      --log-time[=BOOL]                 Include timestamps in log messages
      --log-backtrace=FRAMES            Include a backtrace in log messages
  -p, --dl-search-path=PATH             Set the search path for dynamic shared
                                        objects (plugins)
      --resample-method=METHOD          Use the specified resampling method
                                        (See --dump-resample-methods for
                                        possible values)
      --use-pid-file[=BOOL]             Create a PID file
      --no-cpu-limit[=BOOL]             Do not install CPU load limiter on
                                        platforms that support it.
      --disable-shm[=BOOL]              Disable shared memory support.
      --enable-memfd[=BOOL]             Enable memfd shared memory support.

STARTUP SCRIPT:
  -L, --load="MODULE ARGUMENTS"         Load the specified plugin module with
                                        the specified argument
  -F, --file=FILENAME                   Run the specified script
  -C                                    Open a command line on the running TTY
                                        after startup

  -n                                    Don't load default script file
%u B(invalid)--daemonize expects boolean argument--disable-shm expects boolean argument--disallow-exit expects boolean argument--disallow-module-loading expects boolean argument--enable-memfd expects boolean argument--fail expects boolean argument--high-priority expects boolean argument--log-level expects log level argument (either numeric in range 0..4 or one of debug, info, notice, warn, error).--log-meta expects boolean argument--log-time expects boolean argument--no-cpu-limit expects boolean argument--realtime expects boolean argument--start not supported for system instances.--system expects boolean argument--use-pid-file expects boolean argument1|0ALSA woke us up to read new data from the device, but there was actually nothing to read.
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.
We were woken up with POLLIN set -- however a subsequent snd_pcm_avail() returned 0 or another value < min_avail.ALSA woke us up to write new data to the device, but there was actually nothing to write.
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.
We were woken up with POLLOUT set -- however a subsequent snd_pcm_avail() returned 0 or another value < min_avail.Access deniedAllocated during whole lifetime: %u block containing %s bytes total.
Allocated during whole lifetime: %u blocks containing %s bytes total.
Always keeps at least one sink loaded even if it's a null oneAlways keeps at least one source loaded even if it's a null oneAmplifierAnalog InputAnalog MonoAnalog Mono DuplexAnalog Mono OutputAnalog OutputAnalog StereoAnalog Stereo DuplexAnalog Surround 2.1Analog Surround 3.0Analog Surround 3.1Analog Surround 4.0Analog Surround 4.1Analog Surround 5.0Analog Surround 5.1Analog Surround 6.0Analog Surround 6.1Analog Surround 7.0Analog Surround 7.1Audio on @HOSTNAME@Author: %s
Automatic Gain ControlAuxiliary 0Auxiliary 1Auxiliary 10Auxiliary 11Auxiliary 12Auxiliary 13Auxiliary 14Auxiliary 15Auxiliary 16Auxiliary 17Auxiliary 18Auxiliary 19Auxiliary 2Auxiliary 20Auxiliary 21Auxiliary 22Auxiliary 23Auxiliary 24Auxiliary 25Auxiliary 26Auxiliary 27Auxiliary 28Auxiliary 29Auxiliary 3Auxiliary 30Auxiliary 31Auxiliary 4Auxiliary 5Auxiliary 6Auxiliary 7Auxiliary 8Auxiliary 9Bad stateBass BoostBluetooth InputBluetooth OutputBoostBuffer metrics: maxlength=%u, fragsize=%uBuffer metrics: maxlength=%u, tlength=%u, prebuf=%u, minreq=%uBuilt-in AudioCARD PROFILECARD-NAME|CARD-#N PORT OFFSETCannot access autospawn lock.Capture audio data from a PulseAudio sound server and write it to STDOUT or the specified file.Capture audio data from a PulseAudio sound server and write it to a file.CarCard #%u
	Name: %s
	Driver: %s
	Owner Module: %s
	Properties:
		%s
Channel map doesn't match sample specificationChat OutputClient #%u
	Driver: %s
	Owner Module: %s
	Properties:
		%s
Client forkedClocked NULL sinkConnected to device %s (index: %u, suspended: %s).Connection established.%sConnection failure: %sConnection failure: %s
Connection refusedConnection terminatedCookie: %s
Cork request stack is empty: corking streamCork request stack is empty: uncorking streamCould not parse latency offsetCurrently in use: %u block containing %s bytes total.
Currently in use: %u blocks containing %s bytes total.
DEPRECATION WARNING: %s
Daemon not responding.Daemon startup failed.Daemon startup without any loaded modules, refusing to work.Description: %s
Device or resource busyDigital Input (S/PDIF)Digital Output (S/PDIF)Digital Stereo (HDMI)Digital Stereo (IEC958)Digital Stereo Duplex (IEC958)Digital Surround 4.0 (IEC958/AC3)Digital Surround 5.1 (HDMI)Digital Surround 5.1 (IEC958/AC3)Digital Surround 5.1 (IEC958/DTS)Dock MicrophoneDocking Station InputDocking Station Line InDocking Station MicrophoneDraining connection to server.Dummy OutputEntity existsEntity killedEvent '%s' on %s #%u
External MicrophoneFFT based equalizer on %sFILENAME SINK|#NFILENAME [NAME]FRAMESFailed to acquire stdio.Failed to add bind-now-loader.Failed to allocate new dl loader.Failed to change GID: %sFailed to change UID: %sFailed to change group list: %sFailed to create '%s': %sFailed to determine sample specification from file.Failed to drain stream: %sFailed to find group '%s'.Failed to find original lt_dlopen loader.Failed to find user '%s'.Failed to generate sample specification for file.Failed to get FQDN.
Failed to get card information: %sFailed to get client information: %sFailed to get latency: %sFailed to get machine IDFailed to get module information: %sFailed to get sample information: %sFailed to get server information: %sFailed to get sink information: %sFailed to get sink input information: %sFailed to get source information: %sFailed to get source output information: %sFailed to get statistics: %sFailed to kill PulseAudio daemon.Failed to kill daemon: %sFailed to load cookie data
Failed to open audio file.Failed to open configuration file: %sFailed to open module %s: %sFailed to open sound file.Failed to open target file '%s'.Failed to parse command line.Failed to parse command line.
Failed to parse cookie dataFailed to parse cookie data
Failed to parse the argument for --monitor-streamFailed to save cookie data
Failed to set format: invalid format string %sFailed to set media name.Failed to set monitor stream: %sFailed to set volume: You tried to set volumes for %d channel, whereas channel(s) supported = %d
Failed to set volume: You tried to set volumes for %d channels, whereas channel(s) supported = %d
Failed to unload module: Module %s not loadedFailed to upload sample: %sFailure to resume: %s
Failure to suspend: %s
Failure: %sFront CenterFront LeftFront Left-of-centerFront MicrophoneFront RightFront Right-of-centerGID of user '%s' and of group '%s' don't match.Game OutputGeneral Purpose EqualizerGot EOF.Got SIGINT, exiting.Got SIGINT, exiting.
Got signal, exiting.HDMI / DisplayPortHandsfreeHeadphoneHeadphonesHeadphones Mono OutputHeadsetHeadset Audio Gateway (HSP/HFP)Headset Head Unit (HSP/HFP)Headset MicrophoneHiFiHigh Fidelity Capture (A2DP Source)High Fidelity Playback (A2DP Sink)Home directory of user '%s' is not '%s', ignoring.Incompatible protocol versionInconsistent volume specification.
InputInput DevicesInput/Output errorInternal MicrophoneInternal errorInvalid argumentInvalid channel map '%s'Invalid client name '%s'Invalid latency specification '%s'Invalid log target.Invalid log target: use either 'syslog', 'journal', 'stderr' or 'auto' or a valid file name 'file:<path>', 'newfile:<path>'.Invalid log target: use either 'syslog', 'stderr' or 'auto' or a valid file name 'file:<path>', 'newfile:<path>'.Invalid mute specificationInvalid number of volume specifications.
Invalid process time specification '%s'Invalid property '%s'Invalid resample method '%s'.Invalid sample specificationInvalid serverInvalid sink input indexInvalid sink input index specificationInvalid source output indexInvalid source output index specificationInvalid stream name '%s'Invalid suspend specification.Invalid volume specificationLine InLine OutLoad Once: %s
MicrophoneMissing implementationModemModule #%u
	Name: %s
	Argument: %s
	Usage counter: %s
	Properties:
		%s
Module initialization failedMonoMultichannelMultichannel DuplexMultichannel InputMultichannel OutputNAMENAME FILENAMENAME SINK|#NNAME [ARGS ...]NAME [SINK]NAME|#NNAME|#N 1|0NAME|#N 1|0|toggleNAME|#N KEY=VALUENAME|#N PORTNAME|#N VOLUMENAME|#N VOLUME [VOLUME ...]NUMERIC-LEVELName: %s
No AmplifierNo Automatic Gain ControlNo Bass BoostNo BoostNo PulseAudio daemon running, or not running as session daemon.No authentication keyNo dataNo module information available
No such entityNo such extensionNo valid command specified.Not supportedNot yet implemented.
Null OutputOKOK, so you are running PA in system mode. Please make sure that you actually do want to do that.
Please read http://www.freedesktop.org/wiki/Software/PulseAudio/Documentation/User/WhatIsWrongWithSystemWide/ for an explanation why system mode is usually a bad idea.Obsolete functionalityOffOnOpening a %s stream with sample specification '%s' and channel map '%s'.Output DevicesPATHNAMEPath: %s
PhonePlay back audio data from STDIN or the specified file on a PulseAudio sound server.Play back encoded audio files on a PulseAudio sound server.Playback stream drained.Please specify a sample file to loadPortablePremature end of fileProtocol errorPulseAudio Sound ServerPulseAudio Sound SystemRAOP standard profileRadioRear CenterRear LeftRear MicrophoneRear RightReceived message for unknown extension '%s'Root privileges required.Running in system mode, but --disallow-exit not set.Running in system mode, but --disallow-module-loading not set.Running in system mode, forcibly disabling SHM mode.Running in system mode, forcibly disabling exit idle time.Sample #%u
	Name: %s
	Sample Specification: %s
	Channel Map: %s
	Volume: %s
	        balance %0.2f
	Duration: %0.1fs
	Size: %s
	Lazy: %s
	Filename: %s
	Properties:
		%s
Sample cache size: %s
Server String: %s
Library Protocol Version: %u
Server Protocol Version: %u
Is Local: %s
Client Index: %u
Tile Size: %zu
Server: %s
Side LeftSide RightSink #%u
	State: %s
	Name: %s
	Description: %s
	Driver: %s
	Sample Specification: %s
	Channel Map: %s
	Owner Module: %u
	Mute: %s
	Volume: %s
	        balance %0.2f
	Base Volume: %s
	Monitor Source: %s
	Latency: %0.0f usec, configured %0.0f usec
	Flags: %s%s%s%s%s%s%s
	Properties:
		%s
Sink Input #%u
	Driver: %s
	Owner Module: %s
	Client: %s
	Sink: %u
	Sample Specification: %s
	Channel Map: %s
	Format: %s
	Corked: %s
	Mute: %s
	Volume: %s
	        balance %0.2f
	Buffer Latency: %0.0f usec
	Sink Latency: %0.0f usec
	Resample method: %s
	Properties:
		%s
Sink: %s
Source #%u
	State: %s
	Name: %s
	Description: %s
	Driver: %s
	Sample Specification: %s
	Channel Map: %s
	Owner Module: %u
	Mute: %s
	Volume: %s
	        balance %0.2f
	Base Volume: %s
	Monitor of Sink: %s
	Latency: %0.0f usec, configured %0.0f usec
	Flags: %s%s%s%s%s%s
	Properties:
		%s
Source Output #%u
	Driver: %s
	Owner Module: %s
	Client: %s
	Source: %u
	Sample Specification: %s
	Channel Map: %s
	Format: %s
	Corked: %s
	Mute: %s
	Volume: %s
	        balance %0.2f
	Buffer Latency: %0.0f usec
	Source Latency: %0.0f usec
	Resample method: %s
	Properties:
		%s
Source: %s
SpeakerSpeakersSpecify nothing, or one of: %sStart the PulseAudio Sound SystemStereoStereo DuplexStream buffer attributes changed.%sStream device resumed.%sStream device suspended.%sStream error: %sStream moved to device %s (%u, %ssuspended).%sStream overrun.%sStream started.%sStream successfully created.Stream underrun.%sSubwooferSurround 4.0Surround 4.1Surround 5.0Surround 5.1Surround 7.1System mode refused for non-root user. Only starting the D-Bus server lookup service.System wide mode unsupported on this platform.TARGETThe specified default channel map has a different number of channels than the specified default number of channels.This program is not intended to be run as root (unless --system is specified).Time: %0.3f sec; Latency: %0.0f usec.TimeoutToo largeToo many arguments.Top CenterTop Front CenterTop Front LeftTop Front RightTop Rear CenterTop Rear LeftTop Rear RightTried to open target file '%s', '%s.1', '%s.2' ... '%s.%d', but all failed.Tunnel for %s@%sTunnel to %s/%sUnknown commandUnknown device modelUnknown error codeUnknown file format %s.Usage: %s
User Name: %s
Host Name: %s
Server Name: %s
Server Version: %s
Default Sample Specification: %s
Default Channel Map: %s
Default Sink: %s
Default Source: %s
Cookie: %04x:%04x
User-configured server at %s, refusing to start/autospawn.User-configured server at %s, which appears to be local. Probing deeper.Using sample spec '%s', channel map '%s'.Version: %s
VideoVirtual LADSPA sinkVirtual surround sinkVolume outside permissible range.
WARNING: Child process terminated by signal %u
WARNING: Sound server is not local, not suspending.
Warning: Failed to determine channel map from file.Warning: Failed to determine sample specification from file.Warning: Received more uncork requests than cork requests.Warning: failed to write channel map to file.Warning: specified sample specification will be overwritten with specification from file.XDG_RUNTIME_DIR (%s) is not owned by us (uid %d), but by uid %d! (This could e.g. happen if you try to connect to a non-root PulseAudio as a root user, over the native protocol. Don't do that.)You have to specify a card name/index and a profile nameYou have to specify a card name/index, a port name and a latency offsetYou have to specify a module index or nameYou have to specify a module name and arguments.You have to specify a sample name to playYou have to specify a sample name to removeYou have to specify a sink index and a semicolon-separated list of supported formatsYou have to specify a sink input index and a mute action (0, 1, or 'toggle')You have to specify a sink input index and a sinkYou have to specify a sink input index and a volumeYou have to specify a sink nameYou have to specify a sink name/index and a mute action (0, 1, or 'toggle')You have to specify a sink name/index and a port nameYou have to specify a sink name/index and a volumeYou have to specify a source nameYou have to specify a source name/index and a mute action (0, 1, or 'toggle')You have to specify a source name/index and a port nameYou have to specify a source name/index and a volumeYou have to specify a source output index and a mute action (0, 1, or 'toggle')You have to specify a source output index and a sourceYou have to specify a source output index and a volumeYou may not specify more than one sink. You have to specify a boolean value.You may not specify more than one source. You have to specify a boolean value.[%s:%u] Invalid channel map '%s'.[%s:%u] Invalid fragment size '%s'.[%s:%u] Invalid log level '%s'.[%s:%u] Invalid log target '%s'.[%s:%u] Invalid nice level '%s'.[%s:%u] Invalid number of fragments '%s'.[%s:%u] Invalid resample method '%s'.[%s:%u] Invalid rlimit '%s'.[%s:%u] Invalid sample channels '%s'.[%s:%u] Invalid sample format '%s'.[%s:%u] Invalid sample rate '%s'.[%s:%u] Invalid server type '%s'.[TYPE][options]autoclean=<automatically unload unused filters?>bidirectionalcardchangeclientconnect(): %sdup2(): %sexecvp(): %s
fork() failed: %sfork(): %sfork(): %s
inputinvalidio_new() failed.modulen/anewnonot open(): %soutputpa_context_connect() failed: %spa_context_new() failed.pa_context_new() failed.
pa_context_rttime_new() failed.pa_core_new() failed.pa_mainloop_new() failed.pa_mainloop_new() failed.
pa_mainloop_run() failed.pa_mainloop_run() failed.
pa_pid_file_create() failed.pa_stream_begin_write() failed: %spa_stream_connect_playback() failed: %spa_stream_connect_record() failed: %spa_stream_drain(): %spa_stream_get_buffer_attr() failed: %spa_stream_new() failed: %spa_stream_peek() failed: %spa_stream_update_timing_info() failed: %spa_stream_write() failed: %spacat %s
Compiled with libpulse %s
Linked with libpulse %s
pacmd %s
Compiled with libpulse %s
Linked with libpulse %s
pactl %s
Compiled with libpulse %s
Linked with libpulse %s
pasuspender %s
Compiled with libpulse %s
Linked with libpulse %s
pipe() failed: %splaybackpoll(): %sread() failed: %sread(): %srecordingremovesample-cacheserversetsid() failed: %ssinksink-inputsink_name=<name for the sink> sink_properties=<properties for the sink> master=<name of sink to filter> sink_master=<name of sink to filter> format=<sample format> rate=<sample rate> channels=<number of channels> channel_map=<channel map> use_volume_sharing=<yes or no> force_flat_volume=<yes or no> hrir=/path/to/left_hrir.wav autoloaded=<set if this module is being loaded automatically> sink_name=<name for the sink> sink_properties=<properties for the sink> sink_input_properties=<properties for the sink input> master=<name of sink to filter> sink_master=<name of sink to filter> format=<sample format> rate=<sample rate> channels=<number of channels> channel_map=<input channel map> plugin=<ladspa plugin name> label=<ladspa plugin label> control=<comma separated list of input control values> input_ladspaport_map=<comma separated list of input LADSPA port names> output_ladspaport_map=<comma separated list of output LADSPA port names> autoloaded=<set if this module is being loaded automatically> sink_name=<name of the sink> sink_properties=<properties for the sink> sink_master=<sink to connect to> format=<sample format> rate=<sample rate> channels=<number of channels> channel_map=<channel map> autoloaded=<set if this module is being loaded automatically> use_volume_sharing=<yes or no> snd_pcm_avail() returned a value that is exceptionally large: %lu byte (%lu ms).
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.snd_pcm_avail() returned a value that is exceptionally large: %lu bytes (%lu ms).
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.snd_pcm_avail_delay() returned strange values: delay %lu is less than avail %lu.
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.snd_pcm_delay() returned a value that is exceptionally large: %li byte (%s%lu ms).
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.snd_pcm_delay() returned a value that is exceptionally large: %li bytes (%s%lu ms).
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.snd_pcm_mmap_begin() returned a value that is exceptionally large: %lu byte (%lu ms).
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.snd_pcm_mmap_begin() returned a value that is exceptionally large: %lu bytes (%lu ms).
Most likely this is a bug in the ALSA driver '%s'. Please report this issue to the ALSA developers.socket(PF_UNIX, SOCK_STREAM, 0): %ssourcesource-outputsource_name=<name for the source> source_properties=<properties for the source> source_master=<name of source to filter> sink_name=<name for the sink> sink_properties=<properties for the sink> sink_master=<name of sink to filter> adjust_time=<how often to readjust rates in s> adjust_threshold=<how much drift to readjust after in ms> format=<sample format> rate=<sample rate> channels=<number of channels> channel_map=<channel map> aec_method=<implementation to use> aec_args=<parameters for the AEC engine> save_aec=<save AEC data in /tmp> autoloaded=<set if this module is being loaded automatically> use_volume_sharing=<yes or no> use_master_format=<yes or no> unknownwaitpid(): %swrite() failed: %swrite(): %sxcb_connect() failedxcb_connection_has_error() returned trueyesProject-Id-Version: PulseAudio
Report-Msgid-Bugs-To: https://gitlab.freedesktop.org/pulseaudio/pulseaudio/issues/new
PO-Revision-Date: 2019-02-20 01:36+0200
Last-Translator: Fran Dieguez <frandieguez@gnome.org>
Language-Team: Galician
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
			Parte do perfil(s): %s			Propiedades:
				%s
		%s: %s (sinks: %u, orixes: %u, prioridade: %u, dispoñíbel: %s)
	Porto activo: %s
	Perfil activo: %s
	Formatos:
	Portos:
	Perfís:

  -h, --help                            Mostra esta axuda
      --version                         Mostra a versión
  -s, --server=SERVIDOR                 O nome do servidor co que conectar
  -n, --client-name=NOME                Como chamar a este cliente no servidor

  -h, --help                            Mostrar esta axuda
      --version                         Mostrar a versión
Cando non se dá ningunha orde, pacmd iníciase no modo interactivo.

Os nomes especiais @DEFAULT_SINK@, @DEFAULT_SOURCE@ e @DEFAULT_MONITOR@
poden usarse para especificar o destino, orixe e monitor predeterminados.
### Lendo desde o ficheiro de configuración: %s ###
#N#N 1|0#N 1|0|alternar#N FORMATOS#N CLAVE=VALOR#N SUMIDEIRO|ORIXE#N VOLUME#N VOLUME [VOLUME ...]%0.1f GiB%0.1f KiB%0.1f MiB%s %uch %uHzEntrada %sSaída %s%s [-D pantalla] [-S servidor] [-O destino] [-I orixe] [-c ficheiro]  [-d|-e|-i|-r]

 -d    Mostra os datos actuais de PulseAudio asociados a unha pantalla X11 (por omisión)
 -e    Exporta os datos locais de PulseAudio a unha pantalla X11
 -i    Importa os datos de PulseAudio dunha pantalla X11 cara ás variables de contorno local e o ficheiro de cookies.
 -r    Elimina todos os datos de PulseAudio dunha pantalla X11
%s [opcións]

ORDES:
  -h, --help                            Mostra esta axuda
      --version                         Mostra a versión
      --dump-conf                       Envorca  a configuración predeterminada
      --dump-modules                    Envorca unha lista de módulos dispoñíbeis
      --dump-resample-methods           Envorca os métodos dispoñíbeis de nova mostraxe
      --cleanup-shm                     Limpa os segmentos de memoria compartidos
      --start                           Inicia o «daemon», se aínda non está executándose
  -k  --kill                            Detén un «daemon» que estea executándose
      --check                           Verifica que «daemon» está executándose (só devolve código de saída)

OPCIÓNS:
      --system[=BOOL]                   Executase como única instancia a nivel do sistema
  -D, --daemonize[=BOOL]                Convertese en daemon despois de iniciarse
      --fail[=BOOL]                     Pechase cando falla o inicio
      --high-priority[=BOOL]            Tenta estabelecer un nivel alto agradábel
                                        (só dispoñíbel como root, cando o SUID ou
                                        RLIMIT_NICE son elevados)
      --realtime[=BOOL]                 Tenta activar a planificación en tempo real
                                        (só dispoñíbel como root, cando o SUID ou
                                        RLIMIT_RTPRIO son elevados)
      --disallow-module-loading[=BOOL]  Non permite a carga/descarga do módulo polo usuario
                                        despois de que se teña iniciado
      --disallow-exit[=BOOL]            Non permite a petición do usuario de abandonar o programa
      --exit-idle-time=SECS             Desactiva un daemon cando está desocupado e
                                        transcorreu esa cantidade de tempo
      --scache-idle-time=SECS           Descarga mostras cargadas automaticamente cando están
                                       desocupados e transcorreu esa cantidade de tempo
      --log-level[=LEVEL]               Aumenta ou define o grao da saída a utilizar
  -v  --verbose                         Incrementa o nivel de detalles na información de saída
      --log-target={auto,syslog,stderr,file:PATH,newfile:PATH}
                                        Especifica o destino do rexistro
      --log-meta[=BOOL]                 Incluír a localización do código nos mensaxes de rexistro
      --log-time[=BOOL]                 Incluír a pegada de tempo nos mensaxes de rexistro
      --log-backtrace=FRAMES            Incluír unha busca inversa nas mensaxes do rexistro
  -p, --dl-search-path=PATH             Estabelece a ruta de busca para os obxectos dinámicos compartidos
                                       (engadidos)
      --resample-method=METHOD          Utiliza un método de nova mostraxe específico
                                        (Ver en --dump-resample-methods os valores posíbeis)
      --use-pid-file[=BOOL]             Crea o ficheiro PID
      --no-cpu-limit[=BOOL]             Non instala un limitador de carga de CPU en
                                        plataformas que o admitan.
      --disable-shm[=BOOL]              Desactiva a compatibilidade para memoria compartida.
      --enable-memfd[=BOOL]             Activa a compatibilidade para a memoria compartida memfd.

SCRIPT DE INICIO:
  -L, --load="MODULE ARGUMENTS"      Carga o módulo engadido cos parámetros indicados
  -F, --file=FILENAME                   Executa o script especificado
  -C                                    Abre unha liña de ordes na TTY actual despois de iniciar

  -n                                    Non carga o ficheiro script predeterminado
%u B(incorrecto)--daemonize agarda un argumento booleano--disable-shm agarda un argumento booleano--disallow-exit agarda un argumento booleano--disallow-module-loading agarda un argumento booleano--enable-memfd espera un argumento booleano--fail agarda un argumento booleano--high-priority agarda un argumento booleano--log-level agarda un argumento no nivel do rexistro (xa sexa numérico, dentro do rango de 0..4; xa sexa un de debug, info, notice, warn, ou error).--log-meta agarda un argumento booleano--log-time agarda un argumento booleano--no-cpu-limit agarda un argumento booleano--realtime agarda un argumento booleano--start no está permitido para as instancias do sistema.--system agarda un argumento booleano--use-pid-file agarda un argumento booleano1|0ALSA espertou para ler datos novos desde o dispositivo pero non había nada que ler.
Probabelmente sexa un fallo no controlador de ALSA «%s». Por favor, informe desta incidencia aos desenvolvedores de ALSA.
Espertáronnos co POLLIN -- con todo un posterior snd_pcm_avail() devolveu 0 ou outro valor < min_avail.ALSA espertou para escribir datos novos no dispositivo pero non había nada que escribir.
Probabelmente sexa un fallo no controlador de ALSA «%s». Por favor, informe desta incidencia aos desenvolvedores de ALSA.
Espertáronnos co POLLOUT -- con todo un posterior snd_pcm_avail() devolveu 0 ou outro valor < min_avail.Acceso denegadoAsignados ao longo do tempo: %u bloques contendo %s bytes en total.
Asignados ao longo do tempo: %u bloques contendo %s bytes en total.
Manter sempre polo menos un destino cargado aínda que sexa nuloManter sempre polo menos unha orixe cargado aínda que sexa nulaAmplificadorEntrada analóxicaMonoaural analóxicoMonoaural analóxico dúplexSaída monoaural analóxicaSaída analóxicaEstéreo analóxicoEstéreo analóxico dúplexEnvolvente analóxico 2.1Envolvente analóxico 3.0Envolvente analóxico 3.1Envolvente analóxico 4.0Envolvente analóxico 4.1Envolvente analóxico 5.0Envolvente analóxico 5.1Envolvente analóxico 6.0Envolvente analóxico 6.1Envolvente analóxico 7.0Envolvente analóxico 7.1Son en @HOSTNAME@Autor: %s
Control automático de gananciaAuxiliar 0Auxiliar 1Auxiliar 10Auxiliar 11Auxiliar 12Auxiliar 13Auxiliar 14Auxiliar 15Auxiliar 16Auxiliar 17Auxiliar 18Auxiliar 19Auxiliar 2Auxiliar 20Auxiliar 21Auxiliar 22Auxiliar 23Auxiliar 24Auxiliar 25Auxiliar 26Auxiliar 27Auxiliar 28Auxiliar 29Auxiliar 3Auxiliar 30Auxiliar 31Auxiliar 4Auxiliar 5Auxiliar 6Auxiliar 7Auxiliar 8Auxiliar 9Estado defectuosoEnfatizador baixoEntrada de BluetoothSaída de BluetoothEnfatizadorMétrica do búfer: maxlenght=%u, fragsize=%uMétrica do búfer: maxlenght=%u, tlenghth=%u, prebuf=%u, minreq=%uAudio internoPERFIL DA TARXETANOME-DA-TARXETA|TARXETA-#N DESFASE DO PORTONon é posíbel acceder ao bloqueo de autoxeración.Capturar datos de son dun servidor de son de PulseAudio e escribilos a STDOUT ou a un ficheiro específico.Capturar datos de son dun servidor de son de PulseAudio e escribilos a un ficheiro.AutomóbilTarxeta #%u
	Nome: %s
	Controlador: %s
	propietario do módulo: %s
	Propiedades:
		%s
O mapa de canles non coincide coa especificación da mostraSaída do chatCliente #%u
	Controlador: %s
	Propietario do módulo: %s
	Propiedades:
		%s
Cliente bifurcadoDestino nulo sincronizadoConectado ao dispositivo %s (índice: %u, suspendido: %s).Conexión estabelecida.%sProduciuse un fallo na conexión: %sProduciuse un erro na conexión: %s
Conexión rexeitadaConexión rematadaCookie: %s
A pila de peticións de paradas está baleira: detendo o fluxoA pila de peticións de paradas está baleira: continuando o fluxoNon foi posíbel procesar o desfase da latenciaActualmente en uso: %u bloques contendo %s bytes en total.
Actualmente en uso: %u bloques contendo %s bytes en total.
AVISO DE OBSOLESCENCIA: %s
O daemon non responde.Produciuse un fallo no inicio do daemon.Iniciouse o daemon sen ningún módulo cargado, polo que se nega a funcionar.Descrición: %s
Dispositivo ou recurso ocupadoEntrada dixital (S/PDIF)Saída dixital (S/PDIF)Estéreo dixital (HDMI)Estéreo dixital (IEC958)Estéreo dixital dúplex (IEC958)Envolvente dixital 4.0 (IEC958/AC3)Envolvente dixital 5.1 (HDMI)Envolvente dixital 5.1 (IEC958/AC3)Envolvente dixital 5.1 (IEC958/ACDTS)Micrófono do acopleEntrada de estación acoplada (Docking Station)Entrada de estación acoplada (Docking Station)Micrófono da estación acoplada (Docking Station)Drenando a conexión co servidor.Saída parvaEntidade existenteEntidade rematadaEvento «%s» en %s #%u
Micrófono externoEcualizador baseado en FFT en %sNOME DE FICHEIRO DO SUMIDEIRO|#NNOME_DE_FICHEIRO [NOME]MOSTRASProduciuse un fallo ao tentar adquirir stdio.Produciuse un fallo ao engadir o bind-now-loader.Produciuse un fallo ao asignar o cargador dl novo.Produciuse un fallo ao cambiar o GID: %sProduciuse un fallo ao cambiar o UID: %sProduciuse un fallo ao cambiar a lista do grupo: %sProduciuse un fallo ao crear «%s»: %sProduciuse un fallo ao determinar a especificación de exemplo do ficheiro.Produciuse un fallo ao drenar o fluxo: %sProduciuse un fallo ao buscar o grupo «%s».Produciuse un fallo ao buscar o cargador llt_dlopen orixinal.Produciuse un fallo ao buscar o usuario «%s».Produciuse un fallo ao xerar a especificación de exemplo para o ficheiro.Produciuse un fallo ao obter FQDN.
Produciuse un fallo ao obter a información da tarxeta: %sProduciuse un fallo ao tentar obter información do cliente: %sNon foi posíbel obter a latencia: %sProduciuse un fallo ao tentar obter o ID da máquinaProduciuse un fallo ao tentar obter información do módulo: %sProduciuse un fallo ao obter información da mostra: %sProduciuse un fallo ao tentar obter información do servidor: %sProduciuse un fallo ao tentar obter información do destino: %sProduciuse un fallo ao tentar obter información da entrada do destino: %sProduciuse un fallo ao tentar obter información da orixe: %sProduciuse un fallo ao obter información de saída da orixe: %sProduciuse un fallo ao tentar obter as estatísticas: %sProduciuse un fallo ao tentar deter o daemon de PulseAudio.Non foi posíbel deter o daemon: %sProduciuse un fallo ao cargar os datos da cookie
Produciuse un fallo ao abrir o ficheiro de son.Non foi posíbel abrir o ficheiro de configuración: %sNon foi posíbel abrir o módulo %s: %sProduciuse un fallo ao tentar abrir o ficheiro de son.Produciuse un fallo abrindo o ficheiro de destino «%s».Produciuse un fallo ao analizar a liña de ordes.Produciuse un fallo ao interpretar unha liña de ordes.
Produciuse un fallo ao analizar os datos da cookieProduciuse un fallo ao interpretar os datos da cookie
Produciuse un fallo analizando o argumento de --monitor-streamProduciuse un fallo ao tentar gardar os datos da cookie
Produciuse un fallo ao estabelecer o formato: cadea de formato non válida %sProduciuse un fallo ao estabelecer o nome do multimedia.Produciuse un fallo ao estabelecer o fluxo do monitor: %sProduciuse un fallo ao estabelecer o volume: tentou estabelecer o volume para %d canles, cando os canles permitidos son = %d
Produciuse un fallo ao estabelecer o volume: tentou estabelecer o volume para %d canles, cando os canles permitidos son = %d
Produciuse un fallo a descarga do módulo: O módulo %s non se cargouProduciuse un fallo ao enviar a mostra: %sProduciuse un erro ao continuar: %s
Produciuse un erro ao suspender: %s
Produciuse un fallo en: %sFronte centralFronte esquerdaFrontal esquerda centralMicrófono frontalFronte dereitaFrontal dereita centralO GID do usuario «%s» e do grupo «%s» non coinciden.Saída do xogoEcualizador de propósito xeralObtívose EOF.Obtívose SIGINT, saíndo.Obtívose SIGINT, saíndo.
Obtívose sinal, saíndo.HDMI / DisplayPortSen mansAuricularesAuricularesSaída monoaural para auricularesAuriculares con microEntrada de son por auriculares con micrófono (HSP/HFP)Unidade de auriculares con micrófono de cabeza (HSP/HFP)Micrófono con auricularHifiCaptura en alta fidelidade (A2DP fonte )Reprodución en alta fidelidade (A2DP Sink)O cartafol de inicio do usuario «%s» non é «%s», ignorando.A versión de protocolo non é compatíbelA especificación do volume é inconsistente.
EntradaDispositivos de entradaProduciuse un erro de entrada/saídaMicrófono internoProduciuse un erro internoArgumento incorrectoMapa de canles «%s» incorrectoNome do cliente «%s» incorrectoEspecificación da latencia «%s» incorrectaObxectivo do rexistro incorrecto.O destino do rexistro non é correcto: use «syslog», «journal», «stderr», «auto» ou un nome válido de ficheiro «ficheiro:<path>», «novo_ficheiro:<path>».O destino do rexistro non é correcto: use mellor 'syslog', 'stdrr' ou 'auto' ou un nome de ficheiro apropiado: 'file:<path>', 'newfile:<path>'.Especificación de silenciado non válidaNúmero incorrecto das especificacións do volume.
Especificación de tempo de proceso «%s» incorrectaPropiedade «%s» incorrectaMétodo de nova mostraxe incorrecto «%s».Especificación de mostra incorrectaServidor incorrectoÍndice de entrada a destino incorrectoEspecificación incorrecta de índice de entrada a destinoÍndice de saída de orixe non válidoEspecificación de índice de saída de orixe non válidaNome do fluxo «%s» incorrectoEspecificación de suspensión incorrecta.Especificación incorrecta de volumeLiña de entradaLiña de saídaCarga unha vez: %s
MicrófonoNon se atopa a implementaciónMódemMódulo #%u
	Nome: %s
	Argumento: %s
	Contador de uso: %s
	Propiedades:
		%s
Produciuse un fallo na inicialización do móduloMonoMulticanleDúplex multicanleEntrada multicanleSaída multicanleNOMENOME DO NOME DE FICHEIRONOME SUMIDEIRO|#NNOME [ARGS ...]NOME [SUMIDEIRO]NOME|#NNOME|#N 1|0NOME|#N 1|0|alternarNOME|#N CLAVE=VALORNOME|#N PORTONOME|#N VOLUMENOME|#N VOLUME [VOLUME ...]NIVEL-NUMÉRICONome: %s
Sen amplificadorSen control automático de gananciaSen enfatizador baixoSen enfatizadorO daemon PulseAudio no está executándose, ou non se está executando como un daemon de sesión.Non hai chave de autenticaciónSen datosNon existe información dispoñíbel acerca do módulo
Non existe esa entidadeNon existe esa extensiónNon se especificou ningunha orde correcta.Non admitidoAínda non está implementado.
Saída nulaAceptarDe acordo, está executando P.A. en modo sistema. Asegúrese de saber o que fai antes de levar a cabo isto.
Lea http://www.freedesktop.org/wiki/Software/PulseAudio/Documentation/User/WhatIsWrongWithSystemWide/ para obter unha explicación de porque o modo sistema é normalmente unha mala idea.Funcionalidade obsoletaApagadoActivadoAbrindo un fluxo %s coa especificación da mostra «%s» e o mapa de canles «%s».Dispositivos de saídaNOME_DA_RUTARuta: %s
TeléfonoReproducir datos de son desde STDIN ou desde un ficheiro específico a un servidor de son de PulseAudio.Reproducir ficheiros de son codificados nun servidor de son de PulseAudio.O fluxo de reprodución foi drenado.Por favor, especifique un ficheiro de mostra para cargarPortátilFin prematuro de ficheiroProduciuse un erro de protocoloServidor de son PulseAudioSistema de son PulseAudioPerfil estándar RAOPRadioTraseira centralTraseira esquerdaMicrófono traseiroTraseira dereitaRecibiuse unha mensaxe para unha extensión descoñecida «%s»Precísanse privilexios de superusuario.Executándose en modo sistema, pero sen estabelecer --disallow-exit.Executándose en modo sistema, pero sen estabelecer --disallow-module-loading.Executándose en modo sistema, desactivando forzosamente o modo SHM.Executándose en modo sistema, desactivando forzosamente o tempo de saída por inactividade.Mostra #%u
	Nome: %s
	Especificación de exemplo: %s
	Mapa de canles: %s
	Volume: %s
	        balance %0.2f
	Duración: %0.1fs
	Tamaño: %s
	Ocioso: %s
	Nome de ficheiro: %s
	Propiedades:
		%s
Tamaño da caché de mostra: %s
Cadea do servidor: %s
Versión do protocolo da biblioteca: %u
Versión do protocolo do servidor: %u
É local: %s
Índice do cliente: %u
Tamaño do recadro: %zu
Servidor: %s
Lateral esquerdaLateral dereitaSink #%u
	Estado: %s
	Nome: %s
	Descrición: %s
	Controlador: %s
	Especifiación da mostra: %s
	Mapa da canle: %s
	Módulo propietario: %u
	Mute: %s
	Volume: %s
	        equilibrio%0.2f
	Volume base : %s
	Orixe do monitor: %s
	Latencia: %0.0f usec, confiugardo %0.0f usec
	Flags: %s%s%s%s%s%s%s
	Propiedades:
		%s
Entrada do sink #%u
	Controlador: %s
	Módulo de propietario: %s
	Cliente: %s
	Sink: %u
	Especificación de exemplo: %s
	Mapa de canles: %s
	Formato: %s
	Parado: %s
	Silencio: %s
	Volume: %s
	        balance %0.2f
	Latencia do búffer: %0.0f usec
	Latencia do sink: %0.0f usec
	Método de resampleado: %s
	Propiedades:
		%s
Destino: %s
Fonte #%u
	Estado: %s
	Nome: %s
	Descrición: %s
	Controlador: %s
	Especificación de exemplo: %s
	Mapa de canles: %s
	Módulo de propietario: %u
	Silencio: %s
	Volume: %s
	        balance %0.2f
	Volume base: %s
	Monitor de Sink: %s
	Latencia: %0.0f usec, configurado %0.0f usec
	Bandeiras: %s%s%s%s%s%s
	Propiedades:
		%s
Saída de fonte #%u
	Controlador: %s
	Módulo de propietario: %s
	Cliente: %s
	Fonte: %u
	Especificación de exemplo: %s
	Mapa de canles: %s
	Formato: %s
	Parado: %s
	Silencio: %s
	Volume: %s
	        balance %0.2f
	Latencia do búffer: %0.0f usec
	Latencia do sink: %0.0f usec
	Método de resampleado: %s
	Propiedades:
		%s
Orixe: %s
AltofalanteAltofalantesNon especifique nada, ou un de: %sIniciar o Sistema de son PulseAudioEstéreoDúplex estéreoCambiaron os atributos do búfer do fluxo.%sDispositivo de fluxo restabelecido.%sDispositivo de fluxo suspendido.%sProduciuse un erro de fluxo: %sFluxo trasladado ao dispositivo %s (%u, %ssuspended).%sFluxo saturado.%sFluxo iniciado.%sCreouse satisfactoriamente o fluxo.Fluxo esgotado.%sSubgravesEnvolvente 4.0Envolvente 4.1Envolvente 5.0Envolvente 5.1Envolvente 7.1O modo de sistema foi rexeitado por un usuario sen privilexios. Soamente iniciarase o servizo de busca do servidor D-Bus.O modo a todo do sistema non esta permitido nesta plataforma.DESTINOO mapa de canles predeterminado especificado ten un número de canles distinto ao especificado como predeterminado.Este programa non precisa ser executado como superusuario (a non ser que se especifique --system).Tempo: %0.3f seg; latencia: %0.0f useg.Tempo límiteDemasiado longoDemasiados argumentos.Arriba centroCentral superior frontalFrontal superior esquerdaFrontal superior dereitoTraseira superior centralTraseira superior esquerdaTraseira superior dereitaTentouse abrir os ficheiros de destino «%s», «%s.1», «%s.2» ... «%s.%d», mais todos fallaron.Túnel para %s@%sTúnel a %s/%sOrde descoñecidaModelo de dispositivo descoñecidoCódigo de erro descoñecidoFormato de ficheiro descoñecido %s.Utilización: %s
Nome de usuario: %s
Nome do equipo: %s
Nome do servidor: %s
Versión do servidor: %s
Especificación de mostra predeterminada: %s
Mapa de canles predeterminado: %s
Destino predeterminado: %s
Orixe predeterminada: %s
Cookie: %04x:%04x
Servidor configurado polo usuario %s sen start/autospawning.Servidor configurado polo usuario %s que aparece como local. Probando máis polo miúdo.Utilizando especificacións de mostra «%s», mapa de canles «%s».Versión: %s
VídeoDestino virtual LADSPASumideiro envolvente virtualVolume fóra do rango permitido.
AVISO: o proceso fillo foi rematado polo sinal %u
AVISO: o servidor de son non é local, non se suspende.
Aviso: produciuse un fallo ao determinar o mapa de canles desde o ficheiro.Aviso: produciuse un fallo ao tentar determinar a especificación da mostra desde o ficheiro.Aviso: recibidas máis solicitudes de continuación do fluxo que de paradas.Aviso: produciuse un fallo ao escribir o mapa de canles no ficheiro.Aviso: o exemplo de especificación indicado vai ser sobrescrito coas especificacións do ficheiro.XDG_RUNTIME_DIR (%s) non é propiedade nosa (uid %d), senón uid %d! (Isto podería suceder se, por exemplo, vostede tenta conectarse a un PulseAudio que non pertenza ao superusuario como superusuario mediante o protocolo nativo. Non o faga).Debe especificar un nome/índice de tarxeta e un nome de perfilDebe de especificar un nome ou un índice de tarxeta, un nome de porto e un desfase (offset) de latenciaDebe de especificar un índice ou un nome do móduloDebe especificar un nome de módulo e os argumentos.Debe especificar un nome de mostra para reproducirDebe especificar un nome de mostra para eliminarDebe especificar un índice de sumideiro e unha lista separada por puntos e comas dos formatos admitidosDebe especificar un índice de entrada sink e unha acción para silenciar (0, 1 ou 'toggle')Debe especificar un índice para a entrada ao destino e un destinoDebe especificar un índice de destino e un volumeTen que especificar un nome de destinoDebe especificar un nome/índice sink e unha acción para silenciar (0, 1 ou 'toggle')Debe especificar un nome/índice de destino e un nome de portoDebe especificar un nome/índice de destino e un volumeTen que especificar un nome para a fonteDebe especificar un nome/índice de saída da orixe e unha acción para silenciar (0, 1 ou 'toggle')Debe especificar un nome/índice de orixe e un nome de portoDebe especificar un nome/índice de orixe e un volumeDebe especificar un índice de saída da orixe e unha acción para silenciar (0, 1 ou 'toggle')Debe especificar un índice para a saída da orixe e unha orixeDebe especificar un índice de saída de orixe e un volumeNon é posíbel especificar máis dun destino. Ten que especificar un valor booleano.Non é posíbel especificar máis dunha orixe. Ten que especificar un valor booleano.[%s:%u] Mapa de canles incorrecto «%s».[%s:%u] Tamaño incorrecto de fragmento «%s».[%s:%u] Nivel do rexistro incorrecto «%s».[%s:%u] Destino do rexistro incorrecto «%s».[%s:%u] Nivel de amabilidade incorrecto «%s».[%s:%u] Cantidade incorrecta de fragmentos «%s».[%s:%u] Método de nova mostraxe incorrecto «%s».[%s:%u] Rlimit incorrecto «%s».[%s:%u] Canles de mostra incorrectas «%s».[%s:%u] Formato de mostra «%s» incorrecto.[%s:%u] Taxa de mostraxe incorrecta «%s».[%s:%u] Tipo de servidor incorrecto «%s».[TIPO][opcións]autoclean=<descarga automaticamente os filtros non usados?>bidireccionaltarxetacambiarclienteconnect(): %sdup2(): %sexecvp(): %s
Produciuse un fallo na bifurcación fork(): %sfork(): %sfork(): %s
entradanon válidaProduciuse un fallo en io_new().módulon/dnovononsen open(): %ssaídaProduciuse un fallo en pa_context_connect(): %sProduciuse un fallo en pa_context_new().Produciuse un fallo en pa_context_new().
Produciuse un fallo en pa_context_rttime_new().Produciuse un fallo en pa_core_new().Produciuse un fallo en pa_mainloop_new().Produciuse un fallo en pa_mainloop_new().
Produciuse un fallo en pa_mainloop_run().Produciuse un fallo en pa_mainloop_run().
Produciuse un fallo no pa_pid_file_create().Produciuse un fallo en pa_stream_begin_write(): %sProduciuse un fallo en pa_stream_connect_playback(): %sProduciuse un fallo en pa_stream_connect_record(): %spa_stream_drain(): %sProduciuse un fallo en pa_stream_get_buffer_attr(): %sProduciuse un fallo en pa_stream_new(): %sProduciuse un fallo en pa_stream_peek(): %sProduciuse un fallo en pa_stream_update_timing_info(): %sProduciuse un fallo en pa_stream_write(): %spacat %s
Compilado con libpulse %s
Vinculado con libpulse %s
pacmd %s
Compilado con libpulse %s
Ligado con libpulse %s
pactl %s
Compilado con libpulse %s
Vinculado con libpulse %s
pasuspender %s
Compilado con libpulse %s
Vinculado con libpulse %s
Produciuse un fallo na canalización pipe(): %sreproducirpoll(): %sProduciuse un fallo na lectura read(): %sread(): %sgravandoretirarcaché-mostraxeservidorProduciuse un fallo na sesión setsid(): %sdestinoentrada-destinosink_name=<nome para o destino> sink_properties=<propiedades para o destino> master=<nome do destino a filtrar> sink_master=<nome do destino a filtrar>format=<formato de mostra> rate=<taxa de mostra> channels=<número de canles> channel_map=<asignación de canles> use_volume_sharing=<si ou non> force_flat_volume=<si ou non> hrir=/ruta/ao/left_hrir.wav autoloaded=<estabelecer se este módulo se vai cargar automaticamente> sink_name=<nome para o destino> sink_properties=<propiedades para o destino> sink_input_properties=<propiedada da entrada para o destino>master=<nome do destino a filtrar> sink_master=<nome do destino a filtrar>format=<formato de mostra> rate=<taxa de mostra> channels=<número de canles> channel_map=<asignación de canles> plugin=<nome do engadido ladspa> label=<etiqueta do engadido ladspa> control=<lista separada por vírgula de valores de control de entrada> input_ladspaport_map=<lista separada por comas dos nomes de portos LADSPA de entrada> output_ladspaport_map=<lista separada por comas dos nomes dos portos LADSPA de saída> autoloaded=<estabelecer se este módulo se carga automaticamente> sink_name=<nome para o destino> sink_properties=<propiedades para o destino> sink_master=<sumideiro ao que conectarse> format=<formato de mostra> rate=<taxa de mostra> channels=<cantidade de canles> channel_map=<asignación de canles> autoloaded=<estabelézao se este módulo se carga automaticamente> use_volume_sharing=<si ou non> snd_pcm_avail() devolveu un valor que é excepcionalmente grande: %lu bytes (%lu ms).
O máis probábel é que sexa un erro do controlador ALSA «%s». Informe disto aos desenvolvedores de ALSA.snd_pcm_avail() devolveu un valor que é excepcionalmente grande: %lu bytes (%lu ms).
O máis probábel é que sexa un erro do controlador ALSA «%s». Informe disto aos desenvolvedores de ALSA.snd_pcm_avail_delay() devolveu valores estraños: o atraso de %lu é menor que o dispoñíbel %lu.
O máis probábel é que sexa un erro do controlador ALSA «%s». Informe disto aos desenvolvedores de ALSA.snd_pcm_delay() devolveu un valor que é excepcionalmente grande: %li bytes (%s%lu ms).
O máis probábel é que sexa un erro do controlador ALSA «%s». Informe disto aos desenvolvedores de ALSA.snd_pcm_delay() devolveu un valor que é excepcionalmente grande: %li bytes (%s%lu ms).
O máis probábel é que sexa un erro do controlador ALSA «%s». Informe disto aos desenvolvedores de ALSA.snd_pcm_mmap_begin() devolveu un valor que é excepcionalmente grande: %lu bytes (%lu ms).
O máis probábel é que sexa un erro do controlador ALSA «%s». Informe disto aos desenvolvedores de ALSA.snd_pcm_mmap_begin() devolveu un valor que é excepcionalmente grande: %lu bytes (%lu ms).
O máis probábel é que sexa un erro do controlador ALSA «%s». Informe disto aos desenvolvedores de ALSA.socket(PF_UNIX, SOCK_STREAM, 0): %sorixesaída-orixesource_name=<nome da orixe> source_properties=<propiedades da orixe> source_master=<nome da orixe a filtrar> sink_name=<nome do sumideiro> sink_properties=<propiedades para o sumideiro> sink_master=<nome do sumideiro a filtrar> adjust_time=<cada canto reaxustar as taxas en s> adjust_threshold=<canta derixa reaxustar despis en ms> format=<formato da mostra> rate=<taxa de mostraxe> channels=<número das canles> channel_map=<mapa de canles> aec_method=<implementación a usar> aec_args=<parámetros do motor AEC> save_aec=<gardar os datos AEC en /tmp> autoloaded=<estabeleza se este módulo se carga automaticamente> use_volume_sharing=<si ou non> use_master_format=<si ou non> descoñecidowaitpid(): %sProduciuse un fallo en write(): %swrite(): %sxcb_connect() falloudevolveu como true xcb_connection_has_error()siPK�m�\���eBBLC_MESSAGES/newt.monu�[�����Dl�������*37?CancelNoOkYesProject-Id-Version: newt
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2016-03-23 15:59+0100
PO-Revision-Date: 2004-11-20 11:21-0500
Last-Translator: Jacobo Tarrio <jtarrio@trasno.net>
Language-Team: Galician <trasno@ceu.fi.udc.es>
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Language: gl
Plural-Forms: nplurals=2; plural=(n != 1)
X-Generator: Zanata 3.8.2
CancelarNonAceptarSiPK�m�\���>�>LC_MESSAGES/xkeyboard-config.monu�[�����x�#��G�_�_q�__`!p`�`�`�`�`�`aa$a1aQa-Ua�a-�a$�a�ab
b	-b7bIb%Ub${b%�b�b�b�b�b�bCc"Echc)�c&�c�c
�c�c	d	
dd)d1d9dAdYd_dvd�dF�d�d�d�d
e$e5eIe\e
me{e�e�e�e�e�eW�eYAf�f�f�f�f�fgg4(g]gigxg�g�g�g�g�g�g�g�g	�g	hh	h
(h	3h+=h	ihTsh�h�h�h"�h	i#i;iSiqi
�i
�i�i�i�i�i�i�ijj"7jZjqj�j�j�j�j�j(�jk,9k#fk#�k�k�k#�k"�kl8lRldlwl$�l?�l%�lm$mCm%Ymm�m	�m�m �m�m�mn!n@n_n un �n	�nJ�n>oEKo�o�o�o�o9�o.p@Np@�pG�pTq"mq�q�q�q�q�q�qr0rNr_rorr�r
�r�r�r�r�r
�r�r�rss9sSsls�s�s�s�s�stt%#t$It!nt�t+�t-�t
uu
&u1u7u"Fuiu"~u�u�u�u�uv	vv ,vMvcvuv�v�v�v�v�v�vw"w/w<wPwgwow�w�w�w�w�w�w�w*�w#"xFx[xnxx$�xA�x;�x.4y(cy�y�y�y'�y�yz1zAzYzwz�z�z�z�z�z{{&{<{)Q{{{�{%�{�{#�{|$|C|^|w|3�|@�|#}(}(:}c}%|}�}4�}�}~	~~8~3U~�~�~�~$�~�~.�~	(	2	<	FP`diq�$�!�(�%�'�D�^�z�����
��ŀـ���4�'C�k���%��Á��$��2�O�_�q�����)��ۂ����"�3�I�^�"~�"��(ă
��� �=0�
n�|���!��ք#�)�:�P�l�}���������Ѕ���&�9�T�e�w� ������†׆ކ��	�%�$D�
i�w������� Ƈ���
��.�D�Y�"y���"��(܈� �2�F�`�t�0����׉����� �5�G�V�_�	h�r�
����
����ɊЊ���'�@�&`�����"ċ��'�G�g���������
Ќی�	��&	�)0�$Z�'�&��)΍$��'�&E�)l�$��'��&�)
�$4�'Y�������ُ����.� K�	l�v�������֐�����	!�+�1�7�M�U�g�{�"����Ǒ�
����'�:�J�_�t���%��&����	�"�*�	D�N�U�d�v�!����Ɠ������ �@�V�o�������Ҕ���5�H�e�~�����ʕҕٕ�#���'�>�(S�|���"��Җ����'�)F�-p�����ǗЗ8�!"�D�	X�b�4t�����Dј
�!�*�eC�7�������
"�-�J�\�o�.��(������� *�K� k�#��!��(қ ��+�%H�n�������'Ü���� �%?�)e�
������ȝ
��		�
�4!�&V� }�"��%��%�"
�&0�W�u�	����)��ԟܟ����&�+�:�S�b�)g�������ՠ� �&�8� P�q�&��"��)ա��"�#<�`�	g�q�	����&����*آ#�'�C�$`�#��������ͣ٣�#��#�=A�M�#ͤM�^?�����%ϥ��
�	#�-�A�T�#j�������զSަ2�1Q�������
����
����!�����
��"�2�G�N�i�o� w�������Ψ,ި4�@�_�r�������ǩ
���(�,F�s�!��!��Ӫ$�*�$:�_�s�����ǫ߫����.�	D�N�fh�!Ϭ%�
�"�=�U�l�	x���f���� �@�X�l������
ήٮ�
��	��7�"V�!y���!��"ѯ#��/�(J�s� ������ϰ��! �B�W�t�+����
ұ����1�F�
R�`�y�"��&��˲���� ,�M�0^���$��ȳ9��*�3�J�S�s�"z�������#Ǵ��	�&'�N�j�r���,��!ɵ �$�&1�,X�������öض�7�D�d�z�������ѷ���*�A�W�n�~�������ݸ���3�;�O�`�t���"��"������-�E�L�	^�h��������-ź(��"1�$T�y���������ûȻڻ���,�+A�+m�����ż;ټd�z���������ýӽ߽��(�E�M�]�v���.��*߾
��	,�6�O�d�{�������-ԿN�Q�`�p���������+�+��)�B�I�O�c�
}�
����,���(��B0�cs�(��	�
��"�2�8�&?�Kf�e��u�o��J��oI�J����
�����!�%�)�,�/�3�6�9�<�@�C�F�I�M�P�T�W�Z�]�d�h�k�n��������������������������������������������������������������������������������������� �#�&�)�,�/�2�5�<�?�B�E�H�K�N�Q�T�W�[�_�b�f�i�l�o�r�u�x�{��������������������������������������2����n	�nx� ���!�<�V�i�����������9��"�17�0i���%��
��	�����2�)J�,t�����������P��1,� ^�A�9�����&�
/�
:�"E�h�q���)����������O�^�n�u�����������
����
��0�?�Q�`j�a��-�5�N�f������=�����#�8�?�G�
P�^� v�����	������	��
��	��+�� �]0�������$�������%�E�X�
d�o������������� ��,�>�X�u�������&��+���0.�&_�&������%��.��&� F�g���!��B��R�>^���$����%����	"�,� F�g�o� ~� �� ����#��#�A�kX�K��L�]�#s� ����`��B7�Gz�L��J�\Z�)���������6�M�d�������������
����
��%�
2�=�T�l������������� 7�X�u���%��.���� �E/�8u�����������)�+�#@�*d�������������%���5�M�(h�����!���������&�3�G�_�g�
y������� ������'�+/�[�q�����)��P��J&�8q�2�������0�P�o�������"����!
�,�K�]�n�������)������*�E�-d���!��������9�FW�1����1���/.�^�>~�����	����
�8*�	c�m���/����4��	�	&�	0�	:�D�T�X�]�f���$��"��(��&��#�@�[�w��������������(*�S�0e�����4��"
�-�6�*H�7s����������+�H�Z�l�������������$�'>�f�v�'��F����#�"9�)\���2��5���,�L�^�~������������&
�1�L�]�	o�"y������������$+�'P�x�#����
���&���*�?�P�g�x�����#�&��$%�J�a�~���2������'�<�N�h�|�����	����
���
���� �'�?�L�_�x�&�����"���?�_���������
	��(�	<�(F�,o�)��-�(�(�)F�-p�(��,�)�-�(L�,u�)��-���)'>fw��� �
�-L j�� �	��
���� /8h*������-BS&i'���"�#+3DX+k"�"����%AXt�����5Fbz������+�
$/E0Z�&�*��
<'M3u7��!�	$	ED	-�	�	
�	�	P�	N
&n
g�
�

#o>c�+BZb|��/�&�	

'
7
 Q
r
 �
#�
!�
(�
 "+C%o����'�"7G%f)�����			1;ML+�'�(�3*K'v&���	�.I(Qz�������0�-7&e����� &&@"g)��"�!�"3:'Go*�$���&$=bnz���&�'�=WB%�i��*��,�-
CNcw)����
w4�H� -6F!Ln�������	(BI[,k6�$��(-Vg���(�4�!!=&_�)�)�,�3M!l������ # v@ +� 7� !$(!M!k!�!�!'�!s�!D"M"&a"�"�"�")�"�"#
)#4#9#
Q#\#k#�#!�#�#�# �# $!8$Z$n$*�$�$�$�$�$
%#%<%#W%{%%�%"�%.�%&
#&1&D&V&h&�&
�&
�&�&�&'�&$'''F'V'n' �'�'1�'�'7�'7(;Q(�(	�(�(�( �(�(0�($):)C),U)�)$�)�)/�)"�)	*%*7*.R*#�*"�*%�*-�*0+M+b+z+�+�+�+>�+.,"N,q,�,�,�,�,�,�,--9-O-f-v-�-�-%�-&�-/.E.].c.u.�.�.�.(�.-�./-/D/c/|/�/	�/�/�/�/�/ �/30*40_0(u0*�0�0�0�0�011 191T1]13{12�12�12-2A2FU2t�23%343K3R3
X3	f3p3�3'�3�3
�3�3�3454.R4*�4�4�4�4�4�45%585M5g55�5f�5$636F6`6x6�6�6=�6>�657U7[7b7w7�7
�7�7,�7�72878TQ8��8B,9o9�9�9�9�9�99�9]�9qN:��:�K;E�;�%<m�<>=A=D=H=M=S=X=[=_=c=f=i=m=p=s=v=z=}=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=�=>>>	>>>>>>>>&>)>,>/>2>5>8>;>>>B>E>H>K>N>Q>T>W>Z>]>`>c>f>i>l>o>r>y>|>>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�> z�C�B�\
8�$�K��eD�#e����o3��>C�,B��L3�d�	��g�W$��:f��.x/�tF�1����$����|��V��DkL�JMV6	��F��[K:m�
^w��C�ju't�;<��$b�)��?�"�?���#9���i��M��!�j��#;�)���=I����Zc,'/-1�+�.�I�45�U,V�2"�2cR�9g`��d�7�IZ�
S!N+�*�&���� g`����)�[�����'���`�y]���)�s�eQ�-��E��+���}\Uv�^49���i�IWbM��?�}_���(Hb`��#~���~kO3|�n4^GApX��5�	�;���d�(�����W��t�Z
o�S[q!���r�.�����s
��x%Mg�_������v9�Nl'02��+����l
�X����=:��<%�@�,�jF(��+��R���p c��A�U0hYZ��S��ml�v�8^�J(�a;IJ��M����LFa�fDt>�L�1����Q��\7y�m�J��8'�5���sR���*�%�&LoG������}����0<f���kz���D���u�HK��7���^y�q������rJ-�i��:��E�p*����aHe|R�qqj�Y�P3c@]������6��X�_�|�r�"��w8�����T� BH�G��zA�/�wX��v4�Yn��%��.E��p���G���<{���{`0�
o�f��������C.]�r�k2�"$[��w�j����1O��!whHeE���*NyQ"c�x#�����Ei����h��n}��fh��O�/�� ����hk��_25�PQ����a���)�K4F��;�@v��lb�m�b�>zN���u�66��i>��-W@����7���5�Y%
��	�����nSsP�[������_S�rR]7�������togZ!{?dxB�u��=�D��TBU�=-�>����l�6����:T�m~���K\�(X������Op�q��@����,n0{=xsT�&T�8��P�\3��d��A�����V������N���9�<W1��U&
/V�G�]P�CQ���a�~*O���Y?�u&��
A������	&lt;Less/Greater&gt;&lt;Less/Greater&gt; chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser&lt;Less/Greater&gt;; acts as onetime lock when pressed together with another 3rd level chooser3rd level of &lt;Less/Greater&gt;3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (with &lt;\|&gt; key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)EurKEY (US based layout with European letters)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Finnish DvorakFour-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (US, AZERTY)French (US, with French letters)French (US, with French letters, with dead keys, alternative)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianInternational Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Numeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+&lt;key&gt;) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French, with Vietnamese letters)Vietnamese (QĐERTY)Vietnamese (US, with Vietnamese letters)ViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.26.99
Report-Msgid-Bugs-To: svu@users.sourceforge.net
POT-Creation-Date: 2019-10-19 21:52+0100
PO-Revision-Date: 2019-06-06 06:14+0200
Last-Translator: Marcos Lans <marcoslansgarza@gmail.com>
Language-Team: Galician <proxecto@trasno.gal>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Poedit 1.8.7.1
X-Launchpad-Export-Date: 2014-04-23 20:24+0000
&lt;Menor que/Maior que&gt;&lt;Menor que/Maior que&gt; actúa como un bloqueo dunha vez ao premerse xunto con outro selector de 5º nivel&lt;Menor que/Maior que&gt; actúa como un bloqueo dunha vez ao premerse xunto con outro selector de 3º nivel3º nivel do &lt;Menor/Maior&gt;3º nivel do Bloq Maiús3º nivel da Ctrl esquerda3º nivel da Win esquerda3º nivel do menú3º nivel da Ctrl dereita3º nivel da Win dereitaA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSímbolos de teclado APL: APLX Unificado Disposición APLSímbolos de teclado APL: IBM APL2Símbolos de teclado APL: Manugistics APL*PLUS IISímbolos de teclado APL: disposición unificadaSímbolos de teclado APL: saxCaixeiro automático/estilo teléfonoAcer AirKey VAcer C300Acer Ferrari 4000Portátil AcerEngadir o comportamiento estándar á tecla Menú.Engadir as letras acentuadas do esperantoEngadir o símbolo de divisa a certas teclasAdvance Scorpius KIAfganoAkanAlbanésAlbanés (Plisi)Permitir que accións do teclado liberen as capturas (aviso: risco de seguranza)Permitir captura e rexistro da árbore de xanelasAlt e Meta están nas teclas AltAlt está asignada á tecla Windows dereita e Super a tecla MenúAlt asígnase ás teclas Windows (e as teclas Alt usuais)Alt está cambiada con WinAlt+Bloq MaiúsAlt+CtrlAlt+MaiúsAlt+EspazoComportamento da tecla Alt/WindowsAmharicoCalquera tecla AltCalquera tecla WindowsCalquera tecla Windows (mentres se preme)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emula as teclas do PC  (ImpPant, Bloq Desp , Pausa, Bloq Núm)Portátil AppleÁrabeÁrabe (AZERTY)Árabe (AZERTY/díxitos)Árabe (ALxeria)Árabe (Buckwalter)Árabe (Macintosh)Árabe (Marrocos)Árabe (OLPC)Árabe (Paquistán)Árabe (QWERTY)Árabe (Sun Type 6/7)Árabe (Siria)Árabe (díxitos)Árabe (qwerty/díxitos)Árabe (con extensións para outras linguas escritas en árabe e os díxitos árabes preferidos)Árabe (con extensións para outras linguas escritas en árabe e os díxitos europeos preferidos)ArmenioArmenio (OLPC fonético)Armenio (alt. oriental)Armenio (alt. fonético)Armenio (oriental)Armenio (fonético)Armenio (occidental)Asturiano (español, con H de medio punto e L de medio punto)Portátil AsusNa parte inferior esquerdaÁ esquerda do «A»AtsinaAvatimeAvestánAzerbaixaníAzerbaxaní (cirílico)Internet sen fíos Azona RF2300 BTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarra invertidaBarra invertida; actúa como bloqueo dunha vez cando se preme con outro selector de 3º nivelBambaraBengalíBengalí (India)Bengalí (India, Inscript Baishakhi)Bengalí (India, Baishakhi)Bengalí (India, Bornona)Bengalí (India, Probhat)Bengalí (India, Uni Gitanjali)Bengalí (Probhat)BashkirianoBielorrusoBielorruso (Latín)Bielorruso (herdado)BelgaBelga (Sun Type 6/7)Belga (Wang 724 AZERTY)Belga (alt. ISO)Belga (alternativa)Belga (alternativa, só latin-9)Belga (alternativa con teclas mortas de Sun)Belga (sen teclas mortas)Belga (teclas mortas de Sun)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Bérber (Alxeria, Latín)Bérber (Alxeria, caracteres tifinagh)Bérber (Marrocos, tifinagh alt. fonético)Bérber (Marrocos, Tifinagh)Bereber (Marrocos, tifinagh fonético estendido)Bereber (Marrocos, tifinagh estendido)Bereber (Marrocos, tifinagh fonético)Bereber (Marrocos, Tifinagh)BosnioBosnio (EE.UU. con dígrafos bosnios)Bosnio (teclado de EE. UU. con letras bosnias)Bosnio (usar dígrafos bosnios)Bosnio (con comiñas para citas)Ambas as teclas «Alt» xuntasAmbas as teclas «Ctrl» xuntasAmbas as teclas «Maiús» xuntasAmbas as teclas «Maiús» xuntas activan o Bloqueo de maiúsculasAmbas as teclas Maiús xuntas activan o Bloq Maiús, unha tecla Maiús desactívaoAmbas as teclas Maiús xuntas activan o bloqueo de maiúsculasBrailleBraille (zurdo con polgar invertido)Braille (zurdo)Braille (destro con polgar invertido)Braille (destro)Brother InternetBúlgaroBúlgaro (fonética nova)Búlgaro (fonética tradicional)BurmeseBurmese ZawgyiCamerunés multilingüe (qwerty)Camerunés multilingüe (azerty)Camerunés multilingüe (QWERTY)Canadiense multilingüeCanadiense multilingüe (1ª parte)Canadiense multilingüe (2ª parte)Bloqueo de maiúsculasBloqueo de maiúsculas  (ao pulsarse), Alt+Bloq Maiús realiza a acción orixinal de bloqueo de maiúsculasBloq Maiús actúa como Maiús con bloqueo; Maiús «suspende» Bloq MaiúsBloq Maiús actúa como Maiús con bloqueo; Maiús non afecta ao Bloq MaiúsBloq Maiús como CtrlComportamento da tecla Bloq. MaiúsBloq. Maiús é tamén como CtrlBloq Maiús está desactivadoBloqueo de maiúsculas (á primeira disposición), Maiús+Bloq. Maiús (á última disposición)Bloq Maiús cambia a Maiús con bloqueo (afecta a todas as teclas)Bloq Maiús cambia a capitalización normal dos caracteres alfabéticosBloq Maiús usa a capitalización interna; Maiús «suspende» o Bloq MaiúsBloq Maiús usa a capitalización interna; Maiús non afecta a Bloq MaiúsBloq. Maiús actúa como un bloqueo dunha vez cando se preme con outro selector de 3º nivelCatalán (español, con L de medio punto)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChinésChromebookIdioma da Igrexa eslavonaChuvashCuvash (Latín)Classmate PCCloGaelachCoeur d’Alene salishPortátil Compaq ArmadaCompaq Easy AccessCompaq Internet (13 teclas)Compaq Internet (18 teclas)Compaq Internet (7 teclas)Portátil Compaq PresarioCompaq iPaq Creative Desktop Wireless 7000Tártaro de Crimea (Dobruca Q)Tártaro de Crimea (turco Alt-Q)Tártaro de Crimea (turco F)Tártaro de Crimea (turco Q)CroataCroata (EE.UU. con dígrafos croatas)Croata (teclado de EE. UU. con letras croatas)Croata (usar dígrafos croatas)Croata (con comiñas para citas)Ctrl está asignada ás teclas Alt, Alt está asignado ás teclas WinCtrl asígnase ás teclas Win (e ás teclas Ctrl usuais)Posición da tecla CtrlControl + Alt + RetrocesoCtrl+MaiúsChecoCheco (QWERTY)Checo (QWERTY, Barra invertida estendida)Checo (Sun Type 6/7)Checo (UCW, só letras con acentos)Checo (EE.UU, Dvorak, compatibilidade UCW)Checo (con tecla «\|»)Checo Eslovaco e Alemán (US)DTK2000DanésDanés (Dvorak)Danés (Macintosh)Danés (Macintosh, sen teclas mortas)Danés (Sun Type 6/7)Danés (teclas Windows)Danés (sen teclas mortas)Teclas do teclado numérico por omisiónDellDell PC 101 teclasPortátil Dell Inspiron 6000/8000Portátil Dell LatitudeTeclado Dell Precision MPortátil Dell Precision M65Dell SK-8125Dell SK-8135Dell USB MultimediaDexxa sen fíos DesktopDhivehiDiamond 9801/9802HolandésHolandés (Macintosh)Holandés (Sun Type 6/7)Holandés (estándar)Holandés (teclas mortas de Sun)Dyalog APL completoDzongkhaElfdalian (sueco, con ogonek combinado)Activar caracteres tipográficos adicionaisInglés (australiano)Inglés (Camerún)Inglés (Canadá)Inglés (Carpalx)Inglés (Carpalx, optimización completa)Inglés (Carpalx, optimización completa, internacional con teclas mortas AltGr)Inglés (Carpalx, optimización completa, internacional con teclas mortas)Inglés (Carpalx, internacional con teclas mortas AltGr)Inglés (Carpalx, internacional con teclas mortas)Inglés (Colemark)Inglés (Dvorak)Inglés (Dvorak, alt. intl.)Inglés (Dvorak internacional con teclas mortas)Inglés (Dvorak, man esquerda)Inglés (Dvorak, man dereita)Inglés (Ghana)Inglés (Ghana, GILLBT)Inglés (Ghana, multilingüe)Inglés (India, co signo da rupia)Inglés (Macintosh)Inglés (Mali, EE.UU., Macintosh)Inglés (Mali, EE. UU., intl.)Inglés (Nixeria)Inglés (Norman)Inglés (Sudáfrica)Inglés (RU)Inglés (RU, Colemark)Inglés (RU, Dvorak)Inglés (UK, Dvorak, puntuación para UK)Inglés (RU, Macintosh)Inglés (R.U, Sun Type 6/7)Inglés (UK, estendido con teclas Windows)Inglés (UK, intl., Macintosh)Inglés (RU, internacional con teclas mortas)Inglés (EE. UU.)Inglés (EE.UU, IBM árabe 238_L)Inglés (USA, Sun Type 6/7)Inglés (EE.UU, Macintosh)Inglés (EE. UU. con euro no 5)Inglés (EE. UU., internacional combinando AltGr Unicode)Inglés (EE. UU., internacional combinando AltGr Unicode, alternativa)Inglés (EE. UU. internacional con teclas mortas)Inglés (Workman)Inglés (Workman internacional con teclas mortas)Inglés (Dvorak clásico)Inglés (internacional con teclas mortas AltGr)Inglés (Dvorak de programador)Inglés (as teclas dividir/multiplicar cambian a disposición)Ennyah DKB-1008Intro no teclado numéricoEsperantoEsperanto (Brasil, nativo)Esperanto (Portugal, Nativo)Estoniano (punto e coma e comiña desprazadas, obsoleto)EstonianoEstoniano (Dvorak)Estoniano (Sun Type 6/7)Estonio (teclado EE. UU. con letras estonianas)Estoniano (sen teclas mortas)EurKEY (disposición tipo EE.UU con letras europeas)Euro no 2Euro no 4Euro no 5Euro no EEverex STEPnoteEweFL90FaroésFaroés (sen teclas mortas)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latín)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latín)Filipino (Colemak, Baybayin)Filipino (Colemak, Latín)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latín)Filipino (QWERTY, Baybayin)FinlandésFinlandés (DAS)Finlandés (Macintosh)Finés (Sun Type 6/7)Finlandés (teclas Windows)Finlandés (clásico)Finlandés (clásico, sen teclas mortas)Dvorak finlandésTecla de cuarto nivel con separadores abstractosTecla de cuarto nivel con comaTecla de cuarto nivel con puntoTecla de cuarto nivel con punto, restrición latin-9Tecla de cuarto nivel con momayyezFrancésFrancés (AZERTY)Francés (bepo, ergonómico, forma Dvorak)Francés (bepo, ergonómico, forma Dvorak, só latin-9)Francés (bretón)Francés (Camerún)Francés (Canadá)Francés (Canadá, Dvorak)Francés (Canadá, herdado)Francés (República Democrática do Congo)Francés (Dvorak)Francés (Guinea)Francés (Macintosh)Francés (Mali, alternativa)Francés (Marrocos)Francés (Sun Type 6/7)Francés (Suíza)Francés (Suíza, Macintosh)Francés (Suíza, Sun Type 6/7)Francés (Suíza, sen teclas mortas)Francés (Suíza, teclas mortas de Sun)Francés (Togo)Francés (EE.UU, AZERTY)Francés (EE.UU., con letras francesas)Francés (EE.UU., con letras francesas, con teclas mortas alternativo)Francés (alternativa)Francés (alternativa, só latin-9)Francés (alt., sen teclas mortas)Francés (alt., con teclas mortas de Sun)Francés (herdado, alternativa)Francés (herdado, alternativa, sen teclas mortas)Francés (herdado, alternativa, teclas mortas de Sun)Francés (sen teclas mortas)Francés (teclas mortas de Sun)Friulano (Italia)Portátil Fujitsu-Siemens AmiloFulaGaPC xenérico 101 teclasPC xenérico 102 teclas (intl.)PC xenérico 104 teclasPC xenérico 105 teclas (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSXeorxianoGeorgiano (Francia, AZERTY tskapo)Georgiano (Italia)Georgiano (MESS)Georgiano (ergonómico)AlemánAlemán (Aus der Neo-Welt)Alemán (Austria)Alemán (Austria, Macintosh)Alemán (Austria, sen teclas mortas)Alemán (Austria, teclas mortas de Sun)Alemán (Bone)Alemán (Bone, teclas base eszett )Alemán (Dvorak)Alemán (KOY)Alemán (Macintosh)Alemán (Macintosh, sen teclas mortas)Alemán (Neo 2)Alemán (Neo qwerty)Alemán (Neo qwertz)Alemán (QWERTY)Alemán (Sun Type 6/7)Alemán (Suíza)Alemán (Suíza, Macintosh)Alemán (Suíza, Sun Type 6/7)Alemán (Suíza, herdado)Alemán (Suíza, sen teclas mortas)Alemán (Suíza, teclas mortas de Sun)Alemán (T3)Alemán (EE.UU., con letras alemás)Alemán (acento morto)Alemán (acento grave morto)Alemán (tilde morta)Alemán (sen teclas mortas)Alemán (con letras húngaras e sen teclas mortas)Alemán (teclas mortas de Sun)Ladino alemánGregoGrego (Colemak)Grego (Sun Type 6/7)Grego (estendido)Grego (sen teclas mortas)Grego (politónico)Grego (simple)GuxaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking para MacHausa (Ghana)Hausa (Nixeria)HebreoHebreo (bíblico, SIL fonético)Hebreo (bíblico, tiro)Hebreo (lyx)Hebreo (fonético)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (bolnagri)Hindi (KaGaPa fonético)Hindi (Wx)Honeywell EuroboardTeléfono Htc DreamHúngaroHúngaro (101/QWERTZ/coma/teclas mortas)Húngaro (101/QWERTY/coma/sen teclas mortas)Húngaro (101/QWERTZ/punto/teclas mortas)Húngaro (101/QWERTY/punto/sen teclas mortas)Húngaro (101/QWERTZ/coma/teclas mortas)Húngaro (101/QWERTZ/coma/teclas mortas)Húngaro (101/QWERTZ/punto/teclas mortas)Húngaro (101/QWERTZ/punto/sen teclas mortas)Húngaro (102/QWERTZ/coma/teclas mortas)Húngaro (102/QWERTY/coma/sen teclas mortas)Húngaro (102/QWERTZ/punto/teclas mortas)Húngaro (102/QWERTY/punto/sen teclas mortas)Húngaro (102/QWERTZ/coma/teclas mortas)Húngaro (102/QWERTZ/coma/sen teclas mortas)Húngaro (102/QWERTZ/punto/teclas mortas)Húngaro (102/QWERTZ/punto/sen teclas mortas)Húngaro (QWERTY)Húngaro (sen teclas mortas)Húngaro (estándar)Hyper está asignada ás teclas WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandésIslandés (Dvorak)Islandés (Macintosh)Islandés (Macintosh, herdado)Islandés (sen teclas mortas)Islandés (teclas mortas de Sun)IgboIndioAlfabeto fonético internacionalInuktitutIraquíIrlandésIrlandés (UnicodeExperto)ItalianoItaliano (IBM 142)Italiano (Macintosh)Italiano (Sun Type 6/7)Italiano (teclado EE. UU. con letras italianas)Italiano (teclas Windows)Italiano (internacional con teclas mortas)Italiano (sen teclas mortas)Ladino italianoXaponésXaponés (Dvorak)Xaponés (Kana 86)Xaponés (Kana)Xaponés (Macintosh)Xaponés (OADG 109A)Xaponés (PC-98)Xaponés (Sun Type 6)Xaponés (Sun Type 7 - pc compatíbel)Xaponés (Sun Type 7 - sun compatíbel)Opcións de teclado xaponésCalmucoA tecla Bloq Kana está bloqueandoKannadaKannada (KaGaPa fonético)CasubioKazakhoKazakho (Latín)Kazakho (estendido)Kazakho (con ruso)Secuencia de teclas para matar o servidor XTecla para seleccionar o 5º nivelTecla para seleccionar o 3º nivelKeytronic FlexProKhmer (Camboia)KikuyuKinesisKomiCoreanoCoreano (101/104 teclas compatíbeis)Coreano (Sun Type 6/7)Coreano teclas Hangul/HaniaKurdo (Irán, arábigolatino)Kurdo (Irán, F)Kurdo (Irán, Latín Alt-Q)Kurdo (Irán Latín Q)Kurdo (Irak, arábigolatino)Kurdo (Irak, F)Kurdo (Irak, Latín Alt-Q)Kurdo (Irak, Latín Q)Kurdo (Siria, F)Kurdo (Siria, Latín Alt-Q)Kurdo (Siria, Latín Q)Kurdo (Turquía, F)Kurdo (Turquía, Latín Alt-Q)Kurdo (Turquía, Latín Q)KutenaiKirguíKirguí (fonético)LaoLao (distribución proposta STEA estándar)LetónLetón (F)Letón (Sun Type 6/7)Letón (Colemark RU)Letón (Colemark de RU, variante con apóstrofo)Letón (Dvorak de EE. UU.)Letón (Dvorak de EE. UU., variante Y)Letón (Dvorak de EE. UU., variante menos)Letón (adaptado)Letón (apóstrofo)Letón (ergonómico, ŪGJRMV)Letón (moderno)Letón (programador, Dvorak de EE. UU.)Letón (programador, Dvorak de EE. UU., variante Y)Letón (programador, Dvorak de EE. UU., variante menos)Letón (tilde)Disposición do teclado numéricoAlt esquerdaAlt esquerda (mentres está premida)Alt esquerda como Ctrl, Ctrl esquerda comp Win, Win esquerdp como AltAlt  esquerda está cambiada coa Win esquerdaAlt esquerda + Maiús esquerdaCtrl esquerdaCtrl esquerdo como MetaCtrl esquerda (á primeira disposición), Ctrl dereita (á última disposición)Ctrl esquerda + Maiús esquerdaCtrl esquerda + tecla Windows esquerdaCtrl esquerda + Ctrl dereito (á primeira disposición), Ctrl dereita + Menú (á segunda disposición)Maiús esquerdaWin esquerdaTecla Windows esquerda (ao premela)Win esquerda elixe o 5º nivel, actúa como bloqueo dunha vez ao premerse xunto con outro selector de 5º nivelTecla Windows esquerda (á primeira disposición), Windows /Menú dereita (á última disposición)HerdadoWang 724 herdadoTecla herdada con comaTecla herdada con puntoLituanoLituano (IBM LST 1205-92)Lituano (LEKP)Lituano (LEKPa)Lituano (Sun Type 6/7)Lituano (Dvorak de EE. UU. con letras lituanas)Lituano (EE. UU., con letras lituanas)Lituano (estándar)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2ª alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBBaixo sorbioBaixo serbio (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonioMacedonio (sen teclas mortas)MacintoshMacintosh antigoManter a compatibilidade das teclas cos códigos de teclas antigos de SolarisFacer de Bloq Maiús un Retroceso adicionalFacer de Bloq. Maiús un Esc. adicionalFacer de Bloq. Maiús un Hyper adicionalFacer do Bloq. Maiús unha tecla do menú adicionalFacer de Bloq Maiús un Bloq Num adicionalFacer de Bloq Maiús un Super adicionalFacer Zenkaku Hankaku un ESC adicionalMalaio (Jawi, teclado árabe)Malaio (Jawi, fonético)MalayalamMalayalam (lalitha)Malaio (Inscript mellorado con signo de rupia)MaltésMaltés (con distribución para EE. UU.)Manipuri (Eeyek)MaoríMarathi (KaGaPa fonético)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenú (cando se preme), Maiús.+Menú para MenúMenú como Ctrl dereitoMeta está asignada á tecla Windows esquerdaMeta está asignada ás teclas WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (sueco)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AOpcións varias de compatiblidadeMmuockMoldavoMoldavo (Gagauz)MongolMontenegrinoMontenegrino (cirílico con guillemots)Montenegrino (cirílico)Montenegrino (cirílico, Z e ZHE trocados)Montenegrino (Latín con guillemots)Montenegrino (Latín, QWERTY)Montenegrino (Latín, Unicode)Montenegrino (Latín, Unicode, QWERTY)Multilingüe (Canadá, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Retroceso estilo NICOLA-FNepalíEspazo non separábel no segundo nivelEspazo non separábel no terceiro nivelEspazo non separábel no terceiro nivel, nada no cuarto nivelEspazo non separábel no terceiro nivel, espazo estreito non separábel no cuarto nivelEspazo non separábel no cuarto nivelCarácter de espazo non separábel no 4º nivel, carácter de espazo estreito non separábel no 6º nivelCarácter de espazo non separábel no 4º nivel, carácter de espazo estreito non separábel no 6º nivel (a través de Ctrl+Maiús)Lapón do norte (Finlandia)Lapón do norte (Noruega)Lapón do norte (Noruega, sen teclas mortas)Lapón do norte (Suecia)Northgate OmniKey 101NorueguésNoruegués (Colemak)Noruegués (Dvorak)Noruegués (Macintosh)Noruegués (Macintosh, sen teclas mortas)Noruegués (Sun Type 6/7)Noruegués (teclas Windows)Noruegués (sen teclas mortas)Bloq NumBloq Núm activo: díxitos, Maiús cambia a teclas de frechas, Bloq Núm inactivo:  teclas de frechas (como en Windows)Comportamento da tecla Eliminar do teclado numéricoAs teclas do teclado numérico sempre escriben díxitos (como en Mac OS)OLPCOccitanoOghamOgam (IS434)Ol ChikiHúngaro antigoOrixaOrtek Multimedia/Internet MCK-800Osetio (Xeorxia)Osetio (teclas Windows)Osetio (herdado)PC-98Rusino de PanoniaPosición das paréntesesPashtoPashto (Afganistán, OLPC)PausaPersaPersa (Afganistán, OLPC dari)Persa (con teclado persa)PolacoPolaco (Colemark)Polaco (Dvorak)Polaco (Dvorak, comiñas polacas na tecla 1)Polaco (Dvorak, comiñas polacas na tecla de comiñas)Polaco (Alemaña, sen teclas mortas)Polaco (Glagolica)Polaco (QWERTZ)Polaco (Sun Type 6/7)Polaco (internacional con teclas mortas)Polaco (herdado)Polaco (Dvorak de programador)PortuguésPortugués (Brasil)Portugués (Brasil, Dvorak)Portugués (Brasil, IBM/Lenovo ThinkPad)Portugués (Brasil, nativo para teclados de EE. UU.)Portugués (Brasil, nativo)Portugués (Brasil, Sun Type 6/7)Portugués (Brasil, sen teclas mortas)Portugués (Macintosh)Portugués (Macintosh, sen teclas mortas)Portugués (Macintosh, sen teclas mortas)Portugués (nativo para teclados de EE. UU.)Portugués (nativo)Portugués (Sun Type 6/7)Portugués (sen teclas mortas)Portugués (teclas mortas de Sun)Posición da tecla ComposePropeller Voyager KTEZ-1000PrtScPanyabí (gurmukhi jhelum)Panyabí (gurmukhi)QTronix Scorpius 98N+Alt dereitoAlt dereito (mentres está premido)Alt dereita selecciona o 5º nivel, actúa como un bloqueo dunha vez ao premerse xunto con outro selector de 5º nivelA tecla Alt dereita nunca elixe o 3º nivelA tecla Alt dereita, Maiús+Alt dereita e tecla ComposeCtrl dereitoCtrl dereito (mentres está premido)Ctrl dereito como Alt dereitoCtrl dereito + Maiús dereitoMaiús dereitoWindows dereitoA tecla Windows (mentres está premida)Win dereita selecciona o 5º nivel, actúa como bloqueo dunha vez ao premerse xunto con outro selector de 5º nivelRomanésRomanés (Alemania)Romanés (Alemaña, sen teclas mortas)Romanés (Sun Type 6/7)Romanés (teclas Windows)Romanés (cedilla)Rumanía (tipo de pulsación ergonómica)Romanés (cedilla estándar)Romanés (estándar)Rupia no 4RusoRuso (checo, fonético)Ruso (DOS)Ruso (Xeorxia)Ruso (Alemania, fonético)Ruso (Alemania, recomendado)Ruso (Alemaña, transliteración)Ruso (Kazakhstán, con kazakho)Ruso (Macintosh)Ruso (Polonia, Dvorak fonético)Ruso (políglota e reaccionario)Ruso (Rulemak, Colemak fonético)Ruso (Sun Type 6/7)Ruso (sueco, fonético)Ruso (sueco, fonético, sen teclas mortas)Ruso (EE. UU., fonético)Ruso (Ucraíno estándar RSTU)Ruso (herdado)Ruso (fonético)Ruso (fonético, AZERTY)Ruso (fonético, Dvoraz)Ruso (francés, fonético)Ruso (fonético con teclas Windows)Ruso (máquina de escribir)Ruso (máquina de escribir, heredado)Ruso (con puntuación dos EE. UU.)Ruso (con distribución ucraína e bielorrusa)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwán)Samsung SDM 4500PSamsung SDM 4510PSánscrito (KaGaPa fonético)Sanwa Supply SKB-KG3Bloq DesplSecwepemctsinPunto e coma no terceiro nivelSerbioMontenegrino (cirílico con guillemots)Serbio (cirílico, Z e ZHE trocados)Serbio (Latín con guillemots)Serbio (Latín)Serbio (Latín, QWERTY)Serbio (Latín, Unicode)Serbio (Latín, Unicode, QWERTY)Serbio (Rusia)Serbio (combinar tiles no lugar de teclas mortas)Serbocroata (EE. UU.)Maiús + Bloqueo numérico activa as teclas do punteiroMaiús cancela BloqMaiúsMaiús non cancela Bloq Num, no seu lugar elixe o 3er nivelMaiús+BloqMaiúsSicilianoSiciliano (Teclado U.S.A)SilesioSilvercrest Multimedia sen fíosSindhiCingalés (teclado EE.UU. con letras cingalesas)Cingalés (fonético)EslovacoEslovaco (QWERTY)Eslovaco (QWERTY, barra invertida estendida)Eslovaco (Sun Type 6/7)Eslovaco (Barra invertida estendida)EslovenoEsloveno (teclado EE. UU. con letras eslovenas)Esloveno (con comiñas para citas)EspañolEspañol (Dvorak)Español (latinoamericano)Español (Latinoamericano, Colemak para xogos)Español (Latinoamericano, Colemak)Español (Latinoamericano, Dvorak)Español (latinoamericano, til morta)Español (latinoamericano, sen teclas mortas)Español (latinoamericano, teclas mortas de Sun)Español (Macintosh)Español (Sun Type 6/7)Español (teclas Windows)Español (incluír til morta)Español (sen teclas mortas)Español (teclas mortas de Sun)Teclas especiais (Ctrl+Alt+«tecla») manipuladas nun servidorSteelSeries Apex 300 (Apex RAW)Compatibilidade coas teclas de SunSun Type 6 (xaponés)Sun Type 6 USB (xaponés)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (europeo)Sun Type 7 USBSun Type 7 USB (europeo)Sun Type 7 USB (xaponés)/Xaponés 106 teclasSun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenia)Swahili (Tanzania)Intercambiar Ctrl e Bloq MaiúsIntercambiar ESC e Bloq MaiúsTrocar Alt esquerda con Ctrl esquerdaTrocar Win esquerdo  con Ctrl esquerdaTrocar tecla Win dereita por tecla Ctrl dereitaIntercambiar corchetes SuecoSueco (Dvorak A5)Sueco (Dvorak)Sueco (Macintosh)Sueco (Sun Type 6/7)Sueco (Svdvorak)Sueco (teclado EE.UU. con letras suecas)Sueco (baseado no Dvorak internacional U.S.A)Sueco (sen teclas mortas)Lingua de signos suecoCambiando a outra disposiciónTableta Symplon PaceBookSirioSirio (fonético)TaiwanésTaiwanés (autóctono)TaxicoTaxico (herdado)Támil (Inscript)Támil (Sri Lanka, TamilNet '99)Támil (Sri Lanka, TamilNet '99, codificación TAB)Támil (TamilNet '99, con numerais Támil)Támil (TamilNet '99)Támil (TamilNet '99, codificación TAB)Támil (TamilNet '99, codificación TSCII)Targa Visionary 811TatarTeluguTelugu (KaGaPa fonético)Telugu (Sarala)TailandésTailandés (Pattachote)Tailandés (TIS-820.2538)TibetanoTibetano (con numerais ASCII)Á tecla correspondente nunha disposición Colemak.Á tecla correspondente nunha disposición Dvorak.Á tecla correspondente nunha disposición QWERTY.Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Teclado para computador Truly Ergonomic Modelo 227 (teclas Alt largas)Teclado de computadora Truly Ergonomic Modelo 229 (teclas Alt de tamaño estándar, teclas Menú e Super adicionais)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcoTurco (Alt-Q)Turco (F)Turco (Alemaña)Turco (Sun Type 6/7)Turco (internacional con teclas mortas)Turco (teclas mortas de Sun)TurkmenistanoTurkmenistano (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:modo EU)TypeMatrix EZ-Reach 2030 USB (106:modo JP)UdmurtoUrgarítico no canto de árabeUcraínoUcraíno (Sun Type 6/7)Ucraíno (teclas Windows)Ucraíno (homofónico)Ucraíno (herdado)Ucraíno (fonético)Ucraíno (estándar RSTU)Ucraíno (máquina de escribir)Adicións unicode (frechas e operadores matemáticos)Adicións unicode (frechas e operadores matemáticos); operadores matemáticos no nivel predeterminadoUnitek KB-1925Urdú (Paquistán)Urdú (Paquistán, CRULP)Urdú (Paquistán, NLA)Urdú (teclas Windows)Urdú (alt. fonético)Urdú (fonético)Usar o LED do teclado para mostrar a disposición alternativaUsando a tecla espazo para introducir un espazo non separábelEspacio usual en calquera nivelUigurUzbecoUzbeco (Afganistán)Uzbeco (Afganistán, OLPC)Uzbeco (Latín)VietnamitaVietnamita (AÐERTY)Vietnamita (Francés con letras vietnamitas)Vietnamita (QĐERTY)Vietnamita (teclado EE.UU. con letras vietnamitas)ViewSonic KU-306 InternetTeclado numérico Wang 724 con adicións Unicode (frechas e operadores matemáticos)Teclado numérico Wang 724 con adicións Unicode (frechas e operadores matemáticos); operadores matemáticos no nivel predeterminadoA tecla Win asígnase a Impr. Pantalla (e como tecla Win habitual)Tecla Win+EspazoWinbook Model XP5WolofYahoo! InternetYakutoYorubaEspazo non separábel de largura cero (ZWNJ) no 2º nivelEspazo non separábel de largura cero (ZWNJ) no 2º nivel, espazo non separábel no 3º nivelEspazo non separábel de largura cero (ZWNJ)  no 2º nivel, espazo non separábel no 3º nivel, nada no 4º nivelEspazo non separábel de largura cero (ZWNJ) no 2º nivel, espazo non separábel no 3º nivel, espazo estreito non separábel no 4º nivelEspazo non separábel de largura cero (ZWNJ) no 2º nivel, espazo non separábel no 3º nivel, espazo de largura cero separábel (ZWJ) no 4º nivelCarácer de espazo non separábel de largura cero (ZWNJ) no 3º nivelCarácer de espazo non separábel de largura cero (ZWNJ) no 2º nivel, carácter de espazo separábel (ZWJ) no 3º nivel, caracter de espazo non separábel no 4º nivelEspazo non separábel de largura cero (ZWNJ) no 3º nivel, espazo de largura cero non separábel no 4º nivelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzPortátil eMachines m6800eeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukuree.uuuzviwoxsyyozgzhPK�m�\=�UT,T,LC_MESSAGES/recode.monu�[�����?YpKq���y�
����
|0�9�6
C<
�
�
9�
�
�
�
�
-$95^'�$�$�$&>Je$��
�H�B]y�"��1��(5&Bi"x�0������".Ql&�������
���E�K3��T��r��R��6� G� ;0!Fl!�!�!=�!"")"
8"=F")�"A�",�"-#2K#~#�#'�#T�#=8$v$�$C�$,�$,%	F%%P%+v%�%;�%�%>&
G&0U&�&+�&�&6�&'�9'��'-�*�*&�*/�* +7+P+�k+6,
;,F,K,(.;
0
</"#%9=7>)?:-451'3 	2+86!$&,*
Copyright (C) 1990, 92, 93, 94, 96, 97, 99 Free Software Foundation, Inc.

Fine tuning:
  -s, --strict           use strict mappings, even loose characters
  -d, --diacritics       convert only diacritics or alike for HTML/LaTeX
  -S, --source[=LN]      limit recoding to strings and comments as for LN
  -c, --colons           use colons instead of double quotes for diaeresis
  -g, --graphics         approximate IBMPC rulers by ASCII graphics
  -x, --ignore=CHARSET   ignore CHARSET while choosing a recoding path

If a long option shows an argument as mandatory, then it is mandatory
for the equivalent short option also.  Similarly for optional arguments.

If none of -i and -p are given, presume -p if no FILE, else -i.
Each FILE is recoded over itself, destroying the original.  If no
FILE is specified, then act as a filter and recode stdin to stdout.

Operation modes:
  -v, --verbose           explain sequence of steps and report progress
  -q, --quiet, --silent   inhibit messages about irreversible recodings
  -f, --force             force recodings even when not reversible
  -t, --touch             touch the recoded files after replacement
  -i, --sequence=files    use intermediate files for sequencing passes
      --sequence=memory   use memory buffers for sequencing passes

Option -l with no FORMAT nor CHARSET list available charsets and surfaces.
FORMAT is `decimal', `octal', `hexadecimal' or `full' (or one of `dohf').

REQUEST is SUBREQUEST[,SUBREQUEST]...; SUBREQUEST is ENCODING[..ENCODING]...
ENCODING is [CHARSET][/[SURFACE]]...; REQUEST often looks like BEFORE..AFTER,
with BEFORE and AFTER being charsets.  An omitted CHARSET implies the usual
charset; an omitted [/SURFACE]... means the implied surfaces for CHARSET; a /
with an empty surface name means no surfaces at all.  See the manual.

Report bugs to <recode-bugs@iro.umontreal.ca>.

Usage: %s [OPTION]... [ [CHARSET] | REQUEST [FILE]... ]
  -p, --sequence=pipe     same as -i (on this system)
  -p, --sequence=pipe     use pipe machinery for sequencing passes
 done
%s to %s%sConversion table generated mechanically by Free `%s' %s%sfor sequence %s.%s*Unachievable**mere copy*Ambiguous outputCannot complete table from set of known pairsCannot invert given one-to-one tableCannot list `%s', no names available for this charsetCharset %s already exists and is not %sChild process wait status is 0x%0.2xCodes %3d and %3d both recode to %3dDec  Oct Hex   UCS2  Mne  %s
Expecting `..' in requestFollowing diagnostics for `%s' to `%s'Free `recode' converts files between various character sets and surfaces.
Identity recoding, not worth a tableInternal recoding bugInvalid inputLN is some language, it may be `c', `perl' or `po'; `c' is the default.
Misuse of recoding libraryNo character recodes to %3dNo errorNo table to printNo way to recode from `%s' to `%s'Non canonical inputPair no. %d: <%3d, %3d> conflicts with <%3d, %3d>Recoding %s...Recoding is too complex for a mere tableRequest: %s
Resurfacer set more than once for `%s'Shrunk to: %s
Sorry, no names available for `%s'Step initialisation failedStep initialisation failed (unprocessed options)System detected problemThis is free software; see the source for copying conditions.  There is NO
warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.
This program is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2, or (at your option)
any later version.

This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
GNU General Public License for more details.

You should have received a copy of the GNU General Public License
along with this program; if not, write to the Free Software Foundation,
Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
Try `%s %s' for more information.
UCS2   Mne   Description

Unrecognised surface name `%s'Unsurfacer set more than once for `%s'Untranslatable inputVirtual memory exhaustedVirtual memory exhausted!With -k, possible before charsets are listed for the given after CHARSET,
both being tabular charsets, with PAIRS of the form `BEF1:AFT1,BEF2:AFT2,...'
and BEFs and AFTs being codes are given as decimal numbers.
bytereversibleucs2variableProject-Id-Version: recode 3.5
POT-Creation-Date: 2001-01-02 22:35+0100
PO-Revision-Date: 2000-05-06 01:44+02:00
Last-Translator: Jacobo Tarr�o Barreiro <jtarrio@iname.com>
Language-Team: Galician <gpul-traduccion@ceu.fi.udc.es>
MIME-Version: 1.0
Content-Type: text/plain; charset=iso-8859-1
Content-Transfer-Encoding: 8-bit

Copyright (C) 1990, 92, 93, 94, 96, 97, 99 Free Software Foundation, Inc.

Axustes finos:
  -s, --strict        usar mapeados estrictos, incluso perder caracteres
  -d, --diacritics    converter s� diacr�ticos ou similares para HTML/LaTeX
  -S, --source[=LN]   limita-la recodificaci�n a cadeas e comentarios para LN
  -c, --colon         usar dous puntos no canto de comi�as dobres para di�rese
  -g, --graphics      aproxima-las li�as de IBMPC con gr�ficos ASCII
  -x, --ignore=XOGO   ignora-lo XOGO ao escoller unha rota de recodificaci�n

Se unha opci�n longa amosa un par�metro como obrigatorio, ent�n tam�n �
obrigatorio para a opci�n curta equivalente.  Do mesmo xeito para par�metros
opcionais.

Se non se indica -i nin -p, suponse -p se non se indica un FICHEIRO, sen�n -i.
Cada FICHEIRO recodif�case sobre si mesmo, destru�ndose o orixinal.  Se non
se indica un FICHEIRO, traballa coma un filtro e recodifica stdin a stdout.

Modos de operaci�n:
  -v, --verbose             explica-la secuencia de pasos e informar dos
                               progresos
  -q, --quite, --silent     inhibi-las mensaxes sobre recodificaci�ns
                               irreversibles
  -f, --force               forza-las recodificaci�ns incluso cando non son
                               reversibles
  -t, --touch               toca-los ficheiros recodificados despois de
                               cambialos
  -i, --sequence=files      usar ficheiros intermedios para pasos secuenciais
      --sequence=memory     usa-la memoria para pasos secuenciais

A opci�n -l sen FORMATO ou XOGO lista os xogos e superficies dispo�ibles.
O FORMATO � `decimal', `octal', `hexadecimal' ou `full' (completo), ou unha
letra entre `dofh'.

PETICI�N � SUBPETICI�N[,SUBPETICI�N]...; SUBPETICI�N �
CODIFICACI�N[..CODIFICACI�N]...; CODIFICACI�N � [XOGO][/[SUPERFICIE]]...;
PETICI�N adoita parecer INICIAL..FINAL, sendo INICIAL e FINAL uns xogos de
caracteres.  Se non se indica un XOGO t�mase o xogo normal; se non se indica
unha [/SUPERFICIE]... t�manse as superficies implicadas en XOGO; cunha /
cun nome de superficie baleiro non se toma ningunha superficie.  Lea o manual.

Informe dos erros en <recode-bugs@iro.umontreal.ca>.

Uso: %s [OPCI�N]... [ [XOGO-DE-CARACTERES] | PETICI�N [FICHEIRO]... ]
  -p, --sequence=pipe       o mesmo que -i (neste sistema)
  -p, --sequence=pipe       usar canalizaci�ns para pasos secuenciais
 feito
%s a %s%sT�boa de conversi�n xerada mec�nicamente polo `%s' Libre %s%spara a secuencia %s.%s*Inalcanzable**simple copia*Sa�da ambiguaNon podo completa-la t�boa dado o conxunto de pares co�ecidosNon se pode inverti-la t�boa un-a-un dadaNon se pode listar `%s', non hai nomes dispo�ibles para este xogoO xogo de caracteres %s xa existe e non � %sO estado de espera do proceso fillo � 0x%0.2x�mbolos dous c�digos %3d e %3d recodif�canse a %3dDec  Oct Hex   UCS2  Mne  %s
Esper�base un `..' na petici�nSeguen os diagn�sticos para `%s' a `%s'O `recode' libre convirte ficheiros entre varios xogos de caracteres e superficies.
Recodificaci�n identidade, non merece a pena facer unha t�boaErro interno na recodificaci�nEntrada incorrectaLN � unha linguaxe, pode ser `c', `perl' ou `po'; `c' por defecto.
Uso incorrecto da librer�a de recodificaci�nNon hai caracteres que se recodifiquen a %3dSen errosNon hai ningunha t�boa que visualizarNon hay xeito de recodificar de `%s' a `%s'Sen sa�da normalizadaO par n�m. %d: <%3d, %3d> entra en conflicto con <%3d, %3d>Recodificando %s...A recodificaci�n � demasiado complicada para unha simple t�boaPetici�n: %s
Aplic�ronse superficies m�is dunha vez para `%s'Encollido a: %s
S�ntoo, non hai nomes dispo�ibles para `%s'A inicializaci�n do paso fallouA inicializaci�n do paso fallou (opci�ns sen procesar)O sistema detectou un problemaIsto � software libre; vexa o c�digo fonte polas condici�ns de copia. NON hai
garant�a; nin sequera de COMERCIABILIDADE ou APTITUDE PARA UN FIN DETERMINADO.
Este programa � software libre; pode redistribu�lo e/ou modificalo
baixo os termos da Licencia P�blica Xeral de GNU tal como foi publicada
pola Free Software Foundation; xa a versi�n 2, ou (� s�a elecci�n)
calqueira versi�n posterior.

Este programa � distribu�do coa esperanza de que sexa �til, pero
SEN NINGUNHA GARANT�A; nin sequera a garant�a impl�cita de COMERCIABILIDADE
ou APTITUDE PARA UN FIN EN PARTICULAR. Vexa a Licencia P�blica Xeral de
GNU para ter m�is detalles.

Deber�a ter recibido unha copia da Licencia P�blica Xeral de GNU con
este programa; se non � o caso, escriba � Free Software Foundation, Inc.,
59 Temple Place - Suite 330, Boston, MA 02111-1307, EE.UU.
Escriba `%s %s' para obter m�is informaci�n.
UCS2   Mne   Descripci�n

Nome de superficie `%s' non reco�ecidoQuit�ronse superficies m�is dunha vez para `%s'Entrada non traducibleMemoria virtual esgotada�Memoria virtual esgotada!Con -k, os posibles xogos iniciais l�stanse para o XOGO final indicado,
sendo os dous xogos tabulares, con PARES da forma `INI1:FIN1,INI2:FIN2,...'
e os c�digos INI e FIN d�ndose coma n�meros decimais.
bytereversibleucs2variablePK�m�\0�V�))LC_MESSAGES/atk10.monu�[������l��
HI`q�����#� 4Uq�C�	�4��?�:�<(7e4�,�$�$B6Gy
�5�'#9"](�=�6�*I
[f	lv�����������	��
�
�	

)4EV
hv�������
��+1>EQX]
cns|�����	��������		!+/7<CH	Q[hty
��	�
�
�������	

"-9	AKR
^	isz
��	������	�
��	
%-	6	@JS	_iox}��%5JZix'�+�)�(&<cJ�
�5��D�B�A8?z4�)�.HO\A��7 < $L q � '� 7� 4!)E!o!
�!�!
�!
�!�!�!�!�!�!�!�!
�!"""""1"T"d"y"
�"�"�"�"�"�"�"	##&#/# C#d#w#�#�#
�#�#�#�#$$*$1$K$
Z$e$k$~$�$	�$�$�$
�$�$�$
�$�$�$
%%%#%7%F%U%^%d%s%�%�%�%�%�%�%�%
�%�%�%�%&*&
0&;&P&`&r&�&�&�&�&�&�&�&�&'#'	,'6'K'\'k'{'�'�'�'�'�'�'(	(((-(>(S(m(u(�(�(�(�(�(	�(	�(
�(�(�())�Ace",I�D�+t���';[C�
��/��gBP$�:ko�)m7-.�4(�O��8�}w�jy%0FE�LWM��^u|X*S��J!r�9��npHs_����RZ1�vx�Ul	]3�>hT�=f�{\�ib@2&N�zda6?5~`QGV���<�K 
#�YqAccessible DescriptionAccessible LayerAccessible MDI ValueAccessible NameAccessible ParentAccessible RoleAccessible Table CaptionAccessible Table Caption ObjectAccessible Table Column DescriptionAccessible Table Column HeaderAccessible Table Row DescriptionAccessible Table Row HeaderAccessible Table SummaryAccessible ValueDescription of an object, formatted for assistive technology accessEnd indexIs used to notify that the table caption has changedIs used to notify that the table caption has changed; this property should not be used. accessible-table-caption-object should be used insteadIs used to notify that the table column description has changedIs used to notify that the table column header has changedIs used to notify that the table row description has changedIs used to notify that the table row header has changedIs used to notify that the table summary has changedIs used to notify that the value has changedNumber of Accessible Hypertext LinksNumber of AnchorsObject instance’s name formatted for assistive technology accessParent of the current accessible as returned by atk_object_get_parent()Selected LinkSpecifies whether the AtkHyperlink object is selectedStart indexThe accessible MDI value of this objectThe accessible layer of this objectThe accessible role of this objectThe end index of the AtkHyperlink objectThe number of anchors associated with the AtkHyperlink objectThe number of links which the current AtkHypertext hasThe start index of the AtkHyperlink objectaccelerator labelacceptablealertanimationapplicationarrowarticleaudioautocompletebadbestblock quotecalendarcanvascaptionchartcheck boxcheck menu itemcolor choosercolumn headercombo boxcommentdateeditordefinitiondescription listdescription termdescription valuedesktop framedesktop icondialdialogdirectory panedocument emaildocument framedocument presentationdocument spreadsheetdocument textdocument webdrawing areaedit barembedded componententryfile chooserfillerfontchooserfooterformframeglass panegoodgroupingheaderheadinghighhtml containericonimageimage mapinfo barinput method windowinternal frameinvalidlabellandmarklayered panelevel barlinklistlist boxlist itemlogmarqueemathmediummenumenu barmenu itemnotificationoption panepagepage tabpage tab listpanelparagraphpassword textpopup menuprogress barpush buttonradio buttonradio menu itemratingredundant objectroot panerow headerrulerscroll barscroll panesectionseparatorsliderspin buttonsplit panestatusbarstrongtabletable celltable column headertable rowtable row headertear off menu itemterminaltexttimertitle bartoggle buttontool bartool tiptreetree itemtree tableunknownvery badvery goodvery highvery lowvery strongvery weakvideoviewportweakwindowProject-Id-Version: gl
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2014-03-06 12:24+0100
PO-Revision-Date: 2014-03-06 12:25+0200
Last-Translator: Fran Dieguez <frandieguez@gnome.org>
Language-Team: gnome-l10n-gl@gnome.org
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
Descrición accesíbelCapa accesíbelValor MDI accesíbelNome accesíbelPai accesíbelRol accesíbelTítulo da táboa accesíbelObxecto de título de táboa accesíbelDescrición de columna da táboa accesíbelCabeceira de columna da táboa accesíbelDescrición de fila da táboa accesíbelCabeceira de fila de táboa accesíbelResumo de táboa accesíbelValor accesíbelA descrición dun obxecto formatado para o acceso a tecnoloxías adaptadasÍndice finalÚsase para notificar que o título da táboa cambiouÚsase para notificar que o título da táboa cambiou. Esta propiedade non se debe usar. En troques, debe usarse accessible-table-caption-objectÚsase para notificar que a descrición de columna da táboa cambiouÚsase para notificar que a cabeceira de columna da táboa cambiouÚsase para notificar que a descrición de fila da táboa cambiouÚsase para notificar que a cabeceira de fila da táboa cambiouÚsase para notificar que o resumo da táboa cambiouÚsase para notificar que o valor cambiouNúmero de ligazóns de hipertexto accesíbeisNúmero de áncorasO nome da instancia do obxecto formatado para o acceso a tecnoloxías adaptadasO pai do accesíbel actual como o devolve atk_object_get_parent()Ligazón seleccionadaEspecifica se o obxecto AtkHyperlink está seleccionadoÍndice inicialO valor MDI accesíbel deste obxectoA capa accesíbel deste obxectoO rol accesíbel deste obxectoO índice final do obxecto AtkHyperlinkO número de áncoras asociadas ao obxecto AtkHyperlinkO número de ligazóns que ten o AtkHypertext actualO índice inicial do obxecto AtkHyperlinketiqueta de tecla rápidaaceptábelalertaanimaciónaplicativofrechaartigosoncompletar automaticamentemalaa mellorbloque de citacalendariolenzolendagráficacaixa de verificaciónelemento de menú de verificaciónselector de corcabeceira de columnacaixa de combinacióncomentarioeditor de datadefiniciónlista de descriciónstermo de descriciónvalor de descriciónmarco de escritorioicona de escritoriomarcadordiálogopanel de directoriodocumento de correo electrónicomarco de documentodocumento de presentacióndocumento da folla de cálculodocumento de textodocumento webárea de debuxobarra de edicióncompoñente incorporadoentradaselector de ficheirosrecheoselector de tipo de letrapé de páxinaformulariomarcopanel transparenteboaagrupacióncabeceiratítuloaltacontedor htmliconaimaxemapa de imaxebarra de informaciónxanela de método de entradamarco internonon válidoetiquetapunto de referenciapanel en capasbarra de nivelligazónlistacaixa de listaelemento de listarexistromarquesiñamatemáticasmediamenúbarra de menúelemento de menúnotificaciónpanel de opciónspáxinalapela de páxinalista de lapelas de páxinapanelparágrafotexto de contrasinalmenú emerxentebarra de progresobotón de premerbotón de opciónelemento de menú de opciónpuntuaciónobxecto redundantepanel raízcabeceira de filaregrabarra de desprazamentopanel de desprazamentosecciónseparadorcontrol desprazábelbotón de axustepanel divididobarra de estadofortetáboacela de táboacabeceira de columna de táboafila de táboacabeceira de fila de táboaelemento de menú desprazábelterminaltextotemporizadorbarra de títulobotón de estadobarra de ferramentasferramenta de suxestiónsárboreelemento de árboretáboa en árboredescoñecidomoi malamoi malamoi altamoi baixamoi fortemoi débilvídeoárea de visualizacióndébilxanelaPK�m�\�������LC_MESSAGES/NetworkManager.monu�[������te�`&a&~&�&7�&�&�&	�&�&'	'"'	)'3'<'I'&R'y'�'/�'�'	�'%�'5(4O(�(�(�(�(�(
�(�(�(�(�(�(	)
)$)<)5\)4�) �)�)+�)#*8*N*	m*w*�*�*
�*�*�*�*�*�*�*�*	+++$+9+A+T+k+	�+
�+
�++�+�+�+0,,8,:e,!�,&�,#�,
-$+-P-p- �- �-�-�-.',.'T.&|. �. �.�.�.//*/F/R/V/h/
q/|/�/�/.�/�/%�/�/0(010G0\0`0i0{0#�0�00�0*�0##1G1'_1"�1'�1�1
�1�1 2>,22k2�2�2�2 �2.3A?3'�3)�3�3%�34-54'c41�4>�46�4>355r50�5!�5�566#Q6(u6-�6)�6J�6A7J7?Z7$�7�7"�7&8<'8=d8�85�8,�8)9'F9+n90�9,�90�9,):-V:"�: �: �:+�:+;A;G;d;!�;�;�;�;
�;�;�;
�;L�;9<#L<-p<�<�<$�<
�<�<1�<)=/=>=BJ=�=�=�=�=
�= �=�=�=�=>>4 >0U>9�>0�>/�>4!?V?]?e?l?}?�?#�?�?�?�?(@!D@#f@�@�@0�@�@�@A"A"AAdA�A��AwB�B�B(�B�B&�B$C-CMCkCxC�C�C	�C!�C�C�C
D$D&3D!ZD|D�D
�D�D�D�D�D�D�D-E:EREYE%aE�E�EZ�EFFF%F1F9FOFTF'cF�F1�F4�F	�FG
GG/GCGRG
YG dG)�G�G
�G�G"�G�GHH5H:PHK�HE�H>IE\I@�IE�IF)JHpJD�J�JKK,K'HK$pK1�K&�K�K*L,0L]LyL�L"�L5�LMM9MYMhM%�M+�M�M
�M�MNN_%N��N�OOM?P�P�P�P�P�P
�P�P)�P$Q&Q?QQQgQ	xQ�Q�Q�Q�Q�Q�Q�Q�QcRrRxR�R�R�R�R�R�R�R	�R
�R	SSS!S&S	,S6SMS
cS%nS�S%�S �S�S+	T
5T@TRT_T/gT�T�T
�T�T	�T�T�T�T7U<UVU^U+nU�U�UB�U1�U"V:V=V#JVnV#�V�V�V�V�V�V�V	�V�V�V�VWW(W4W<WQW	fW(pW�W
�W��W{Y�Y�Y7�Y�YZ	ZZ+Z?Z	NZXZgZsZ�Z+�Z�Z�Z;�Z1[	9[$C[>h[/�[�[�[�[�[�[\ \>\E\Q\
Y\	d\n\)�\&�\=�\2]'H]p]']�]�]"�]�]^^#5^
Y^g^l^s^y^~^�^�^	�^�^�^�^�^�^�^+_	B_
L_
W_,e_�_ �_9�_6	`9@`(z`3�`/�`+a03a(da'�a2�a3�a2b.Ob*~b4�b4�b3c0Gc1xc�c'�c�c�c d$d3d7d	HdRd^dgdod/{d�d0�d$�d(eBeNefexe|e�e	�e$�e+�eA�e=8f'vf�f<�f9�f-4gbg	}g
�g�gN�g?hDhwh�hA�h@�h43i7hi1�i+�i(�iA'j*ij>�jE�j<kEVk;�k/�kl2&l@Yl/�l.�l:�l64mXkm�m�m@�m7#n#[n/n4�nV�nZ;o!�oB�oK�oDGp0�p4�pD�p77q@oq8�q5�q5r6Ur3�rF�rCsKs%Qs%ws/�s�s�s�s
�stt
tk&t�t%�t1�t
�t	u'u
9uDu4\u�u�u�uF�u�u�uvv0v&?vfvxvv�v�v=�v>�vF&wFmwH�wJ�wHx
Ox]xfx"yx�x(�x"�x)�x#y6;y5ry(�y�y�y<�y)z,Dzqz$�z'�z'�z�z�{||6|-V|�|4�|�|*�|&}'}>}U}s}	�}/�}�}�}�};�}46~;k~+�~�~
�~ �~28<H7h���-���h(�����������ǀ��/��	)�/3�9c�������$с'���
3�>�(O�3x�����Ȃ+т#��!�9�=@�R~�_у]1�O��^߄O>�N��P݅W.�T��ۆ��F��%>�$d�8��(‡�5�0:�k���1��ֈB�7� M�%n���)��3щ0�6�C�'U�%}���d�����C�F�V�[�m�u�y�
��5��)΍!���(+�T�h�u���������������ڎZ�_�k�s���������ҏ֏	ߏ�������	��4�
L�)W���(��#�-�	.� 8�Y�f�<s�����
ɑב	� ���>0�%o�����9��ے�C��69�p�����0��)ՓA��A�I�X�e�q�z�
��
��������ǔ����#�C�3R�����^m���0yc�A#��'�=�7��Q��2:D���v��41+c��uq���mE���9)qtoY*�`�
�%Yf�K�[T�HL����g�b[�I,L �S����~�p;���N�a?Q�`����zi!I?��BF	�H����xEC���%C���h�8\�z�{|��D�\W�Fk�^3$9>��l;Mu�].�P.��Uo��	��d"��J��������{�G������'e��M!�V�/�T�]�1�@s���=�n>���O�_����
�s�����-�&)y�$�O:�GR�/J�Uk�����j�e6�X�v���t��}�p_�&7�d+�Z<i���Bw���l((r<��������������j,RW��������b|r6P�h4���-�n��S���g0��8��2K#�}�
@*
V5���w �"Ax�~�XN�Z�f5��3a�# Created by NetworkManager
# Merged from %s

%d (unknown)%s.  Please use --help to see a list of valid options.
%u MHz%u Mb/s%u Mbit/s'%s' has to be alone'%s' not among [%s](default)(none)(unknown)0 (NONE)0 (disabled)0 (none)802.1X supplicant configuration failed802.1X supplicant disconnected802.1X supplicant failed802.1X supplicant took too long to authenticate802.3adA (5 GHz)A dependency of the connection failedA problem with the RFC 2684 Ethernet over ADSL bridgeA secondary connection of the base connection failedADSLARPAccess PointActivateActivate a connectionActive BackupActive connection detailsAd-HocAd-Hoc NetworkAddAdd...AddressesAging timeAllow control of network connectionsAllowed authentication methods:An http(s) address for checking internet connectivityAre you sure you want to delete the connection '%s'?Ask for this password every timeAuthenticationAuthentication required by wireless networkAutoIP service errorAutoIP service failedAutoIP service failed to startAutomaticAutomatic (DHCP-only)Automatically connectAvailable to all usersB/G (2.4 GHz)BONDBRIDGEBSSIDBondBond connection %dBridgeBridge connection %dBroadcastCHAPCancelCarrier/link changedChannelCloned MAC addressClosing %s failed: %s
Config file locationConnectedConnectingConnecting...Connection '%s' (%s) successfully deleted.
Connection is already activeConnection profile detailsConnection sharing via a protected Wi-Fi networkConnection sharing via an open Wi-Fi networkConnection successfully activated (D-Bus active path: %s)
Could not activate connection: %sCould not contact NetworkManager: %s.
Could not daemonize: %s [error %u]
Could not decode private key.Could not delete connection '%s': %sCould not generate random data.Could not parse argumentsCouldn't decode PKCS#12 file: %dCouldn't decode PKCS#12 file: %sCouldn't decode PKCS#8 file: %sCouldn't decode certificate: %dCouldn't decode certificate: %sCouldn't initialize PKCS#12 decoder: %dCouldn't initialize PKCS#12 decoder: %sCouldn't initialize PKCS#8 decoder: %sCouldn't verify PKCS#12 file: %dCouldn't verify PKCS#12 file: %sCreateDCB or FCoE setup failedDHCP client errorDHCP client failedDHCP client failed to startDNS serversDSLDSL connection %dDatagramDeactivateDeleteDestinationDeviceDevice '%s' successfully activated with '%s'.
Device detailsDevice disconnected by user or clientDevice is now managedDevice is now unmanagedDisabledDon't become a daemonDon't print anythingEAPETHERNETEdit a connectionEdit...Enable STP (Spanning Tree Protocol)Enable or disable Wi-Fi devicesEnable or disable WiMAX mobile broadband devicesEnable or disable mobile broadband devicesEnable or disable system networkingEnter connection type: Error initializing certificate data: %sError updating secrets for %s: %s
Error: %s - no such connection profile.Error: %s argument is missing.Error: %s.Error: %s: %s.Error: '%s' argument is missing.Error: '%s' is not a valid monitoring mode; use '%s' or '%s'.
Error: '%s' is not valid argument for '%s' option.Error: 'device show': %sError: 'device status': %sError: 'general logging': %sError: 'general permissions': %sError: Access point with bssid '%s' not found.Error: BSSID to connect to (%s) differs from bssid argument (%s).Error: Connection activation failed: %sError: Device '%s' is not a Wi-Fi device.Error: Device '%s' not found.Error: NetworkManager is not running.Error: No Wi-Fi device found.Error: No access point with BSSID '%s' found.Error: No network with SSID '%s' found.Error: Option '%s' is unknown, try 'nmcli -help'.Error: Option '--pretty' is mutually exclusive with '--terse'.Error: Option '--pretty' is specified the second time.Error: Option '--terse' is mutually exclusive with '--pretty'.Error: Option '--terse' is specified the second time.Error: Parameter '%s' is neither SSID nor BSSID.Error: SSID or BSSID are missing.Error: Timeout %d sec expired.Error: bssid argument value '%s' is not a valid BSSID.Error: invalid extra argument '%s'.Error: missing argument for '%s' option.Error: polkit agent initialization failed: %sError: secret agent initialization failedError: wep-key-type argument value '%s' is invalid, use 'key' or 'phrase'.EthernetEthernet deviceExit immediately if NetworkManager is not running or connectingFailed to decode PKCS#8 private key.Failed to decode certificate.Failed to decrypt the private key.Failed to decrypt the private key: %d.Failed to decrypt the private key: decrypted data too large.Failed to decrypt the private key: unexpected padding length.Failed to encrypt: %d.Failed to finalize decryption of the private key: %d.Failed to find expected PKCS#8 end tag '%s'.Failed to find expected PKCS#8 start tag.Failed to initialize the crypto engine.Failed to initialize the crypto engine: %d.Failed to initialize the decryption cipher slot.Failed to initialize the decryption context.Failed to initialize the encryption cipher slot.Failed to initialize the encryption context.Failed to register with the requested networkFailed to select the specified APNFailed to set IV for decryption.Failed to set IV for encryption.Failed to set symmetric key for decryption.Failed to set symmetric key for encryption.GROUPGSM Modem's SIM PIN requiredGSM Modem's SIM PUK requiredGSM Modem's SIM card not insertedGSM Modem's SIM wrongGVRP, GatewayHello timeHideHostnameINFINIBANDIP configuration could not be reserved (no available address, timeout, etc.)IPv6 CONFIGURATIONIV contains non-hexadecimal digits.IV must be an even number of bytes in length.IdentityIgnoreIgnore automatically obtained routesInfiniBandInfiniBand connection %dInfiniBand device does not support connected modeInfraInterface(s): Interface: Invalid option.  Please use --help to see a list of valid options.KeyLEAPLOOSE_BINDING, Link monitoringLink-LocalList of plugins separated by ','MII (recommended)MSCHAPMSCHAPv2MTUMake all warnings fatalMalformed PEM file: DEK-Info was not the second tag.Malformed PEM file: Proc-Type was not first tag.Malformed PEM file: invalid format of IV in DEK-Info tag.Malformed PEM file: no IV found in DEK-Info tag.Malformed PEM file: unknown Proc-Type tag '%s'.Malformed PEM file: unknown private key cipher '%s'.ManualMax ageMetricMobile BroadbandMobile broadband connection %dModeModem failed or no longer availableModem initialization failedModem now ready and availableModemManager is unavailableModify network connections for all usersModify persistent system hostnameModify personal network connectionsMonitoring frequencyN/ANecessary firmware for the device may be missingNetwork registration deniedNetwork registration timed outNetworkManager TUINetworkManager active profilesNetworkManager connection profilesNetworkManager is not running.NetworkManager loggingNetworkManager monitors all network connections and automatically
chooses the best connection to use.  It also allows the user to
specify wireless access points which wireless cards in the computer
should associate with.NetworkManager permissionsNetworkManager statusNetworkManager went to sleepNever use this network for default routeNew ConnectionNew connection activation was enqueuedNext HopNo carrier could be establishedNo custom routes are defined.No dial toneNo reason givenNo such connection '%s'Not searching for networksOLPC MeshOne custom route%d custom routesOpen SystemOpening %s failed: %s
PAPPEM certificate had no end tag '%s'.PEM certificate had no start tag '%s'.PEM key file had no end tag '%s'.PIN check failedPPP CONFIGURATIONPPP failedPPP service disconnectedPPP service failed to startPPPoEParentPasswordPassword must be UTF-8Password provided, but key was not encrypted.Please select an optionPrefixPrimaryPrint NetworkManager version and exitPrivate key passwordProperty name? Put NetworkManager to sleep or wake it up (should only be used by system power management)QuitREORDER_HEADERS, RemoveRound-robinRoutingSIM PIN was incorrectSSIDSearch domainsSecrets were required, but not providedSecuritySelect the type of connection you wish to create.Select the type of slave connection you wish to add.Select...ServiceSet HostnameSet hostname to '%s'Set system hostnameSetting name? SharedShared KeyShared connection service failedShared connection service failed to startShowShow passwordSlavesSpecify the location of a PID fileState file locationStatus of devicesSuccessSystem policy prevents control of network connectionsSystem policy prevents enabling or disabling Wi-Fi devicesSystem policy prevents enabling or disabling WiMAX mobile broadband devicesSystem policy prevents enabling or disabling mobile broadband devicesSystem policy prevents enabling or disabling system networkingSystem policy prevents modification of network settings for all usersSystem policy prevents modification of personal network settingsSystem policy prevents modification of the persistent system hostnameSystem policy prevents putting NetworkManager to sleep or waking it upSystem policy prevents sharing connections via a protected Wi-Fi networkSystem policy prevents sharing connections via an open Wi-Fi networkTEAMTeamTeam connection %dThe Bluetooth connection failed or timed outThe IP configuration is no longer validThe Wi-Fi network could not be foundThe device could not be readied for configurationThe device parent's management changedThe device was removedThe device's active connection disappearedThe device's existing connection was assumedThe device's parent changedThe dialing attempt failedThe dialing request timed outThe expected start of the responseThe interval between connectivity checks (in seconds)The line is busyThe modem could not be foundThe supplicant is now availableTransport modeUnable to delete connection: %sUnable to determine private key type.Unexpected amount of data after encrypting.UnknownUnknown errorUnknown log domain '%s'Unknown log level '%s'UsageUsage: nmcli agent all { help }

Runs nmcli as both NetworkManager secret and a polkit agent.

Usage: nmcli agent polkit { help }

Registers nmcli as a polkit action for the user session.
When a polkit daemon requires an authorization, nmcli asks the user and gives
the response back to polkit.

Usage: nmcli agent secret { help }

Runs nmcli as NetworkManager secret agent. When NetworkManager requires
a password it asks registered agents for it. This command keeps nmcli running
and if a password is required asks the user for it.

Usage: nmcli agent { COMMAND | help }

COMMAND := { secret | polkit | all }

UsernameVLANVLAN connection %dVLAN idVPNVPN connectedVPN connectingVPN connecting (getting IP configuration)VPN connecting (need authentication)VPN connecting (prepare)VPN connection %dVPN connection failedVPN disconnectedWEP indexWEP key index1 (Default)WEP key index2WEP key index3WEP key index4WI-FIWPA & WPA2 EnterpriseWPA & WPA2 PersonalWWAN radio switchWarning: password for '%s' not given in 'passwd-file' and nmcli cannot ask without '--ask' option.
Wi-FiWi-FiAutomaticWi-FiClientWi-Fi radio switchWi-Fi securityNoneWiMAXWired connection %dWriting to %s failed: %s
XORactivatedactivatingadvertise, asleepauthautobytesconnectedconnected (local only)connected (site only)connectingconnecting (checking IP connectivity)connecting (configuring)connecting (getting IP configuration)connecting (need authentication)connecting (prepare)connecting (starting secondary connections)connectionconnection faileddeactivatingdefaultdevice '%s' not compatible with connection '%s'disableddisconnecteddisconnectingenabledenabled, field '%s' has to be alonefullinvalid IP address: %sinvalid field '%s'; allowed fields: %s and %s, or %s,%sinvalid priority map '%s'limitedmillisecondsmsneither a valid connection nor device givennevernew hostnamenmcli successfully registered as a NetworkManager's secret agent.
nmcli successfully registered as a polkit agent.
nmcli tool, version %s
nono (guessed)no active connection on device '%s'no active connection or deviceno device found for connection '%s'nonenot required, not saved, offonportalpreparingrunningsecondssetting not foundstartedteamd control failedunavailableunknownunknown device '%s'.unknown setting nameunmanagedwrong type; should be a list of strings.yesyes (guessed)Project-Id-Version: NetworkManager
Report-Msgid-Bugs-To: https://gitlab.freedesktop.org/NetworkManager/NetworkManager/issues
PO-Revision-Date: 2017-04-21 06:08-0400
Last-Translator: Copied by Zanata <copied-by-zanata@zanata.org>
Language-Team: gnome-l10n-gl@gnome.org
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Zanata 3.9.6
X-Project-Style: gnome
# Creado por NetworkManager
# Fusionado desde %s

%d (descoñecido)%s. Use --help para ver a lista das opcións válidas.
%u MHz%u Mb/s%u Mbit/s«%s» ten que estar só'%s' non entre [%s](por omisión)(ningún)(descoñecido)0 (NINGÚN)0 (desactivado)0 (ningún)Fallou a configuación do 802.1X supplicant802.1X supplicant desconectadoFallou o 802.1X supplicantO 802.1X supplicant votou demasiado tempo para autenticarse802.3adA (5 GHz)Fallou unha dependencia da conexiónProduciuse un problema coa Ethernet RFC 2684 sobre bridge ADSLFallou a conexión secundaria da conexión baseADSLARPPunto de accesoActivadoActivar unha conexiónRespaldo activoActivar detalles da conexiónAd-HocRede Ad-HocEngadirEngadir…EnderezosTempo de envecellamentoPermitir o control das conexións de redeMétodos de autenticación permitidos:Un enderezo http(s) para comprobar a conectividade a internetTen certeza que quere eliminar a conexión «%s»?Preguntar por esta contrasinal cada vezAutenticaciónA rede sen fíos require autenticaciónErro no servizo AutoIPO servizo AutoIP fallouO servizo AutoIP fallou ao iniciarAutomáticoAutomático (só DHCP)Conectar automaticamenteDispoñíbel para todos os usuariosB/G (2.4 GHz)BONDBRIDGEBSSIDBondConexión Bond %dBridgeConexión Bridge %dBroadcastCHAPCancelarCambiou o «carrier»/ligazónCanleClonar enderezo MACO peche de %s fallou: %s
Localización do ficheiro de configuraciónConectadoConectandoConectando…Conexión «%s» (%s) eliminada con éxito.
A conexión xa está activaDetalles do perfíl da conexiónConexión compartida a través dunha rede Wi-Fi protexidaConexión compartida a través dunha rede Wi-Fi abertaConexión activada con éxito (ruta activa de D-Bus: %s)
Non foi posíbel activar a conexión: %sNon foi posíbel contactar con NetworkManager: %s.
Non foi posíbel crear o daemon: %s [error %u]
Non puido ser decodificada a chave privada.Non foi posíbel eliminar a conexión «%s»: %sNon foi posíbel xerar datos aleatorios.Non foi posíbel analizar os argumentosNon fo posíbel decodificar o ficheiro PKCS#12: %dNon foi posíbel decodificar o ficheiro PKCS#12: %sNon foi posíbel decodificar o ficheiro PKCS#8: %sNon foi posíbel decodificar o certificado: %dNon se puido decodificar o certificado: %sNon foi posíbel iniciar o decodificador PKCS#12: %dNon foi posíbel iniciar o decodificador PKCS#12: %sNon foi posíbel iniciar o decodificador PKCS#8: %sNon foi posíbel verficar o ficheiro PKCS#12: %dNon foi posíbel verificar o ficheiro PKCS#12: %sCrearFallou a configuración de DCB ou FCoE Erro no cliente DHCPO cliente DHCP fallouO cliente DHCP fallou ao iniciarServidores DNSDSLConexión DSL %dDatagramaDesactivadoEliminarDestinoDispositivoÉxito: «%s» activado con éxito con «%s».
Detalles do dispositivoDispositivo desconectado polo usuario ou clienteO dispositivo agora está xestionadoO dispositivo está agora non xestionadoDesactivadoNon converter en daemonNon imprimir nadaEAPETHERNETEditar unha conexiónEditar…Activar STP (Spanning Tree Protocol)Activar ou desactivar os dispositivos Wi-FiActivar ou desactivar os dispositivos de banda larga móbil WIMAXActivar ou desactivar os dispositivos de banda ancha móbilesActivar ou desactivar a rede do sistemaIntroduza o tipo de conexión:Produciuse un erro ao iniciar a certificación dos datos: %sProduciuse un erro ao actualizar os segredos para %s: %s
Erro: %s - non existe o perfíl de conexión.Erro: falta o argumento %sErro: %s.Erro: %s: %s.Erro: falta o argumento «%s».Erro: «%s» non é un modo de monitorización válido; use «%s» ou «%s».
Erro: «%s» non é un argumento válido para a opción «%s».Erro: «dev show»: %sErro: «device status»: %sErro: 'rexistro xeral': %sErro: «permisos xerais»: %sErro: non foi posíbel atopar o punto de acceso con bssid «%s».Erro: BSSID ao que conectar (%s) difire do argumento bssid (%s).Erro: Produciuse un fallo ao activar a conexión: %sErro: O dispositivo «%s» non é un dispositivo Wi-Fi.Erro: Non é posíbel encontrar o dispositivo %s.Erro: NetworkManager non está a funcionar.Erro: Non se atopou o dispositivo Wi-Fi.Erro: Non foi posíbel atopar o punto de acceso con BSSID «%s».Error: no se atopou a rede co SSID «%s».Erro: A opción «%s» é descoñecida, tente «nmcli --help»Erro: A opción «--pretty» é mutuamente exclusiva con «--terse».Erro: A opción «--pretty» especifícase en segundo lugar.Erro: A opción «--terse» é mutuamente exclusiva con «--pretty».Erro: A opción «--terse» especifícase en segundo lugar.Erro: o parámetro «%s» non é SSID ou BSSID.Erro: falta o SSID ou o BSSIDErro: Alcanzouse o tempo de espera de %d segundos.Erro: O valor do argumento bssid «%s» non é un BSSID válido.Erro: parámetro adicional non válido: «%s».Erro: falta o argumento para a opción «%s».Erro: produciuse un fallo ao iiniciar o xecte de plkit: %sErro: produciuse un fallo ao iniciar do axente secretoErro: o valor do argumento wep-key-type «%s» non é válido, use «key» ou «phrase»EthernetDispositivo EthernetSaír inmediatamente de NetworkManager se non está a funcionar.Produciuse un erro ao descifrar a chave privada PKCS#8.Fallou ao decodificar o certificadoProduciuse un erro ao descifrar a chave privadaProduciuse un erro ao descifrar a chave privada: %d.Produciuse un erro ao descifrar a chave privada: os datos descifrados son moi grandes.Produciuse un fallo ao descifrar a chave privada: lonxitude de desprazamento non esperada.Produciuse un erro ao cifrar: %d.Produciuse un erro ao finalizar o descifrado da chave privada: %d.Produciuse un fallo ao buscar a etiqueta de finalización «%s» de PKCS#8.Produciuse un fallo ao buscar a etiqueta de inicio «%s» de PKCS#8.Produciuse un erro ao iniciar o motor de cifradoProduciuse un erro ao iniciar o motor de cifrado:%d.Produciuse un erro ao iniciar a rañura de cifrado para o descifradoProduciuse un erro ao iniciar o contexto de descifrado.Produciuse un erro ao inicializar a rañura da cifra de cifrado.Produciuse un erro ao inicializar o contexto de cifrado.Produciuse un fallo ao rexistrarse na rede solicitadaProduciuse un fallo ao seleccionar o APN especificadoProduciuse un erro ao establecer IV para o descifrado.Produciuse un erro ao establecer IV para o cifrado.Produciuse un erro ao establecer a chave simétrica para o descifrado.Produciuse un erro ao establecer a chave simétrica para o cifrado.GRUPORequírese o PIN do SIM do módem GSMRequírese o PUK do SIM do módem GSMA tarxeta SIM do módem GSM non está insertadaSIM do modem GSM incorrectaGVRP, PasarelaHello timeOcultarNome do equipoINFINIBANDNon foi posíbel reservar a configuración de IP (enderezo non dispoñíbel, tempo de espera esgotado, etc)CONFIGURACIÓN IPv6IV contén díxitos non hexadecimais.IV debe ter un número par de bytes en lonxitude.IdentidadeIgnorarIgorar automaticamente as rutas obtidasInfiniBandConexión InfiniBand %dO dispositivo InfiniBand non admite o modo conectadoInfraInterface(s): Interface: Opción incorrecta.  Use --help para ver a lista de opcións válidas.ChaveLEAPLOOSE_BINDING, Monitorización da ligazónLigazón-localLista de engadidos separados por «,»MII (recomendado)MSCHAPMSCHAPv2MTUFacer todos os avisos fataisFicheiro PEM malformado: Proc-Type non é a segunda etiqueta.Ficheiro PEM malformado: Proc-Type non é a primeira etiqueta.Ficheiro PEM malformado: formato de IV incorrecto na etiqueta DEK-InfoFicheiro PEM malformado: non se atopou ningún IV na etiqueta DEK-InfoO ficheiro PEM é erróneo: a etiqueta Proc-Type «%s» é descoñecida.Ficheiro PEM malformado: o cifrado da chave privada «%s» é descoñecidoManualIdade máximaMétricaBanda larga móbilConexión de banda larga móbil %dModoFallou o modem ou non está dispoñíbelFallou a inicialización do módemO módem está agora listo e dispoñíbelModemManager non está dispoñíbelModificar as conexións de rede para tódolos usuariosModificar o nome persistente do anfitrión do sistemaModificar as conexións de rede persoaisMonitorizar frecuenciaN/DÉ preciso o firmware que poida que falte para o dispositivoRexistro na rede rexeitadoO rexistro na rede superou o tempo de esperaNetworkManager TUIO perfiles de NetworkManager activosPerfiles de conexión de NetworkManagerNetworkManager non está executándose.Rexistro de NetworkManagerNetworkManager monitoriza todas as redes e selecciona automaticamente
a mellor conexión para o seu uso. Tamén lle permite ao usuario
especificar puntos de accceso sen fíos aos que se asociarán as 
tarxetas sen fíos neste computador.Permisos de NetworkManagerEstado de NetworkManagerNetworkManager púxose a durmirNunca usar esta rede para a ruta por omisiónNova conexiónA nova activación de conexión foi engadida á colaSeguinte HopNon foi posíbel estabelecer o «carrier»Non se definiron rutas personalizadas.Non hai ton de chamadaNon se dou unha razónNon existe a conexión «%s»Non está buscando por redesOLPC MeshUnha ruta personalizada%d rutas personalizadasSistema abertoA apertura de %s fallou: %s
PAPO certificado PEM non ten etiqueta de finalización «%s».O certificado PEM non ten etiqueta de inicio «%s».O ficheiro de chave PEM non ten a etiqueta de final «%s».Produciuse un fallo na comprobación do PINCONFIGURACIÓN PPPPPP fallouO servizo PPP está desconectadoO servizo PPP fallou ao iniciarPPPoEPaiContrasinalO contrasinal de estar en UTF-8Contrasinal fornecido, máis a chave non está cifrada.Seleccione unha opciónPrefixoPrimarioImprimir a versión de NetworkManager e saírContrasinal da chave privadaNome da propiedade?Poñer o NetworkManager en suspensión e espertalo (só debe ser usado polo sistema de xestión de rede)SaírREORDER_HEADERS, EliminarRound-robinEnrutadoO PIN da SIM é incorrectoSSIDDominios de buscaRequírense os segredos, pero non se forneceronSeguranzaSeleccoine o tipo de conexión que quere crear.Seleccoine o tipo de conexión escrava que quere engadir.Seleccionar…ServizoEstabelecer o nome do equipoNome do equipo estabelecido a «%s»Estabelecer o nome do equipo do sisetmaNome da preferencia?CompartidoChave compartidaO servizo de conexión compartida fallouO servizo de conexión compartida fallou ao iniciarMostrarMostrar contrasinalEscravosEspecifique a localización do ficheiro PIDLocalización do ficheiro de estadoEstado dos dispositivosÉxitoA normativa do sistema evita o control das conexións de redeA normativa do sistema evita a activación e desactivación dos dispositivos Wi-FiA normativa do sistema evita activar ou desactivar os dispositivos de banda larga móbil WIMAX.A normativa do sistema evita a activación ou desactivación dos dispositivos de banda ancha.A normativa do sistema evita a activación ou desactivación da rede do sistemaA política do sistema impide a modificación da configuración da rede para tódolos usuariosA política do sistema impide a modificación da configuración persoal da redeA política do sistema impide a modificación do nome do anfitrión do sistemaA normativa do sistema evita poñer o NetworkManager en suspensión ou espertaloA política do sistema impide compartir conexións a través dunha rede Wi-Fi protexidaA política do sistema impide compartir conexións a través dunha rede Wi-Fi abertaTEAMTeamConexión Team %dFallou a conexión de Bluetooth ou superouse o tempo máximo de esperaA configuración IP xa non é válidaNon foi posíbel atopar a rede Wi-FiO dispositivo non puido lerse para a súa configuraciónA xestión do pai do dispositivo cambiouO dispositivo eliminouseA conexión de rede activa do dispositivo desapareceuA conexión existente do dispositivo foi asumidaO pai do dispositivo cambiouFallou o intento de marcadoTempo de espera superado na solicitude de marcadoO inicio agardado da respostaO intervalo entre as comprobacións de conectividade (en segundos)A liña está ocupadaNon foi posíbel atopar o módemO «supplicant» está agora activadoModo de transporteNon foi posíbel eliminar a conexión: %sNon foi posíbel determinar o tipo de chave privadaTamaño non agardado de datos despois de cifrar.DescoñecidoErro descoñecidoDominio de rexistro «%s» descoñecidoNivel de rexistro «%s» descoñecidoUsoUso: nmcli agent all { help }

Executa nmcli como un axente secreto e un polkit de NetworkManager.

Uso: nmcli agent polkit { help }

Rexistra nmcli como unha acción de polkit para a sesión do usuario.
Cando un daemon de polkit require autorización, nmcli preguntaralle ao usuario
e daralle a resposta de volta a polkit.

Uso: nmcli agent secret { help }

Executa nmcli como o axente secreto de NetworkMnager. Cando NetworkManager require
un contrasinal pregunta por axentes rexistrados por el. Esta orde mantén nmcli 
executándose e se se require un contrsinal pregúntalle ao usuario por ela.
Uso: nmcli agent { ORDE | help}

ORDE := { secret | polkit | all}

Nome de usuarioVLANConexión VLAN %dVLAN idVPNConectado á VPNConexión VPNConectándose á VPN (obtendo a configuración de IP)Conexión VPN (requírese autenticación)Conectándose á VPN (preparando)Conexión VPN %dProduciuse un fallo ao conectarse á VPNDesconectado á VPNÍndice WEP 1 (Predeterminada)234WIFIWPA & WPA2 EmpresarialPersonal WPA & WPA2Conmutador da radio do WWANAviso: o contrasinal para «%s» non está fornecido en «passwd-file» e nmcli non pode preguntar sen unha opción «--ask».
WifiAutomáticoClienteConmutador da radio da WifiNingunhaWiMAXConexión cableada %dA escritura de %s fallou: %s
XORactivadaactivandopublicitar,dormidoauthautomáticobytesconectadoconectado (só local)conectado (só o sitio)conectandoconectando (comprobando conectividade IP)conectando (configurando)conectando (obtendo a configuración IP)conectando (precisa autenticación)conectando (preparando)conectando (iniciando conexións secundarias)conexiónproduciuse un fallo na conexióndesactivandopor omisióno dispositivo «%s» non é compatíbel coa conexión «%s»desactivadodesconectadodesconectandoactivadoactivado,o campo «%s» ten que estar sócompletoenderezo IP non válido: %scampo «%s» non válido: campos permitidos: %s e %s, ou %s,%smapa de prioridade «%s» non válidalimitadomsnon se forneceu unha conexión válida nin un dispositivonuncanovo nome de equiponmcli rexistrado con éxito como axente secreto de NetworkManager.
nmcli rexistrado con éxito como un axente de polkit.
ferramenta nmcli, versión %s
nonnon (adiviñado)non hai conexións activas no dispositivo «%s»non hai conexións activas ou dispositivonon foi posíbel encontrar un dispositivo para a conexión «%s»ningunanon requirido,non gardado,desactivadoactivadoPortalpreparandoen execuciónsegundosconfiguración non atopadainiciadoFallou o control de teamdnon dispoñíbeldescoñecidodispositivo descoñecido «%s»nome da configuración descoñecidonon xestionadatipo incorrecto; debería ser unha lista de cadeas.sisí (adiviñado)PK�m�\?���LC_MESSAGES/gnupg2.monu�[������L
3|H#-I#w#�$�$�$�$�$%(%DE%.�%I�%& &:&W&t&�&�&�&�&$�&&',D'q'�'�'�'�'�'](e(�(�(�(�(�())";)%^)&�)!�)%�)"�)#*':* b*�*�*�*�*�*�*(+$9+^+s+#�+�+�+�+,& ,%G,,m,'�,H�,--%--C-0q-.�-�-�-3�-4'.-\..�.�.	�.
�.:�./3/#O/&s/&�/�/�/G�/@'0>h0+�0=�01"!1:D11�1�1-�1
�1#�12"2�>2E�23;3V3u3�3�3�3�3�3
4 404B4%Y44 �4(�4 �4
�4�45#555O5"j5�5�5�5E�5 "6cC6#�6-�6)�6�#78
9&9/9H91T9(�9�9�9 �9}	:�;/�;�;�;�;<9%<5_<.�<�<�<�<!
=/=N=a=~=+�=�= �=�=
>%%>K>e>r�>1X?=�?I�?4@G@#f@?�@D�@1A%AAHgA-�AH�A�'B�BB�B)CC9C.}CF�C�C*�D1E#QE2uE=�E0�E"F&:F%aF,�F5�F�F�F_GkGxG�GS�G5�G4HTHcH
xH�H
�H�H�H�H�HI"I)IBI%`I2�I5�I�I;J<>J{J�J&�J�J-�J(K;KQK1mK�K�K�K�K�KL+LIL_LvL�L�L$�L%�LM*MAM]MiMK�M%�M$�M@N\N!tN�N�N�N%�N%�N$O?O.VO�O�O�O�O�O$P&,P$SPxP�P�PG�PH�PB3QvQ�Q�Q�Q�Q
R)R	?RIRdR}R�R�R�R'�RS$S(3S\S_S
}S�S�S�S&�S�S�S!T.TLTaT%�T�T&�T)�TU0UKUkU�U�U�U"�U�U*V!;V$]V�V�V�VI�V�V�V#W#2WVWkW
�W�W#�W�W3�W%X%>XdXxX
�X�X�X"�X�X�X �X5Y$OYtY4�Y%�Y*�Y0ZFZ.OZ*~Z��Z+:[/f[%�[-�[/�[,\"G\)j\�\�\ �\�\	]#&]-J]x]�]#�] �]�]�]^$^6<^ s^�^�^�^-�^�^_3_K_^_a_7e_ �_$�_�_'`q+`:�a'�acc4cPclc�c�cA�c4dK7d�d"�d�d�d"�d e:eTene&�e(�e/�e#f/f Ffgf"yf!�fo�f!.gPg gg�g*�g�g�gh&#h+Jh2vh3�h0�h)i(8i1ai-�i'�i+�i7jMj5bj�j0�j0�j)k5k5Nk �k-�k-�kl, l-Ml6{l'�lG�l
"m0m)=m,gm,�m+�m)�mn> n?_n7�n3�noo
 o@.o"oo"�o(�o*�o,	p6pMpDVp:�p6�p4
q:Bq}q#�qE�q!�qr7r2Qr�r�r�r6�r��rFzs$�s�s"t't!@tbt"yt �t�t�t�tu*#u8Nu�u$�u&�u)�u
vv+vHv%dv%�v$�v�v�v 
wH+w2twn�w&x,=x1jx��x�y"�z
�z$�z�z?�z2>{q{)�{&�{��{"w}>�}�}�}
~#~6<~7s~'�~�~�~&C`v
�6�$�4�$3�!X�(z����À�W�5�G�Qf�8��8�)*�JT�^��+��3*�C^�6��Kل�%���G؅3 �IT�2��Sц!%�*G�6r�+��7ՈH
�PV�&��,Ή'��(#�7L�����k��
�)�	9�\C�E��<�)#�!M�o���
��&��%Ռ!��#�A�_�$g�6��8ÍA��B>���F��Q� 2�S�.i�)��A'�,�"C�Df�#��ϐ��)�E�^�~�#����ˑ�&�!+� M�n�#����'��l�;T�0��H��
�#&�J�&S�z�M��2�)�#>�8b�+��(Ǖ&�&�&>�/e�3��.ɖ���#�N5�O��gԗ.<�2k�0��*Ϙ1��&,�S�q�*��!��!ԙ%���;�1X�*����'ƚ�#�
�1 �R�6Z�0��›ٛ-�(�H�7d�@��ݜ*��1'�#Y�!}�%��'ŝ�#�(/�&X��7��*Ԟ0��0�	3�=�QO�����"џ!��2�H�$W�-|���DȠ3
�2A�!t�������ס$��	/�'9�Ma�,��&ܢ@�'D�2l�4��
ԣ9ߣ4��N�5�7*�,b�9��Fɥ;�=L�J��<զ-�8@�9y�5��*�4�'I�q�'~�1��ب'���:�AW�'����ȩ.�=�!M�*o�����ت۪D�/'�2W�*��6��Px�o>Q��S[i����.�
��]o�lTF=,�����t��Or&�b��Y^�v����s�q(y�D�
WW��<���H����5Z��\�n�+�z�,t"���L�e~�%���M�Q3�g0I*LJA(�h�w6�cE$}��FH�84r��e�]42���-%��D2k�)}g�1#�/n�$�@��1S�XRN:R�\-fX�J�d�8b�E��A ��i���f�B'�K=;?���k��v����#7+.�7��O��{)m�Ca��_aPq?��&�l<��pc�V@*�����|�_�	Z9�0s!h��^�����>p[G�M��
`3��uY�`	�!���������
"T�{j;/UB���65G����j�y��C~�K:9d IuzV����U�N�mw���'��x|
Enter the user ID.  End with an empty line: 
Pick an image to use for your photo ID.  The image must be a JPEG file.
Remember that the image is stored within your public key.  If you use a
very large picture, your key will become very large as well!
Keeping the image close to 240x288 is a good size to use.

Supported algorithms:
              imported: %lu             unchanged: %lu
           new subkeys: %lu
          new user IDs: %lu
          not imported: %lu
          w/o user IDs: %lu
         It is not certain that the signature belongs to the owner.
         The signature is probably a FORGERY.
         There is no indication that the signature belongs to the owner.
        new signatures: %lu
      Subkey fingerprint:      secret keys read: %lu
      skipped new keys: %lu
     Subkey fingerprint:   (%d) DSA (sign only)
   (%d) RSA (encrypt only)
   (%d) RSA (sign only)
   (0) I will not answer.%s
   (1) I have not checked at all.%s
   (2) I have done casual checking.%s
   (3) I have done very careful checking.%s
   new key revocations: %lu
  Unable to sign.
  secret keys imported: %lu
 (non-exportable) Primary key fingerprint: secret keys unchanged: %lu
# List of assigned trustvalues, created %s
# (Use "gpg --import-ownertrust" to restore them)
%s does not yet work with %s
%s encrypted data
%s encrypted session key
%s encryption will be used
%s makes no sense with %s!
%s not allowed with %s!
%s/%s encrypted for: "%s"
%s: directory does not exist!
%s: error reading free record: %s
%s: error reading version record: %s
%s: error updating version record: %s
%s: error writing dir record: %s
%s: error writing version record: %s
%s: failed to append a record: %s
%s: failed to create hashtable: %s
%s: failed to create version record: %s%s: failed to zero a record: %s
%s: invalid file version %d
%s: invalid trustdb
%s: invalid trustdb created
%s: keyring created
%s: not a trustdb file
%s: skipped: %s
%s: skipped: public key already present
%s: skipped: public key is disabled
%s: trustdb created
%s: unknown suffix
%s: version record with recnum %lu
%s:%d: deprecated option "%s"
%s:%d: invalid export options
%s:%d: invalid import options
(No description given)
(Probably you want to select %d here)
(This is a sensitive revocation key)
(unless you specify the key by fingerprint)
--output doesn't work for this command
@
(See the man page for a complete listing of all commands and options)
@
Options:
 @Commands:
 ASCII armored output forced.
Are you sure you still want to add it? (y/N) Are you sure you still want to revoke it? (y/N) Are you sure you still want to sign it? (y/N) Can't check signature: %s
CancelCertificates leading to an ultimately trusted key:
Change (N)ame, (C)omment, (E)mail or (O)kay/(Q)uit? Change (N)ame, (C)omment, (E)mail or (Q)uit? Changing expiration time for the primary key.
Cipher: Comment: Compression: Create a revocation certificate for this signature? (y/N) Critical signature notation: Critical signature policy: Delete this good signature? (y/N/q)Delete this invalid signature? (y/N/q)Delete this unknown signature? (y/N/q)Detached signature.
Digest: Do you want to issue a new signature to replace the expired one? (y/N) Do you want to promote it to a full exportable signature? (y/N) Do you want to promote it to an OpenPGP self-signature? (y/N) Do you want to sign it again anyway? (y/N) Do you want your signature to expire at the same time? (Y/n) Email address: Enter JPEG filename for photo ID: Enter an optional description; end it with an empty line:
Enter new filenameEnter passphrase
Enter passphrase: Enter the user ID of the designated revoker: Features: Go ahead and type your message ...
Hash: Hint: Select the user IDs to sign
How carefully have you verified the key you are about to sign actually belongs
to the person named above?  If you don't know what to answer, enter "0".
IDEA cipher unavailable, optimistically attempting to use %s instead
Invalid character in comment
Invalid character in name
Invalid command  (try "help")
Invalid selection.
Is this photo correct (y/N/q)? Key available at: Key generation canceled.
Key generation failed: %s
Key has been compromisedKey is no longer usedKey is revoked.Key is supersededKey is valid for? (0) Key not changed so no update needed.
KeyringName may not start with a digit
Name must be at least 5 characters long
Need the secret key to do this.
NnCcEeOoQqNo help availableNo reason specifiedNo such user ID.
No user ID with index %d
Not a valid email address
Note: This key has been disabled.
Note: This key has expired!
Nothing deleted.
Please correct the error first
Please don't put the email address into the real name or the comment
Please enter name of data file: Please note that the shown key validity is not necessarily correct
unless you restart the program.
Please select exactly one user ID.
Please select the reason for the revocation:
Please select what kind of key you want:
Please specify how long the key should be valid.
         0 = key does not expire
      <n>  = key expires in n days
      <n>w = key expires in n weeks
      <n>m = key expires in n months
      <n>y = key expires in n years
Please specify how long the signature should be valid.
         0 = signature does not expire
      <n>  = signature expires in n days
      <n>w = signature expires in n weeks
      <n>m = signature expires in n months
      <n>y = signature expires in n years
Primary key fingerprint:Pubkey: Public key is disabled.
Real name: Really create the revocation certificates? (y/N) Really delete this self-signature? (y/N)Reason for revocation: %s
Requested keysize is %u bits
Revocation certificate created.
Revocation certificate created.

Please move it to a medium which you can hide away; if Mallory gets
access to this certificate he can use it to make your key unusable.
It is smart to print this certificate and store it away, just in case
your media become unreadable.  But have some caution:  The print system of
your machine might store the data and make it available to others!
Secret key is available.
Secret parts of primary key are not available.
Signature expired %s
Signature expires %s
Signature notation: Signature policy: The self-signature on "%s"
is a PGP 2.x-style signature.
There are no preferences on a PGP 2.x-style user ID.
This command is not allowed while in %s mode.
This key belongs to us
This key has been disabledThis key has expired!This key is due to expire on %s.
This signature expired on %s.
To be revoked by:
Total number processed: %lu
UncompressedUsage: gpgv [options] [files] (-h for help)User ID "%s" is expired.User ID "%s" is not self-signed.User ID "%s" is revoked.User ID is no longer validWARNING: "%s" is a deprecated option
WARNING: %s overrides %s
WARNING: This is a PGP 2.x-style key.  Adding a designated revoker may cause
         some versions of PGP to reject this key.
WARNING: This is a PGP2-style key.  Adding a photo ID may cause some versions
         of PGP to reject this key.
WARNING: This key has been revoked by its owner!
WARNING: This key is not certified with a trusted signature!
WARNING: This key is not certified with sufficiently trusted signatures!
WARNING: This subkey has been revoked by its owner!
WARNING: Using untrusted key!
WARNING: We do NOT trust this key!
WARNING: a user ID signature is dated %d seconds in the future
WARNING: appointing a key as a designated revoker cannot be undone!
WARNING: encrypted message has been manipulated!
WARNING: invalid notation data found
WARNING: message was encrypted with a weak key in the symmetric cipher.
WARNING: message was not integrity protected
WARNING: multiple signatures detected.  Only the first will be checked.
WARNING: no user ID has been marked as primary.  This command may
              cause a different user ID to become the assumed primary.
WARNING: nothing exported
WARNING: potentially insecure symmetrically encrypted session key
WARNING: program may create a core file!
WARNING: recipients (-r) given without using public key encryption
WARNING: signature digest conflict in message
WARNING: unable to %%-expand notation (too large).  Using unexpanded.
We need to generate a lot of random bytes. It is a good idea to perform
some other action (type on the keyboard, move the mouse, utilize the
disks) during the prime generation; this gives the random number
generator a better chance to gain enough entropy.
You are about to revoke these signatures:
You can't change the expiration date of a v3 key
You can't delete the last user ID!
You did not specify a user ID. (you may use "-r")
You may not add a designated revoker to a PGP 2.x-style key.
You may not add a photo ID to a PGP2-style key.
You must select at least one key.
You must select at least one user ID.
You selected this USER-ID:
    "%s"

Your current signature on "%s"
has expired.
Your current signature on "%s"
is a local signature.
Your decision? Your selection? Your system can't display dates beyond 2038.
However, it will be correctly handled up to 2106.
[revocation][self-signature][uncertain]a notation name must have only printable characters or spaces, and end with an '='
a notation value must not use any control characters
a user notation name must contain the '@' character
add a photo IDadd a revocation keyadd a user IDarmor header: armor: %s
assume no on most questionsassume yes on most questionsassuming %s encrypted data
batch mode: never askbe somewhat more quietbinarybuild_packet failed: %s
can't disable core dumps: %s
can't handle public key algorithm %d
can't handle text lines longer than %d characters
can't use a symmetric ESK packet due to the S2K mode
cancelled by user
cannot appoint a PGP 2.x style key as a designated revoker
cannot avoid weak key for symmetric cipher; tried %d times!
change the ownertrustchange the passphrasechecking created signature failed: %s
checking the trustdb
cipher algorithm %d%s is unknown or disabled
completes-needed must be greater than 0
conflicting commands
create ascii armored outputdata not saved; use option "--output" to save it
dearmoring failed: %s
decrypt data (default)decryption failed: %s
decryption okay
deleting keyblock failed: %s
do not make any changesdon't use the terminal at allenable full debuggingenarmoring failed: %s
encrypt dataencrypted with %lu passphrases
encrypted with 1 passphrase
encrypted with unknown algorithm %d
encryption only with symmetric ciphererror creating passphrase: %s
error in trailer line
error reading keyblock: %s
export keysexport keys to a keyserverexternal program calls are disabled due to unsafe options file permissions
failed to initialize the TrustDB: %s
failed to rebuild keyring cache: %s
forcing symmetric cipher %s (%d) violates recipient preferences
generate a new key pairgenerate a revocation certificateiImMqQsSimport keys from a keyserverimport/merge keysinput line %u too long or missing LF
input line longer than %d characters
invalid S2K mode; must be 0, 1 or 3
invalid armor header: invalid armor: line longer than %d characters
invalid clearsig header
invalid dash escaped line: invalid default preferences
invalid export options
invalid import options
invalid personal cipher preferences
invalid personal compress preferences
invalid personal digest preferences
invalid value
keykey export failed: %s
key has been created %lu second in future (time warp or clock problem)
key has been created %lu seconds in future (time warp or clock problem)
key is not flagged as insecure - can't use it with the faked RNG!
keyserver receive failed: %s
keyserver refresh failed: %s
keyserver search failed: %s
keyserver send failed: %s
keysize invalid; using %u bits
keysize rounded up to %u bits
list key and user IDslist keyslist keys and fingerprintslist keys and signatureslist preferences (expert)list preferences (verbose)list secret keysmake a detached signaturemake timestamp conflicts only a warningmake_keysig_packet failed: %s
malformed CRC
marginals-needed must be greater than 1
nNnested clear text signatures
never     next trustdb check due at %s
nono need for a trustdb check
no remote program execution supported
no secret key
no signed data
no ultimately trusted keys found
no valid OpenPGP data found.
no valid addressees
no writable keyring found: %s
no writable public keyring found: %s
not a detached signature
okay, we are the anonymous recipient.
old encoding of the DEK is not supported
old style (PGP 2.x) signature
original file name='%.*s'
ownertrust information cleared
please do a --check-trustdb
please use "%s%s" instead
premature eof (in CRC)
premature eof (no CRC)
problem handling encrypted packet
prompt before overwritingpublic and secret key created and signed.
public key decryption failed: %s
public key encrypted data: good DEK
qQquitquit this menuquoted printable character in armor - probably a buggy MTA has been used
reading stdin ...
reason for revocation: remove keys from the public keyringremove keys from the secret keyringrevocation comment: rounded up to %u bits
save and quitsearch for keys on a keyserversecret key parts are not available
select user ID Nselected certification digest algorithm is invalid
selected cipher algorithm is invalid
selected digest algorithm is invalid
set debugging flagsshow this helpsign a keysign a key locallysign or edit a keysignature verification suppressed
signing failed: %s
signing:skipped: public key already set
skipped: public key already set as default recipient
skipped: secret key already present
skipping block of type %d
standalone revocation - use "gpg --import" to apply
standalone signature of class 0x%02x
subpacket of type %d has critical bit set
system error while calling external program: %s
textmodethe given certification policy URL is invalid
the given signature policy URL is invalid
the signature could not be verified.
Please remember that the signature file (.sig or .asc)
should be the first file given on the command line.
there is a secret key for public key "%s"!
this may be caused by a missing self-signature
this message may not be usable by %s
trust record %lu is not of requested type %d
trust record %lu, req type %d: read failed: %s
trust record %lu, type %d: write failed: %s
trustdb rec %lu: lseek failed: %s
trustdb rec %lu: write failed (n=%d): %s
trustdb transaction too large
trustdb: lseek failed: %s
trustdb: read failed (n=%d): %s
trustdb: sync failed: %s
unable to display photo ID!
unable to execute external program
unable to read external program response: %s
unable to set exec-path to %s
unknownunnatural exit of external program
update all keys from a keyserverupdate failed: %s
update the trust databaseuse as output fileuse canonical text modeuse option "--delete-secret-keys" to delete it first.
user ID "%s" is already revoked
verboseverify a signatureweak key created - retrying
weird size for an encrypted session key (%d)
writing direct signature
writing key binding signature
writing self signature
writing to stdout
yYyesyou cannot appoint a key as its own designated revoker
|FD|write status info to this FD|NAME|use NAME as default secret key|NAME|use cipher algorithm NAME|NAME|use message digest algorithm NAMEProject-Id-Version: gnupg 1.2.4
Report-Msgid-Bugs-To: translations@gnupg.org
POT-Creation-Date: 2020-03-20 15:40+0100
PO-Revision-Date: 2003-12-04 11:39+0100
Last-Translator: Jacobo Tarrio <jtarrio@trasno.net>
Language-Team: Galician <gpul-traduccion@ceu.fi.udc.es>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit

Introduza o ID de usuario. Remate cunha liña en branco: 
Escolla unha imaxe a empregar coma identificación fotográfica. A imaxe ten
que ser un ficheiro JPEG. Lembre que a imaxe armacénase coa súa chave
pública. Se emprega unha imaxe moi grande, a súa chave tamén se ha volver
moi grande. Un bo tamaño para empregar é un semellante a 240x288.

Algoritmos soportados:
           importadas: %lu          sin cambios: %lu
     novas sub-chaves: %lu
 novos IDs de usuario: %lu
       non importadas: %lu
   sin IDs de usuario: %lu
       Non é seguro que a sinatura pertenza ao seu propietario.
       Probablemente, a sinatura estea FALSIFICADA.
       Non hai indicacións de que a sinatura pertenza ao seu propietario.
         novas sinaturas: %lu
     Pegada dactilar da sub-chave:chaves secretas lidas: %lu
novas chaves omitidas: %lu
     Pegada dactilar da sub-chave:   (%d) DSA (só asinar)
   (%d) RSA (só cifrar)
   (%d) RSA (só asinar)
   (0) Non hei respostar.%s
   (1) Non o comprobei en absoluto.%s
   (2) Fixen algunhas comprobacións.%s
   (3) Fixen comprobacións moi exhaustivas.%s
 novas revocacións de chaves: %lu
 Non se puido asinar.
chaves secretas importadas: %lu
 (non exportable)Pegada dactilar da chave primaria:chaves secretas sin cambios: %lu
# Lista de valores de confianza asignados, creada o %s
# (Empregue "gpg --import-ownertrust" para restauralos)
¡%s aínda non traballa con %s!
datos cifrados con %s
chave de sesión cifrada con %s
hase empregar cifrado %s
¡%s non ten sentido empregándoo con %s!
¡%s non se admite con %s!
%s/%s cifrado para: "%s"
%s: ¡o directorio non existe!
%s: erro ao ler un rexistro libre: %s
%s: erro ao le-lo rexistro de versión: %s
%s: erro ao actualiza-lo rexistro de versión: %s
%s: erro ao escribi-lo rexistro de directorios: %s
%s: erro ao escribi-lo rexistro de versión: %s
%s: non se puido engadir un rexistro: %s
%s: fallo ao crear unha táboa hash: %s
%s: non se puido crea-lo rexistro de versión: %s%s: non se puido pór a cero un rexistro: %s
%s: versión do ficheiro incorrecta %d
%s: base de datos de confianza non válida
%s: creouse unha base de datos de confianza incorrecta
%s: chaveiro creado
%s: non é un ficheiro de base de datos de confianza
%s: omitido: %s
%s: omitido: a chave pública xa está presente
%s: omitido: a chave pública está desactivada
%s: creouse a base de datos de confianza
%s: sufixo descoñecido
%s: rexistro de versión con número de rexistro %lu
%s:%d: opción a extinguir "%s"
%s:%d: opcións de exportación non válidas
%s:%d: opcións de importación non válidas
(Non se deu unha descrición)
(probablemente queira seleccionar %d aquí)
(Esta é unha chave de revocación sensible)
(a menos que especifique a chave por pegada dactilar)
--output non traballa con este comando
@
(Vexa a páxina man para un listado completo de comandos e opcións)
@
Opcións:
 @Comandos:
 Forzouse unha saída con armadura ASCII.
¿Está seguro de que quere engadila? (s/N) ¿Está seguro de que quere revocala? (s/N) ¿Está seguro de que quere asinalo? (s/N) Non foi posible verifica-la sinatura: %s
CancelarCertificados que conducen a unha chave de confianza absoluta:
¿Cambiar (N)ome, (C)omentario, (E)-mail ou (A)ceptar/(S)aír? ¿Cambia-lo (N)ome, (C)omentario, (E)-mail ou (S)aír? Cambiando a data de expiración da chave primaria.
Cifra: Comentario: Compresión: ¿Crear un certificado de revocación para esta sinatura? (s/N) Notación de sinaturas críticas: Normativa de sinaturas críticas: ¿Borrar esta sinatura correcta? (s/N/q)¿Borrar esta sinatura incorrecta? (s/N/q)¿Borrar esta sinatura descoñecida? (s/N/q)Sinatura non adxunta.
Resumo: ¿Quere emitir unha nova sinatura que substitúa á caducada? (s/N) ¿Quere promovela a sinatura totalmente exportable? (s/N) ¿Quere promovela a unha auto-sinatura OpenPGP? (s/N) ¿Quere asinalo outra vez de tódolos xeitos? (s/N) ¿Quere que a súa sinatura caduque ao mesmo tempo? (S/n) Enderezo de E-mail: Introduza o nome do ficheiro JPEG: Introduza unha descrición opcional; remátea cunha liña en branco:
Introduza o novo nome de ficheiroIntroduza o contrasinal
Introduza o contrasinal: Introduza o ID de usuario do revocador designado: Características: Escriba a súa mensaxe ...
Hash: Pista: seleccione os IDs de usuario que desexa asinar
¿Con canto tino comprobou que a chave que vai asinar realmente pertence á
persoa de enriba? Se non sabe que respostar, introduza "0".
A cifra IDEA non está dispoñible, téntase empregar %s no seu canto
Carácter non válido no comentario
Caracter non válido no nome
Comando incorrecto (tente "help")
Selección non válida.
¿É esta foto correcta (s/N/q)? Chave dispoñible en: Cancelouse a xeración de chaves.
A xeración da chave fallou: %s
Esta chave quedou descobertaXa non se emprega esta chaveA chave está revocada.A chave é obsoleta¿Por canto tempo é válida a chave? (0) A chave non cambiou, polo que non fai falla actualizar.
ChaveiroO nome non pode comezar cun díxito
O nome debe ter alomenos 5 caracteres
Cómpre a chave secreta para facer isto.
NnCcEeAaSsNon hai axuda dispoñibleNon se especificou un motivoNon hai tal ID de usuario.
Non hai ID de usuario con índice %d
Non é un enderezo de e-mail válido
Nota: Esta chave está desactivada.
Nota: ¡Esta chave xa caducou!
Non se borrou nada.
Por favor, corrixa antes o erro
Por favor, non poña o enderezo de correo no nome real ou no comentario
Por favor, introduza o nome do ficheiro de datos: Teña en conta que a validez da chave amosada non é necesariamente
correcta a menos que reinicie o programa.
Escolla exactamente un ID de usuario.
Por favor, escolla o motivo da revocación:
Por favor, seleccione o tipo de chave que quere:
Por favor, indique canto tempo debería ser válida a chave.
         0 = a chave non caduca
      <n>  = a chave caduca en n días
      <n>w = a chave caduca en n semanas
      <n>m = a chave caduca en n meses
      <n>y = a chave caduca en n anos
Por favor, indique canto tempo debería ser válida a sinatura.
         0 = a sinatura non caduca
      <n>  = a sinatura caduca en n días
      <n>w = a sinatura caduca en n semanas
      <n>m = a sinatura caduca en n meses
      <n>y = a sinatura caduca en n anos
Pegada dactilar da chave primaria:Pública: A chave pública está desactivada.
Nome: ¿Realmente desexa crea-los certificados de revocación? (s/N) ¿Realmente quere borrar esta auto-sinatura? (s/N)Motivo para a revocación: %s
O tamaño de chave requerido son %u bits
Creouse o certificado de revocación.
Creouse o certificado de revocación.

Por favor, trasládeo a un soporte que poida agochar; se Mallory consegue
acceso a este certificado pode empregalo para inutiliza-la súa chave.
É unha boa idea imprimir este certificado e armacenalo, por se o soporte
se volve ilexible. Pero teña coidado: o sistema de impresión da súa
máquina podería armacena-los datos e deixárllelos dispoñibles a outros.
A chave secreta está disponible.
as partes secretas da chave primaria non están dispoñibles.
A sinatura caducou o %s
A sinatura caduca o %s
Notación de sinaturas: Normativa de sinaturas: A auto-sinatura de "%s"
é unha sinatura tipo PGP 2.x
Non hai preferencias nun ID de usuario estilo PGP 2.x.
Non se admite este comando no modo %s.
Esta chave perténcenos a nós
Esta chave está desactivada¡Esta chave caducou!Esta chave ha caducar o %s.
Esta sinatura caducou o %s.
Ha ser revocada por:
Número total procesado: %lu
Sen comprimirUso: gpgv [opcións] [ficheiros] (-h para ve-la axuda)O ID de usuario "%s" está caducado.O ID de usuario "%s" non está asinado por el mesmo.O ID de usuario "%s" está revocado.O ID de usuario xa non é válidoAVISO: "%s" é unha opción a extinguir
AVISO: %s fai que se ignore %s
AVISO: Esta é unha chave de estilo PGP 2.x. Se engade un revocador designado
       pode facer que algunhas versións de PGP rexeiten esta chave.
AVISO: Esta é unha chave de estilo PGP2. Se engade unha identificación
       fotográfica algunhas versións de PGP han rexeitar esta chave.
AVISO: ¡Esta chave está revocada polo propietario!
AVISO: ¡Esta chave non está certificada cunha sinatura de confianza!
AVISO: ¡Esta chave non está certificada con sinaturas de suficiente confianza!
AVISO: ¡Esta subchave está revocada polo propietario!
AVISO: ¡Emprégase unha chave que non é de confianza!
AVISO: ¡Esta chave NON é de confianza!
AVISO: unha sinatura de ID de usuario ten unha data %d segundos no futuro
AVISO: ¡o nomeamento dunha chave coma o seu propio revocador designado non se pode desfacer!
AVISO: ¡a mensaxe cifrada foi manipulada!
AVISO: atopáronse datos de notación non válidos
AVISO: cifrouse a mensaxe cunha chave feble no cifrado simétrico.
AVISO: a mensaxe non tiña protección de integridade
AVISO: detectáronse sinaturas múltiples. Só se ha comproba-la primeira.
AVISO: non se marcou ningún ID de usuario coma primario. Esta orde pode
              facer que un ID de usuario diferente se converta no primario.
AVISO: non se exportou nada
AVISO: chave de sesión cifrada simetricamente potencialmente insegura
AVISO: ¡o programa pode crear un ficheiro 'core'!
AVISO: deronse destinatarios (-r) sen empregar cifrado de chave pública
AVISO: conflicto de resumo de sinatura na mensaxe
AVISO: non se pode expandir-%% a notación (grande de máis). Úsase sen expandir.
Cómpre xerar unha morea de bytes aleatorios. E unha boa idea facer outras
cousas (premer teclas no teclado, move-lo rato, usa-los discos duros)
mentres se xeran os números primos; isto proporciónalle ao xerador de
números aleatorios unha opoertunidade de acumular entropía de abondo.
Está a punto de revocar estas sinaturas:
Non pode cambia-la data de expiración dunha chave v3
¡Non pode borra-lo último ID de usuario!
Non especificou un ID de usuario. (pode empregar "-r")
Non pode engadir un revocador designado a unha chave de estilo PGP 2.x.
Non pode engadir unha identificación fotográfica a unha chave de estilo PGP2.
Debe seleccionar alomenos unha chave.
Debe seleccionar alomenos un ID de usuario.
Escolleu este ID de usuario:
    "%s"

A súa sinatura actual en "%s"
caducou.
A súa sinatura actual en "%s"
é unha sinatura local.
¿A súa decisión? ¿A súa selección? O seu sistema non pode amosar datas máis aló do 2038.
Aínda así, hase tratar correctamente ata o 2106.
[revocación][auto-sinatura][incerto]un nome de notación só debe ter caracteres imprimibles ou espacios, e debe rematar en '='
un valor de notación non pode empregar ningún carácter de control
un nome de notación de usuario debe conte-lo carácter '@'
engadir unha identificación fotográficaengadir unha chave de revocaciónengadir un ID de usuariocabeceira de armadura: armadura: %s
asumir `non' na maioría das preguntasasumir `si' na maioría das preguntassupoñendo datos cifrados con %s
modo por lotes: non preguntar nuncaser un pouquiño máis caladobinarioa chamada a build_packet fallou: %s
non é posible deshabilita-los volcados de 'core': %s
non é posible manexa-lo algoritmo de chave pública %d
non é posible manexar liñas de texto maiores que %d caracteres
non se pode empregar un paquete simétrico ESK debido ao modo S2K
cancelado polo usuario
non se pode nomear unha chave estilo PGP 2.x coma revocador designado
non se pode evitar unha chave feble para o cifrado simétrico; tentouse %d veces
cambia-la confianza sobre o donocambia-lo contrasinalfallou a comprobación da sinatura creada: %s
comprobando a base de datos de confianza
o algoritmo de cifrado %d%s é descoñecido ou está desactivado
completes-needed debe ser superior a 0
comandos conflictivos
crear saída con armadura en asciios datos non foron gardados; use a opción "--output" para gardalos
non se puido quita-la armadura: %s
descifrar datos (por defecto)o descifrado fallou: %s
descifrado correcto
fallou o borrado do bloque de chaves: %s
non facer ningún cambionon usa-la terminal en absolutohabilitar depuración totalnon se puido poñe-la armadura: %s
cifrar datoscifrado con %lu contrasinais
cifrado con 1 contrasinal
cifrado cun algoritmo descoñecido %d
cifrar só con cifrado simétricoerro ao crea-lo contrasinal: %s
error nunha liña adicional
erro ao le-lo bloque de chaves: %s
exportar chavesexportar chaves a un servidor de chavesas chamadas a programas externos están desactivadas debido a opcións de permisos de ficheiros non seguras
non se puido inicializa-la base de datos de confianzas: %s
fallo ao reconstruí-la caché de chaveiros: %s
forza-la cifra simétrica %s (%d) viola as preferencias do destinatario
xerar un novo par de chavesxerar un certificado de revocacióniImMsSoOimportar chaves dun servidor de chavesimportar/mesturar chavesa liña de entrada %u é longa de máis ou fáltalle a marca de fin de liña
a liña de entrada contén máis de %d caracteres
modo S2K non válido; debe ser 0, 1 ou 3
cabeceira de armadura non válida: armadura incorrecta: liña máis longa ca %d caracteres
cabeceira de sinatura en claro non válida
liña escapada cunha barra non válida: preferencias por defecto non válidas
opcións de exportación non válidas
opcións de importación non válidas
preferencias de cifrado personais non válidas
preferencias de compresión personais non válidas
preferencias de resumo personais non válidas
valor non válido
chavea exportación da chave fallou: %s
creouse a chave %lu segundo no futuro (salto no tempo ou problemas co reloxo)
creouse a chave %lu segundos no futuro (salto no tempo ou problemas co reloxo)
a chave non está marcada coma insegura - non se pode empregar co xerador de números aleatorios falso
a recepción do servidor de chaves fallou: %s
a actualización no servidor de chaves fallou: %s
a busca no servidor de chaves fallou fallou: %s
o envío ao servidor de chaves fallou: %s
tamaño de chave non válido; empregando %u bits
tamaño de chave redondeado a %u bits
listar chave e IDs de usuariove-la lista de chavesve-la lista de chaves e pegadas dactilaresve-la lista de chaves e sinaturaslista-las preferencias (expertos)lista-las preferencias (moitos datos)ve-la lista de chaves secretasfacer unha sinatura separadaconverte-los conflictos de selo de data nun avisoa chamada a make_keysig_packet fallou: %s
CRC mal formado
marginals-needed debe ser superior a 1
nNsinaturas en texto claro aniñadas
nunca     hase comproba-la base de datos de confianza o %s
non|nomnon se precisa comproba-la base de datos de confianza
non se soporta a execución remota de programas
non hai chave secreta
non hai datos asinados
non se atoparon chaves de confianza absoluta
non se atoparon datos OpenPGP válidos.
non hai enderezos válidos
non se atopou un chaveiro no que se poida escribir: %s
non se atopou un chaveiro público no que se poida escribir: %s
non é unha sinatura separada
vale, nós somo-lo destinatario anónimo.
a codificación vella do DEK non está soportada
Sinatura ó vello estilo (PGP 2.x)
nome do ficheiro orixinal='%.*s'
borrouse a información de confianza
por favor, execute con --check-trustdb
empregue "%s%s" no seu canto
fin de ficheiro prematura (no CRC)
fin de ficheiro prematura (non hai CRC)
problema ao manexa-lo paquete cifrado
avisar antes de sobrescribircreáronse e asináronse as chaves pública e secreta.
fallou o descifrado de chave pública: %s
datos cifrados coa chave pública: DEK correcto
aAabandonarsaír deste menúcarácter quoted-printable na armadura - seguramente empregouse un MTA con erros
lendo de stdin ...
motivo para a revocación: borrar chaves do chaveiro públicoborrar chaves do chaveiro secretocomentario de revocación: redondeado a %u bits
gardar e saírbuscar chaves nun servidor de chaveshai partes da chave secreta non dispoñibles
selecciona-lo ID de usuario No algoritmo de resumo de certificación seleccionado non é válido
o algoritmo de cifrado seleccionado non é válido
o algoritmo de resumo seleccionado non é válido
axusta-los valores de depuraciónamosar esta axudaasinar unha chaveasinar unha chave localmenteasinar ou editar unha chaveverificación de sinatura suprimida
fallou a sinatura: %s
asinando:omitido: chave pública xa estabrecida
omitido: a chave pública xa está estabrecida coma destinatario por defecto
omítese: a chave secreta xa está presente
pasando por alto un bloque de tipo %d
revocación independente - empregue "gpg --import" para aplicar
sinatura independiente de clase 0x%02x
un subpaquete de tipo %d ten o bit crítico posto
erro do sistema ao chamar a un programa externo: %s
modo textoo URL de normativa de certificación dado non é válido
o URL de normativa de sinaturas dado non é válido
non se puido verifica-la sinatura.
Por favor, lembre que o ficheiro de sinatura (.sig ou .asc) debería
se-lo primeiro ficheiro que se indique na liña de comandos.
¡hai unha chave secreta para a chave pública "%s"!
isto pode ser causado por unha auto-sinatura que falta
esta mensaxe pode non ser utilizable por %s
o rexistro de confianza %lu non é do tipo %d solicitado
rexistro de confianza %lu, tipo da petición %d: fallou a lectura: %s
rexistro de confianza %lu, tipo %d: fallou a escritura: %s
rexistro da base de datos de confianza %lu: lseek fallou: %s
rexistro da base de datos de confianza %lu: fallou a escritura (n=%d): %s
transacción da base de datos de confianza demasiado grande
base de datos de confianza: lseek fallou: %s
base de datos de confianza: fallou a lectura (n=%d): %s
base de datos de confianza: fallou a sincronización: %s
¡non se pode amosa-la identificación fotográfica!
non se puido executar un programa externo
non se puido le-la resposta do programa externo: %s
non se puido estabrecer exec-path a %s
descoñecidosaída non natural do programa externo
actualizar tódalas chaves dun servidor de chavesa actualización fallou: %s
actualiza-la base de datos de confianzausar coma ficheiro de saídausar modo de texto canónicoempregue a opción "--delete-secret-keys" para borrala primeiro.
o ID de usuario "%s" xa está revocado
laretoverificar unha sinaturacreouse unha chave feble - volvendo a tentalo
tamaño moi estraño para unha chave de sesión cifrada (%d)
escribindo unha sinatura directa
escribindo unha sinatura que liga a chave
escribindo a propia sinatura
escribindo na saída estándar
sSsi|simnon se pode nomear unha chave coma o seu propio revocador designado
|DF|escribi-la información de estado a este DF|NOME|empregar NOME coma chave secreta por defecto|NOME|emprega-lo algoritmo de cifrado NOME|NOME|emprega-lo algoritmo de resumos de mensaxes NOMEPK�m�\&B��vxvxLC_MESSAGES/rhn-client-tools.monu�[�����.�	��`
a)l�L���	' 7X
jx���{�HBW��5�2
k@n�q1�5��Q:d��H'sp�� 0 
G (U ~ � G� 
� 
� � !!!5!!L!#n!�!�!�!�!*�!�!"!";"U"+d"�"%�"V�"[%#�#�# �#�#A�#/ $8P$#�$�$2�$!�$%)'%,Q%%~%(�%�%!�%&,&-B&p&|&�&0�&�&
�&�&	�&
'�'+�'�'�'�'N�'B:(=}(�(D�()+);)	P)Z)?a)
�)�)�)�)�)�)
�)�)�) �)*.*!6*	X*b*#�*.�*K�*-+%M+s+�+%�+!�+"�+$,<,Z,&y,
�,�,�,�,--$-]5-�-'�-�-e�-�P.�.�.�./4/E/AX/�/�/�/�/�/)�/
0,+0X0o0�0�0�0.�011(1H1c1;1(�1�1�1 
2.2A2,[2s�2N�2K3T3
n3y3
�3 �3"�3}�3"]4�4,�4]�4+5&G51n5Q�5?�5026jc6H�6.7@F7.�74�7$�708$A8%f8X�8��8��9:2:/m:E�:F�:Y*;T�;�;:�;'.<V<i<�<"�<�<	�<�<�<=.=>K=4�=�= �=�=S>
X>f>Au>>�>�>(?:?R?%m?"�?2�?�?S@C\@��@.-A]\A�A�A�A�A�AB*B
FBQBbBoB�B�B�B�B�B
C!C
2C@CMC]ClC�C�C�C�C�C�C�CD
D)D8D<DUD�lD4F'DFlFStF�F�F�F�F�F!G'GGG\GtG$�G
�G �G��GkHL~H!�H!�H5I2EIyxI��Ix�J,K03KdKS~KJ�K�LN�L�M&�M�M�M8�M	N N9N @NUaN�N�N�N�N�N/O6O)UO)O�O�O�O
�O3�O!#PEPUPpP�P+�P�P3�PYQjkQ�Q�Q2�Q)'RLQR)�R/�R%�RS0#S TS0uSD�S>�S1*T?\T3�T&�T�T=�T,;U
hUsU�U2�U�U�U�U	V
VV1�V�V�V
�VXWJ]W;�W�WR�W QXrX�X�X�XF�X�X	YY	Y%Y4Y
=YKYQY)YY�Y�Y$�Y�Y&�Y$Z2(ZV[Z9�Z3�Z  [!A[<c[7�[7�[9\3J\3~\9�\�\$�\$!]F]^]!u]�]a�]^+$^P^�m^��^�_�_�_�_3�_`N5`�`�`�`�`�`-�`%a?:aza�a�a#�a$�a;bRb)db#�b2�b6�b-c?Jc�c�c+�c�c!d7$du\dI�de #eDe^ere�e$�e��e)@fjf1�fl�f&g)Eg5ogH�g;�g0*hl[hQ�h-i:Hi%�i-�i&�i&�i)%j*OjOzj��j��k?9l3ylK�lH�l}Bmd�m#%nIInG�n"�n$�n%#o+Io'uo
�o�o�o�o7�o@p7`p�p&�p�pD�p
6qDqHUqK�q"�q'
r%5r[r"{r.�rG�rsY3s>�s��sG_tl�t u5u=uSueuvu&�u
�u�u�u�u
v)v"8v$[v �v�v-�v�v�v�vw'wEw&_w �w�w�w�w"�wxx$x:x>xWx�
G
L�
-��R�H)������Pcv��_����=�w�r?�[���2(u���a�6���@0Y,M��.���W�d�b|���"�/���h�z�<�;xIyT�
�% ���V��7~�>�`����'�����s�&������t{�9�pi�-�'�(��+����&��]���JX^�g���3m%)B��	��$U8Ef1��$�#��nA��eQ�����}��+oK."�FN���4\	��Z�D�Oq#*�j*,�k����5 C��!�Sl!:�
Aborted.

Are you sure you would like to continue?         <Tab>/<Alt-Tab> between elements  |  <Space> selects  |  <F12> next screen Minor Release: %d MHz%s MB%s megabytes%s was not found*Email Address:<b>Downloads &amp; Upgrades:</b><b>HTTP Proxy</b><b>Login:</b><b>Management:</b><b>Security &amp; Updates:</b><b>Support:</b><b>System ID:</b><b>The network connection on your system is not active. Your system cannot be set up for software updates at this time.</b><b>Warning</b><b>Your system was registered for updates during installation.</b><big><b>Profile Data</b></big><big><b>System Name</b></big><small><b>Example:</b> squid.example.com:3128</small><small><b>Example</b>: XXXX-XXXX-XXXX-XXXX</small><small><b>Tip:</b> Red Hat values your privacy: http://www.redhat.com/legal/privacy_statement.html.</small><small>Tip: Forgot your login or password? Contact your Satellite's <i>Organization Administrator</i>.</small>A common cause of this error is the system time being incorrect. Verify that the time on this system is correct.
A connection was attempted with a malformed URI.
A connection was attempted with a malformed URI: %s.
A proxy was specified at %s.A recognizable name will help you identify this system in a management interface.A username and password are required to register a system.Access to the technical support experts at Red Hat or Red Hat's partners for help with any issues you might encounter with this system.Activate a previously purchased subscription you have not yet activated.Additional hardware information including PCI devices, disk sizes and mount points will be included in the profile.All available updatesAn error has occurred:ArchArchitecture: %s, OS Release: %s, OS Version: %sAre you Sure?Are you sure you would like to continue?BackBuilding Package ListBuilding a list of RPM packages installed on your system.  Please wait.CPU Model:CPU Speed:CPU model: CPU speed: CancelCannot contact selected serverCertificate _Location:Channel(s): %s successfully addedChannel(s): %s successfully removedChoose ServiceChoose minor releaseCloseCompliance:Confirm operating system release selectionConnection aborted by the userCreate ProfileCreate Profile - HardwareCreate Profile - PackagesCreate profileDelay error from server.  The message was:
Do not attempt to use XDo not upload any virtualization infoDouble-check the location - is '%s' correct? If not, you can correct it and try again.Download installation images for Red Hat Enterprise Linux releases, including new releases.Downloads & Upgrades:ERRORERROR: can not find RHNS CA fileERROR: must be root to execute
ERROR: these arguments make no sense in this context (try --help)ERROR: you have to specify at least one channelERROR: you may want to specify --add, --remove or --listEnter in the format hostname(:port)ErrorError communicating with server. The message was:
Error during adding channel(s) %sError reading cpu information:Error reading install method information:Error reading network interface information:Error reading networking information:Error reading system memory information:Error running hardware profileError validating data at server:
Error:Error: Server Unavailable. Please try later.Example: https://satellite.example.com/XMLRPCFatal ErrorFile Not Found: 
FinishGetting list of packages installed on the systemGo Back and RegisterHardware InfoHardware ProfileHostname:Hostname: I <b>_don't</b> have an SSL certificate. I will contact my system administrator for assistance and will register at a later time.I would like to connect via an _HTTP proxy.I'll register later.IP Address:IP Address: If you are using https you must enter the location of a valid SSL certificate.Include RPM packages installed on this system in my System ProfileInclude the following information about hardware and network:Installation _Number:It appears this system has already been set up for software updates:Limited Updates OnlyLimited updatesLink To SubscriptionLocation:Login:Make sure the network connection on this system is operational.ManagementManagement:Memory:Memory: Network error: NextNo, CancelNoticeOKOperating System Release VersionOperating System version:PackagePassword error. The message was:
Password:Please enter a desired login.Please enter and verify a password.Please enter your Red Hat account information:Please enter your login information for the %s Red Hat Network Satellite:

Please review the subscription details below:Press <space> to deselect the option.Problem registering system.Problem registering system:
Problem sending hardware information.Problem sending hardware profile.Problem sending hardware profile:
Problem sending package information.Problem sending package list.Problem sending package list:
Problem writing out system id to disk.Profile name:Provide a Security CertificateProvide a security certificateProxy ConfigurationProxy P_assword:Proxy Setup ButtonProxy _Username:Purchase an additional Red Hat Enterprise Linux subscription at http://www.redhat.com/store/.RHN RegistrationRPM dependency error. The message was:
RPM error.  The message was:
RPM information is important to determine what updated software packages are relevant to this system.Receive the latest software updates, including security updates, keeping this Red Hat Enterprise Linux system updated and secure.Red Hat AccountRed Hat Login:Register LaterRegister _LaterRegister the system even if it is already registeredRegistering SystemRegistering system and sending profile information.  Please wait.Review SubscriptionReview system...SSL certificate:Satellite URL:Security & Updates:See /var/log/up2date for more informationSelect A FileSelect how your system will receive updates:Send _hardware profileSend _package profileSending InformationSending hardware informationSending package informationServer has refused connection due to high loadService Level:Set Up Software UpdatesSoftware Channel Subscriptions:Software Update Not Set UpSoftware Updates Not Set UpSomething went wrong while installing the new certificate:
Specify a file to use as the ssl CA certSpecify a passwordSpecify a profilenameSpecify a url to use as a serverSpecify a usernameSpecify an activation keySpecify an organizational id for this systemStay in compliance with your subscription agreement and manage subscriptions for systems connected to your account.Subscriptions have been activated for the following Red Hat products/services:Support:System Already RegisteredSystem ID:System RegistrationSystem _Name:Take me back to the registrationTake me back to the setup process.The installation number [ %s ] provided is not a valid installation number. Please go back to the previous screen and fix it.The installation number is invalidThe server indicated an error:
There was a problem registering this system.There was an SSL error. This could be because the file you picked was not a certificate file.There was an SSL error: %s
There was an authentication error: %s
There was an error building the list of packages.There was an error communicating with the registration server.  The message was:
There was an error communicating with the registration server:
There was an error getting the list of hardware.There was an error loading your configuration.  Make sure that
you have read access to /etc/sysconfig/rhn.There was an error saving your configuration. Make sure that
you own %s.There was an error while applying your choice.There was an error while assembling information for the profile.There was an error while creating the profile.There was an error while installing the certificate.There was an error while logging in.There was an error while populating the profile.There was some sort of I/O error: %sThere was some sort of I/O error: %s
This client requires the server to support %s, which the current server does not supportThis error shouldn't have happened. If you'd like to help us improve this program, please file a bug at bugzilla.redhat.com. Including the relevant parts of '%s' would be very helpful. Thanks!This server doesn't support functionality needed by this version of the software update setup client. Please try again with a newer server.This system is already registered. Use --force to overrideThis system is not associated with any channel.This system may not be updated until it is associated with a channel.This system will receive updates from the following software channels:Tip: Forgot your login or password?  Contact your Satellite's Organization Administrator.Tip: Red Hat values your privacy: http://www.redhat.com/legal/privacy_statement.htmlUnable to Locate SystemIdUnable to locate SystemId file. Is this system registered?Unable to open gui. Try `up2date --nox`Updates ConfiguredUpdating hardware profile...Updating package profile...Updating virtualization profile...User interrupted process.Version: View Hardware ProfileView Package ProfileWarningWarning: unable to enable rhnsd with chkconfigWe are attempting to contact the Red Hat Network server at %s.We could not contact the Satellite or Proxy at '%s.'Why RegisterWhy Should I Connect to RHN? ...Why Should I Register?Would you like to register your system at this time? <b>(Strongly recommended.)</b>Yes, ContinueYes/No dialog:You may be running a client that is incompatible with the server.You may deselect individual packages by unchecking them below.You must be root to run %sYou must choose a name for this profile.You must enter a login.You must enter a password.You must enter a valid Satellite URL.You must run rhn_register as root.You must run the RHN registration program as root.You must select a certificate.You need to register this system by running `rhn_register` before using this optionYou specified an invalid protocol. Only https and http are allowed.You were unable to be subscribed to the following software channels because there were insufficient subscriptions available in your account:Your system is not setup for software updates.Your system will be subscribed to the base software channel to receive all available updates._Activate a subscription now..._Close_Go Back and Register_Login:_Minor release:_No, Cancel_No, I prefer to register at a later time._Password:_Proxy Location:_Proxy Setup_View Hardware Profile ..._Why Should I Register?_Yes, Continue_Yes, I'd like to register now.class %s has no attribute '%s'installation number fieldlabellist all available child channelslist channelsprogress barprogress statusproxy locationproxy password fieldproxy user fieldsatellite server locationshow base channel of a systemsubscribe to channelsystem nameunknownunsubscribe from channelverbose outputyour passwordyour user name•• A network connection• Your account loginProject-Id-Version: Spacewalk
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2018-11-23 14:33+0100
PO-Revision-Date: 2018-03-16 11:00+0000
Last-Translator: Copied by Zanata <copied-by-zanata@zanata.org>
Language-Team: Galician (http://www.transifex.com/projects/p/spacewalk/language/gl/)
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Zanata 4.6.2

Interrompido.

Ten a certeza de que desexa continuar?        <Tab>/<Alt-Tab> entre elementos   |   <Space> escolle   |  <F12> pantalla seguinte Edición menor: %d MHz%s MB%s megabytesNon se atopou %s*Enderezo de correo electrónico:<b>Descargas e anovacións:</b><b>Proxy de HTTP</b><b>Identificación:</b><b>Xestión:</b><b>Actualizacións de seguranza:</b><b>Axuda:</b><b>Identificador do sistema:</b><b>A conexión de rede deste sistema non está activa. Non é posíbel configurar as actualizacións de software deste sistema neste momento.</b><b>Advertencia</b><b>Este sistema rexistrouse para actualizacións durante a instalación.</b><big><b>Datos do perfil</b></big><big><b>Nome do sistema</b></big><small><b>Exemplo:</b> squid.exemplo.gal:3128</small><small><b>Exemplo</b>: XXXX-XXXX-XXXX-XXXX</small><small><b>Suxestión:</b>A Red Hat aprecia a súa privacidade: http://www.redhat.com/legal/privacy_statement.html</small><small>Suxestión: Esqueceu a súa identificación ou o seu contrasinal? Contacte coa <i>administración da Organización</small> do Satélite</i></small>Unha causa frecuente deste erro é que a hora do sistema sexa incorrecta. Comprobe que a hora do sistema sexa correcta.
Tentouse unha conexión cun URI incorrecto.
Tentouse unha conexión cun URI incorrecto: %s.
Indicouse un proxy en %s.Un nome recoñecíbel axuda a identificar este sistema nunha interface de xestión.Requírense un nome de usuario e un contrasinal para rexistrar un sistema.Acceda aos expertos en axuda técnica da Red Hat ou dos colaboradores da Red Hat para axuda con calquera problema que poda atopar con este sistema.Activar unha subscricións adquirida anteriormente que aínda non se activase.No perfil incluirase información adicional de hardware, incluídos os dispositivos PCI, os tamaños dos discos e os puntos de montaxe.Todas as actualizacións dispoñíbeisProduciuse un erro:ArquitecturaArquitectura: %s, Edición do SO: %s, Versión do SO: %sTen a certeza?Ten certeza de querer continuar?AtrásA construír a lista de paquetesA construír unha lista dos paquetes RPM instalados no sistema. Agarde un momentiño.Modelo de CPU:Velocidade da CPU:Modelo de CPU: Velocidade da CPU: CancelarNon é posíbel contactar co servidor escollido_Localización do certificado:Canle(s): %s engadidas satisfactoriamenteCanle(s): %s retiradas satisfactoriamenteEscoller un servizoEscoller unha edición menorFecharConformidade:Confirme a escolla da edición do sistema operativoO usuario interrompeu a conexiónCrear un perfilCrear un perfil - HardwareCrear un perfil - PaquetesCrear un perfilErro de demora do servidor: A mensaxe foi:
Non tentar empregar XNon enviar ningunha información de virtualizaciónVerifique o lugar - é «%s» correcto? Caso de que non, pode corrixilo e tentar de novo.Descargue imaxes de instalación das edicións do Linux Red Hat Enterprise, incluídas as novas edicións.Descargas e anovacións:ERROERRO: non é posíbel atopar o ficheiro de CA RHNSERRO: hai que ser «root» para executar
ERRO: estes parámetros non teñen sentido neste contexto (tente con --help)ERRO: ten que indicar ao menos unha canleERRO: tente indicando --add, --remove ou --listIntroduza no formato servidor(:porto)ErroErro ao comunicarse co servidor. A mensaxe foi:
Erro ao engadir a(s) canle(s) %sProduciuse un erro ao ler a información da cpu:Produciuse un erro ao ler a información do método de instalación:Produciuse un erro ao ler a información da interface de rede:Produciuse un erro ao ler a información da rede:Produciuse un erro ao ler a información da memoria do sistema:Produciuse un erro ao executar o perfil do hardwareErro ao validar os datos no servidor:
Erro:Erro: O servidor non está dispoñíbel. Ténteo máis tarde.Exemplo: https://satelite.exemplo.gal/XMLRPCErro fatalFicheiro non atopado: 
RematarA obter a lista dos paquetes instalados no sistemaRecuar e rexistrarseInformación do hardwarePerfil do hardwareServidor:Servidor: <b>Non</b> teño un certificado SSL. Contactarei co administrador do meu sistema para que me axude e rexistrareime máis tarde.Desexaría conectarme mediante un proxy de _HTTP.Rexistrareime máis tarde.Enderezo IP:Enderezo IP: Se está a usar https ten que introducir a localización dun certificado de SSL válido.Incluír os paquetes RPM instalados neste sistema no meu perfil de sistemaIncluír a información seguinte sobre o hardware e a rede:_Número de instalación:Semella que este sistema xa está configurado para as actualizacións de software:Só as actualizacións limitadasActualizacións limitadasLigar á subscriciónLugar:Identificador:Asegúrese de que a conexión de rede deste sistema estea a funcionar.XestiónXestión:Memoria:Memoria: Erro de rede: SeguinteNon, CancelarAvisoAceptarVersión da edición do sistema operativoVersión do sistema operativo:PaqueteErro de contrasinal: A mensaxe foi:
Contrasinal:Introduza a identificación que desexeIntroduza e comprobe un contrasinal.Introduza a información da súa conta da Red Hat:Introduza a súa información de identificación no Satélite da Rede da Red Hat %s:

Revise os detalles da subscrición que ten aquí embaixo:Prema <espazo> para anular a selección da opción.Problema co rexistro do sistema.Problema co rexistro do sistema:
Produciuse un problema ao enviar a información do hardware.Produciuse un problema ao enviar o perfil do hardware..Produciuse un problema ao enviar o perfil do hardware:
Produciuse un erro ao enviar a información dos paquetes.Produciuse un erro ao enviar a lista dos paquetes..Produciuse un erro ao enviar a lista dos paquetes:
Problema ao escribir o identificador do sistema no disco.Nome do perfil:Fornecer un certificado de seguranzaFornecer un certificado de seguranzaConfiguración do proxyContr_asinal do proxy:Botón de configuración do proxyNome de _usuario do proxy:Adquirir unha subscrición adicional ao Linux Red Hat Enterprise en http://www.redhat.com/store/.Rexistro na RHNErro de dependencia de RPM. A mensaxe foi:
Erro de RPM. A mensaxe foi:
A información sobre RPM é importante para determinar os paquetes de software actualizados que son relevantes para este sistema.Reciba as últimas actualizacións de software, incluídas as actualizacións de seguranza, mantendo o sistema Linux Red Hat Enterprise actualizado e seguro.Conta da Red HatIdentificación na Red Hat:Rexistrarme máis tarde_Rexistrarme máis tardeRexistrar o sistema mesmo se xa estivese rexistradoA rexistrar o sistemaA rexistrar o sistema e enviar a información do perfil. Agarde un momentiño.Revisión da subscriciónRevisar o sistema...Certificado de SSL:URL do Satélite:Actualizacións de seguranza:Vexa /var/log/up2date para máis informaciónEscoller un ficheiroEscolla como desexa que este sistema reciba as actualizacións:Enviar o perfil de _hardwareEnviar o perfil dos _paquetesA enviar a informaciónA enviar a información do hardwareA enviar a información dos paquetesO servidor rexeitou a conexión por ter unha carga excesivaNivel de servizo:Configurar as actualizacións de softwareSubscricións a canles de software:A actualización de software non está configuradaAs actualizacións de software non están configuradasAlgo foi mal ao instalar o novo certificado:
Indique un ficheiro para empregar como certificado de CA de sslIndique un contrasinalIndique un nome de perfilIndique un URL para empregalo como servidorIndique un nome de usuarioIndique unha chave de activaciónIndique un identificador organizativo para este sistemaManteña a conformidade co acordo de subscrición e xestione as subscricións dos sistemas conectados coa súa conta.Activáronse as subscricións aos seguintes produtos/servizos da Red Hat:Axuda:Este sistema xa está rexistradoIdentificador do sistema:Rexistro no sistema_Nome do sistema:Volver ao rexistroVolver ao proceso de configuración.O número de instalación [ %s ] que forneceu non é un número de instalación correcto. Retorne á pantalla anterior e arránxeo.O número de instalación non é correctoO servidor indicou un erro:
Produciuse un problema ao rexistrar este sistema.Produciuse un erro de SSL. Poderíase deber ao que o ficheiro escollido non sexa un ficheiro de certificado.Produciuse un erro de SSL: %s
Produciuse un erro de autenticación: %s
Produciuse un erro ao construír a lista de paquetes.Produciuse un erro ao comunicar co servidor de rexistro. A mensaxe foi:
Produciuse un erro ao comunicarse co servidor de rexistro:
Produciuse un erro ao obter a lista de hardware.Produciuse un erro ao cargar a configuración. Asegúrese de que ten acceso de lectura a /etc/sysconfig/rhn.Produciuse un erro ao gardar a configuración. Asegúrese de que
é o dono de %s.Produciuse un erro ao aplicar a súa escolla.Produciuse un erro ao reunir a información para o perfil.Produciuse un erro ao crear o perfil.Produciuse un erro ao instalar o certificado.Produciuse un erro durante o rexistro.Produciuse un erro ao encher o perfil.Produciuse algún tipo de erro de E/S: %sProduciuse algún tipo de erro de E/S: %s
Este cliente require que o servidor admita %s, que o servidor actual non admiteEste erro non se debería ter producido. Se desexa axudarnos a mellorar este programa, informe deste fallo en bugzilla.redhat.com. Axudaría se incluíse as partes relevantes de «%s». Grazas!Este servidor non acepta algunha funcionalidade requirida por esta versión do cliente de configuración das actualizacións de software. Ténteo de novo cun novo servidor.Este sistema xa está rexistrado. Empregue --force para ignorarEste sistema non está asociado con ningunha canle.Este sistema podería non estar actualizado até que se asocie cunha canle.Este sistema recibirá actualizacións das canles de software seguintes:Suxestión: Esqueceu a súa identificación ou o seu contrasinal? Contacte coa administración da Organización do Satélite.Suxestión: A Red Hat aprecia a súa privacidade: http://www.redhat.com/legal/privacy_statement.htmlNon foi posíbel localizar SystemIdFoi imposíbel atopar o ficheiro SystemId. Está rexistrado este sistema?Non é posíbel abrir a interface gráfica. Tente con «up2date --nox»Configuráronse as actualizaciónsA actualizar o perfil do hardware...A actualizar o perfil dos paquetes...A actualizar o perfil da virtualización...O proceso foi interrompido polo usuarioVersión: Ver o perfil do hardwareVer o perfil dos paquetesAdvertenciaAdvertencia: foi imposíbel activar rhnsd con chkconfigEstamos a tentar contactar co servidor da Rede da Red Hat en %s.Non puidemos contactar co Satélite ou Proxy de «%s».Por que rexistrarsePor que debería conectarme a RHN? ...Por que debería rexistrarme?Desexaría rexistrar este sistema agora? <b>(Moi recomendábel).</b>Si, ContinuarDiálogo Si/Non:Pode que estea a executar un cliente que sexa incompatíbel co servidor.Pode anular a selección de paquetes individuais retirándoa aquí embaixo.Debe ser «root» para executar %sDebe escoller un nome para este perfil.Debe introducir unha identificación.Debe introducir un contrasinal.Ten que introducir un URL válido.rhn_register debe ser executado como «root».O programa de rexistro de RHN ten que ser executado como administrador.Debe escoller un certificado.Ten que rexistrar este sistema executando «rhn_register» antes de empregar esta opciónIndicou un protocolo incorrecto. Só se permiten https e http.Non foi posíbel subscribirse ás canles de software seguintes porque había un número insuficiente de subscricións dispoñíbeis na súa conta:Este sistema non está configurado para as actualizacións de software.Este sistema vaise subscribir á canle base de software para recibir todas as actualizacións dispoñíbeis._Activar a subscrición agora..._Fechar_Recuar e rexistrarse_Identificación:Edición _menor:_Non, cancelar_Non, prefiro rexistrarme máis tarde._Contrasinal:Localización do _proxy:Configuración do _proxy_Ver o perfil do hardware ..._Por que debería rexistrarme?_Si, continuar_Si, desexaría rexistrarme agora.a clase %s non ten o atributo «%s»campo do número de instalaciónetiquetaenumerar todas as canles fillas dispoñíbeisenumerar as canlesbarra de progresoestado do progresolocalización do proxycampo do contrasinal do proxycampo de usuario do proxylocalización do servidor do satélitemostrar a canle base dun sistemasubscribirse a unha canlenome do sistemadescoñecidoanular a subscrición a unha canlesaída detalladao seu contrasinalo seu nome de usuario•* Unha conexión de rede* O seu identificador de contaPK�m�\�6��LC_MESSAGES/policycoreutils.monu�[�����,<P	Q�[�Password:Project-Id-Version: PACKAGE VERSION
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2023-02-15 12:35+0100
PO-Revision-Date: 2016-06-17 05:40-0400
Last-Translator: Copied by Zanata <copied-by-zanata@zanata.org>
Language-Team: Galician
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1)
X-Generator: Zanata 4.6.2
Contrasinal:PK�m�\M�:)��LC_MESSAGES/sysstat.monu�[�����$<5\01M&d%��"��))S\"s�.�-�I'Q-y6����!'(Pe8���+�#.Bq$y���,�	�	2�	7
.I
$x
'�
%�
/�
*"-M{L�O�S74�B�9
=
	P
Z
2x
4�
�
 �
Le&�3�4�CW5^�"#	
$ 
!	-F	Filesystems statistics
	-R	Memory statistics
	-S	Swap space utilization statistics
	-b	I/O and transfer rate statistics
	-d	Block devices statistics
	-r	Memory utilization statistics
	-y	TTY devices statistics
	[Unknown activity format]-f and -o options are mutually exclusive
Average:Cannot find disk data
Cannot handle so many processors!
Cannot open %s: %s
Cannot write data to system activity file: %s
Cannot write system activity file header: %s
Current sysstat version can no longer read the format of this file (%#x)
End of system activity file unexpected
Error while reading system activity file: %s
File created by sar/sadc from sysstat version %d.%d.%dFile time: Host: Invalid data format
Invalid system activity file: %s
Invalid type of persistent device name
List of activities:
Main options and reports:
Not reading from a system activity file (use -f option)
Not that many processors!
Other devices not listed herePlease check if data collecting is enabled
Requested activities not available
Requested activities not available in file %s
SummarySystem activity data file: %s (%#x)
sysstat version %s
Project-Id-Version: sysstat 10.3.1
Report-Msgid-Bugs-To: sysstat <at> orange.fr
POT-Creation-Date: 2014-03-16 06:40+0100
PO-Revision-Date: 2014-05-10 19:08+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
X-Bugs: Report translation errors to the Language-Team address.
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
	-F	Estatísticas dos sistemas de ficheiros
	-R	Estatísticas de memoria
	-S	Estatísticas de uso do espazo de intercambio
	-b	Estatísticas de E/S e velocidade de transferencia
	-d	Estatísticas dos dispositivos de bloques
	-r	Estatísticas de uso da memoria
	-y	Estatísticas dos dispositivos TTY
	[Formato de actividade descoñecido]As opcións -f e -o son mutuamente excluíntes
Media:Non foi posíbel atopar os datos do disco
Non é posíbel manexar tantos procesadores!
Non foi posíbel abrir %s: %s
Non foi posíbel escribir os datos no ficheiro de actividade do sistema: %s
Non foi posíbel escribir a cabeceira do ficheiro de actividade do sistema: %s
A versión actual de sysstat xa non é capaz de ler o formato deste ficheiro (%#x)
Fin inesperado do ficheiro de actividade do sistema
Produciuse un erro ao ler o ficheiro de actividade do sistema: %s
Ficheiro creado por sar/sadc de sysstat versión %d.%d.%dTempo do ficheiro:Máquina:Formato de datos non válido
Ficheiro de actividade do sistema non válido: %s
Tipo de nome de dispositivo persistente non válido
Lista de actividades:
Opcións principais e informes:
Non se está a ler dun ficheiro de actividade do sistema (use a opción -f)
Non hai tantos procesadores!
Outros dispositivos non listados aquíComprobe se a recolección de datos está activada
As actividades solicitadas non están dispoñíbeis
As actividades solicitadas non están dispoñíbeis no ficheiro %s
ResumoFicheiro de datos de actividade do sistema: %s (%#x)
sysstat versión %s
PK�m�\M7�A�ALC_MESSAGES/systemd.monu�[�����r��<�	)�	&�	$
!'
+I
(u
6�
B�
?>X@�-�* 1;R)�G�D
RE
^�
[�
ZS\�IFU<�_�V96�I�`Wr7�]T`4�K�^6U�5�H!EjC�@�\5S�>�<%<bR�-�= 9^6�P�K BlD�/�7$D\0�C�M0d<�\�:/6jm�?4O2�6�.�- Kl ��=�4�4Sr�'�1�,�#,%Pv=�4��: 1K } �  � � 
� � =!M!b!!�!�!�!;�!2"+7"�c"-�#) $(J$$s$6�$:�$E
%LP%N�%K�%N8&5�&9�&"�&G'Cb'X�'\�'h\(o�(p5)n�)q*^�*\�*AC+e�+g�+2S,P�,c�,_;-0�-f�-h3.3�.Z�.f+/h�/3�/M/0I}0H�0D1bU1Q�1G
2FR2E�2^�2/>3Kn3D�3@�3\@4R�4T�4RE52�5<�5K63T6e�6R�6?A7K�7y�7GG8C�8��8Qp9O�9=:EP:0�:/�:(�:' ;.H;w;C�;G�;'<'><$f< �<1�<6�<2=4H=3}=�=A�=?>D>DX>H�>�>(?(,?U?s?&�?Z�?&@19@0k@�@�@�@D�@H.A8wA*"]-N_BA
MYbqU6f`@>+7H;1kG58Fp&I\X%cRhO!)Kn9<.20CdT$Qrm^/(g#eZ
DVJ:S34P,a= iE'?W[	ljoLAcquire a pseudo TTY in a local containerAcquire a pseudo TTY on the local hostAcquire a shell in a local containerAcquire a shell on the local hostAllow applications to delay system shutdownAllow applications to delay system sleepAllow applications to inhibit automatic system suspendAllow applications to inhibit system handling of the hibernate keyAllow applications to inhibit system handling of the lid switchAllow applications to inhibit system handling of the power keyAllow applications to inhibit system handling of the suspend keyAllow applications to inhibit system shutdownAllow applications to inhibit system sleepAllow attaching devices to seatsAllow indication to the firmware to boot to setup interfaceAllow non-logged-in users to run programsAuthentication is required for an application to delay system shutdown.Authentication is required for an application to delay system sleep.Authentication is required for an application to inhibit automatic system suspend.Authentication is required for an application to inhibit system handling of the hibernate key.Authentication is required for an application to inhibit system handling of the lid switch.Authentication is required for an application to inhibit system handling of the power key.Authentication is required for an application to inhibit system handling of the suspend key.Authentication is required for an application to inhibit system shutdown.Authentication is required for an application to inhibit system sleep.Authentication is required for attaching a device to a seat.Authentication is required for hibernating the system while an application asked to inhibit it.Authentication is required for hibernating the system while other users are logged in.Authentication is required for hibernating the system.Authentication is required for managing active sessions, users and seats.Authentication is required for powering off the system while an application asked to inhibit it.Authentication is required for powering off the system while other users are logged in.Authentication is required for powering off the system.Authentication is required for rebooting the system while an application asked to inhibit it.Authentication is required for rebooting the system while other users are logged in.Authentication is required for rebooting the system.Authentication is required for resetting how devices are attached to seats.Authentication is required for suspending the system while an application asked to inhibit it.Authentication is required for suspending the system while other users are logged in.Authentication is required for suspending the system.Authentication is required to acquire a pseudo TTY in a local container.Authentication is required to acquire a pseudo TTY on the local host.Authentication is required to acquire a shell in a local container.Authentication is required to acquire a shell on the local host.Authentication is required to control whether network time synchronization shall be enabled.Authentication is required to control whether the RTC stores the local or UTC time.Authentication is required to download a VM or container imageAuthentication is required to export a VM or container imageAuthentication is required to import a VM or container imageAuthentication is required to indicate to the firmware to boot to setup interface.Authentication is required to kill '$(unit)'.Authentication is required to lock or unlock active sessions.Authentication is required to log into a local container.Authentication is required to log into the local host.Authentication is required to manage local virtual machine and container images.Authentication is required to manage local virtual machines and containers.Authentication is required to manage system service or unit files.Authentication is required to manage system services or other units.Authentication is required to reload '$(unit)'.Authentication is required to reload the systemd state.Authentication is required to reset the "failed" state of '$(unit)'.Authentication is required to restart '$(unit)'.Authentication is required to run programs as a non-logged-in user.Authentication is required to send the entered passphrase back to the system.Authentication is required to set a wall messageAuthentication is required to set local machine information.Authentication is required to set or unset system and service manager environment variables.Authentication is required to set properties on '$(unit)'.Authentication is required to set the local host name.Authentication is required to set the statically configured local host name, as well as the pretty host name.Authentication is required to set the system keyboard settings.Authentication is required to set the system locale.Authentication is required to set the system time.Authentication is required to set the system timezone.Authentication is required to start '$(unit)'.Authentication is required to stop '$(unit)'.Download a VM or container imageExport a VM or container imageFlush device to seat attachmentsHibernate the systemHibernate the system while an application asked to inhibit itHibernate the system while other users are logged inImport a VM or container imageLock or unlock active sessionsLog into a local containerLog into the local hostManage active sessions, users and seatsManage local virtual machine and container imagesManage local virtual machines and containersManage system service or unit filesManage system services or other unitsPower off the systemPower off the system while an application asked to inhibit itPower off the system while other users are logged inReboot the systemReboot the system while an application asked to inhibit itReboot the system while other users are logged inReload the systemd stateSend passphrase back to systemSet RTC to local timezone or UTCSet a wall messageSet host nameSet machine informationSet or unset system and service manager environment variablesSet static host nameSet system keyboard settingsSet system localeSet system timeSet system timezoneSuspend the systemSuspend the system while an application asked to inhibit itSuspend the system while other users are logged inTurn network time synchronization on or offProject-Id-Version: systemd
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2015-09-14 23:55+0200
PO-Revision-Date: 2015-09-15 00:20+0200
Last-Translator: Fran Dieguez <frandieguez@gnome.org>
Language-Team: gnome-l10n-gl@gnome.org
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
Adquirir unha pseudo TTY nun contenedor localAdquirir unha pseudo TTY nun equipo localAdquirir unha shell nun contenedor localAdquirir unha shell nun equipo localPermitir aos aplicativos retrasar o apagado do sistemaPermitir aos aplicativos retrasar a suspensión do sistemaPermitir aos aplicativos inhibir a suspensión automática do sistemaPermitir aos aplicativos inhibir a xestión do sistema da tecla de hibernadoPermitir aos aplicativos inhibir a xestión do sistema do interruptor da tapa.Permitir aos aplicativos inhibir a xestión do sistema da tecla de acendidoPermitir aos aplicativos inhibir a xestión do sistema da tecla de suspensiónPermitir aos aplicativos inhibit o apagado do sistemaPermitir aos aplicativos inhibir a suspensión do sistemaPermitir conectar anexar a asentosPermitir indicarlle ao firmware arrincar para configurar unha interfacePermitirlle a usuarios sen unha sesión iniciada executar programasRequírese autenticación para permitirlle a un aplicativo retrasar o apagado do sistemaRequírese autenticación para permitirlle a un aplicativo retrasar a suspensión do sistemaRequírese autenticación para permitirlle a un aplicativo inhibir a suspensión automática do sistema.Requírese autenticación para permitirlle a un aplicativo inhibir a xestión do sistema da tecla de hibernado.Requírese autenticación para permitirlle a un aplicativo inhibir a xestión do sistema do interruptor da tapa.Requírese autenticación para permitirlle a un aplicativo inhibir a xestión do sistema da tecla de acendido.Requírese autenticación para permitirlle a un aplicativo inhibir a xestión do sistema da tecla de suspensión.Requírese autenticación para permitirlle a un aplicativo poida inhibir o apagado do sistema.Requírese autenticación para permitirlle a un aplicativo inhibir a suspensión do sistema.Requírese autenticación para anexar un dispositivo a un asento.Requírese autenticación para hibernar o sistema mentres un aplicativo solicitou a súa inhibición.Requírese autenticación para hibernar o sistema mentres outros usuarios teñen unha sesión iniciada.Requírese autenticación para hibernar o sistema.Requírese autenticación para xestionar as sesións, usuariso e asentos activosRequírese autenticación para apagar o sistema mentres un aplicativo solicitou a súa inhibición.Requírese autenticación para apagar o sistema mentres hai usuarios con unha sesión iniciada.Requírese autenticación para apagar o sistema.Requírese autenticación para reiniciar o sistema mentres un aplicativo solicitou a súa inhibición.Requírese autenticación para reiniciar o sistema mentres outros usuarios teñen unha sesión iniciada.Requírese autenticación para reiniciar o sistema.Requírese autenticación para reiniciar como os dispositivos están anexados aos asentos.Requírese autenticación para suspender o sistema mentres un aplicativo solicitou a súa inhibición.Requírese autenticación para suspender o sistema mentres outros usuarios teñen unha sesión iniciada.Requírese autenticación para suspender o sistema.Requírese autenticación para adquirir unha pseudo TTY nun contenedor local.Requírese autenticación para adquirir unha pseudo TTY nun equipo local.Requírese autenticación para adquirir unha shell nun contenedor local.Requírese autenticación para adquirir unha shell nun equipo local.Requírese autenticación para controlar se a sincronización de hora por rede debería activarse.Requírese autenticación para controlar se o RTC almacena a hora local ou a UTC.Requírese autenticación para descargar unha imaxe de MV ou contenedorRequírese autenticación para exportar unha imaxe de MV ou contenedorRequírese autenticación para imporar unha imaxe de MV ou contenedorRequírese autenticación para indicarlle ao firmware arrincar para configurar unha interface.Requírese autenticación para matar '$(unit)'.Requírese autenticación para bloquear ou desbloquear as sesións activas.Requírese autenticación para iniciar sesión nun contenedor local.Requírese autenticación para iniciar sesión nun equipo local.Requírese autenticación para xestionar imaxes de máquinas virtuais e contenedores locais.Requírese autenticación para xestionar máquinas virtuais e contenedores locais.Requírese autenticación para xestionar os servizos do sistema ou outros ficheiros.Requírese autenticación para xestionar os servizos do sistema ou outras unidadesRequírese autenticación para recargar '$(unit)'.Requírese autenticación para recargar o estado de systemd.Requírese autenticación para reinicair o estado «fallido» de '$(unit)'.Requírese autenticación para reiniciar '$(unit)'.Requírese autenticación para permitirlle executar programas a un usuario sen unha sesión iniciada.Requírese autenticación para enviar a frase de paso escrita de volta ao sistema.Requírese autenticación para estabelecer unha mensaxe de muroRequírese autenticación para estabelecer a información da máquina localRequírese autenticación para estabelecer ou desestabelecer as variables de ambiente do sistema ou do xestor de servizosRequírese autenticación para estabelecer as propiedades en '$(unit)'.Requírese autenticación para estabelecer o nome local do equiupo.Requírese autenticación para estabelecer de forma o nome do equipo local estabelecido de forma estática, así como o nome do equipo lexíbel por persoas.Requírese autenticación para estabelecer as preferencias do teclado do sistema.Requírese autenticación para estabelecer a configuración rexional do sistemaRequírese autenticación para estabelecer a hora do sistema.Requírese autenticación para estabelecer o fuso horario do sistema.Requírese autenticación para inciar '$(unit)'.Requírese autenticación para deter '$(unit)'.Descargar unha imaxe de MV ou contenedorExportar unha imaxe de MV ou contenedorReiniciar os anexos do dispositivo aos asentosHibernar o sistemaHibernar o sistema cando un aplicativo solicitou a súa inhibiciónHibernar o sistema mentres outros usuarios teñen unha sesión iniciadaImportar unha imaxe de MV ou contenedorBloquear ou desbloquear sesión activasIniciar sesión nun contenedor localIniciar sesión nun equipo localXestionar as sesións, usuarios e asentos activosXestionar imaxes locais virtuais e contenedores locaisXestionar máquinas virtuais e contenedores locaisXestionar os servizos do sistema ou outros ficheirosXestionar os servizos do sistema ou outras unidadesApagar o sistemaApagar o sistema cando un aplicativo solicitou a súa inhibiciónApagar o sistema mentres hai usuarios con unha sesión iniciadaReiniciar o sistemaReiniciar o sistema cando un aplicativo solicitou a súa inhibiciónReiniciar o sistema mentres outros usuarios teñen unha sesión iniciadaRecargar o estado de systemdEnviar frase de paso de volta ao sistemaEstabelecer o RTC ao fuso horario ou UTCEstabelecer a mensaxe do muroEstabelecer o nome do equipoEstabelecer a información da máquinaEstabelecer ou desestabelecer as variables de ambiente do sistema ou do xestor de servizosEstabelecer o nome do equipo estáticoEstabelecer as preferencias do teclado do sistemaEstabelecer a configuración rexional do sistemaEstabelecer a hora do sistemaEstabelecer o fuso horarioSuspender o sistemaSuspender o sistema cando un aplicativo solicitou a súa inhibiciónSuspender o sistema mentres outros usuarios teñen unha sesión iniciadaActivar ou desactivar a sincronización de hora por redePK�m�\�D;��&�&LC_MESSAGES/chkconfig.monu�[�����^������-�<�2	L	f	9�	"�	$�	%
-
+I
(u
��
Qi����
�4�6&]"o���B�3
&4
/[
�
-�
�
*�
(�
LMf.�=�!>Sf;���#$+&P,w����6 Mn���!�'�'"8J � ���A�9H!b��&�`�$#?c�,��>�1B�Z%�''�->?~��9�"$.%Sy+�(�������
 .5Aw7��#��$S1=�4�6�/07	h&r$�S�J:]<�#��3?P�!�#�4� + -L -z $� +� *� -$!R!$o!1�!"�!-�!'"2?"0r"8�"4�"M#%_#,�#�#�#?�#K�# E$#f$	�$�$$�$q�$$:%(_%#�%�%*�%�%B&H&c&y&R>*MHE\#WL!-5.V
)$79'QS1"O<@:ZGD63(IFN8?0T&/K+,C]X^%U;[2B
=AYPJ4	 

Note: This output shows SysV services only and does not include native
      systemd services. SysV configuration data might be overridden by native
      systemd configuration.


error reading choice
                    [--initscript <service>]
                --altdir <directory> --admindir <directory>
         %s --add <name>
         %s --del <name>
         %s --override <name>
         %s [--level <levels>] [--type <type>] <name> %s
       alternatives --auto <name>
       alternatives --config <name>
       alternatives --display <name>
       alternatives --list
       alternatives --remove <name> <path>
       alternatives --set <name> <path>
      If you want to list systemd services use 'systemctl list-unit-files'.
      To see services enabled on particular target use
      'systemctl list-dependencies [target]'.

  Selection    Command
 link currently points to %s
 slave %s: %s
%s - status is auto.
%s - status is manual.
%s already exists
%s empty!
%s has not been configured as an alternative for %s
%s version %s
%s version %s - Copyright (C) 1997-2000 Red Hat, Inc.
(would remove %s
--type must be 'sysv' or 'xinetd'
BackCancelCurrent `best' version is %s.
Enter to keep the current selection[+], or type selection number: Failed to forward service request to systemctl: %m
No services may be managed by ntsysv!
Note: Forwarding request to 'systemctl %s %s'.
OkPress <F1> for more information on a service.ServicesThere are %d programs which provide '%s'.
There is %d program that provides '%s'.
This may be freely redistributed under the terms of the GNU Public License.
This may be freely redistributed under the terms of the GNU Public License.

What services should be automatically started?You do not have enough privileges to perform this operation.
You must be root to run %s.
admindir %s invalid
altdir %s invalid
alternatives version %s
alternatives version %s - Copyright (C) 2001 Red Hat, Inc.
bad argument to --levels
bad mode on line 1 of %s
bad primary link in %s
cannot determine current run level
error reading from directory %s: %s
error reading info for service %s: %s
error reading information on service %s: %s
failed to create %s: %s
failed to glob pattern %s: %s
failed to link %s -> %s: %s
failed to make symlink %s: %s
failed to open %s/init.d: %s
failed to open %s: %s
failed to open directory %s: %s
failed to read %s: %s
failed to read link %s: %s
failed to remove %s: %s
failed to remove link %s: %s
failed to replace %s with %s: %s
link %s incorrect for slave %s (%s %s)
link changed -- setting mode to manual
link points to no alternative -- setting mode to manual
missing path for slave %s in %s
numeric priority expected in %s
offononly one of --list, --add, --del, or --override may be specified
only one runlevel may be specified for a chkconfig query
path %s unexpected in %s
path to alternate expected in %s
reading %s
running %s
service %s does not support chkconfig
service %s supports chkconfig, but is not referenced in any runlevel (run 'chkconfig --add %s')
slave path expected in %s
the primary link for %s must be %s
unexpected end of file in %s
unexpected line in %s: %s
usage:   %s [--list] [--type <type>] [name]
usage:   %s [name]
usage: alternatives --install <link> <name> <path> <priority>
would link %s -> %s
would remove %s
xinetd based services:
Project-Id-Version: PACKAGE VERSION
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2017-07-25 13:31+0200
PO-Revision-Date: 2015-01-05 06:03+0000
Last-Translator: Copied by Zanata <copied-by-zanata@zanata.org>
Language-Team: Galician (http://www.transifex.com/projects/p/fedora/language/gl/)
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Zanata 4.6.2


Nota: Isto só mostra os servizos de SysV e non inclúen os 
      servizos de systemd. Os datos de configuración de SysV poden ser sobrescritos pola
      configuración nativa de systemd.


produciuse un erro ao ler a elección
                    [--initscript <servizo>]
                --altdir <directorio> --admindir <directorio>
         %s --add <nome>
         %s --del <nome>
         %s --override <nome>
         %s [--level <niveis>] [--type <tipo>] <nome> %s
       alternatives --auto <nome>
       alternatives --config <nome>
       alternatives --display <nome>
 alternatives --list
       alternatives --remove <nome> <ruta>
       alternatives --set <nome> <ruta>
Se desexa enumerar os servizos de systemd empregue «systemctl list-unit-files».
Para ver os servizos activados sobre un destino en concreto, empregue
«systemctl list-dependencies [destino]».
  Selección    Orde
 liga apunta actualmente a %s
 esclado %s: %s
%s - o estado é auto.
%s - o estado é manual.
%s xa existe
%s está baleiro!
%s non foi configurado como unha alternativa para %s
%s versión %s
%s versión %s - Copyright (C) 1997-2000 Red Hat, Inc.
(debería eliminar %s
--type debe ser 'sysv' ou 'xinetd'
AnteriorCancelarA «mellor» versión actual é %s.
Prema Intro para manter a selección actual[+] ou escriba o número da selección: Produciuse un fallo na solicitude do servizo a systemctl: %m
¡Ningún servicio pode ser xestionado polo ntsysv!
Nota: Redirixindo a solicitude a «systemctl %s %s».
AceptarPrema <F1> para máis información dun servicio.ServiciosHai %d programas que fornecen «%s».
Hai %d programa que fornece «%s».
Isto pódese redistribuír libremente baixo os termos da Licencia Pública de GNU.
Isto distribúese libremente baixo os termos da Licenza Pública de GNU.

¿Que servicios teñen que ser automáticamente iniciados?Non ten permisos dabondo para levar a cabo esta operación.
Ten que ser root para executar %s.
o admindir %s non é válido
o altdir %s non é válido
versión de alternatives %s
versión de alternatives %s - Copyright (c) 2011 Red Hat, Inc.
argumento erróneo de --levels
modo incorrecto na liña 1 de %s
ligazón primaria incorrecta en %s
non se pode determinar o nivel de execución actual
erro lendo do directorio %s: %s
erro lendo a información do servicio %s: %s
erro lendo a información do servicio %s: %s
produciuse un fallo ao crear %s: %s
imposible facer coincidir o patrón %s: %s
produciuse un fallo ao ligar %s -> %s: %s
imposible crear a ligazón simbólica %s: %s
erro ó abrir %s/init.d: %s
produciuse un fallo ao abrir %s: %s
produciuse un fallo ao abrir o directorio %s: %s
produciuse un fallo ao ler %s: %s
produciuse un fallo ao ler a ligazón %s: %s
produciuse un fallo ao eliminar %s: %s
produciuse un fallo ao eliminar a ligazón %s: %s
produciuse un fallo ao substituir %s con %s: %s
a ligazón %s non é correcta para o esclavo %s (%s %s)
a ligazón cambiou -- estabelecendo o modo a manual
a ligazón non apunta a ningunha alternativ -- estabelecendo o modo a manual
falta a ruta para o %s esclavo en %s
agardábase unha prioridade numérica en %s
offonsó debe especificar un de --list, --add, --del ou --override.
só se pode indicar un nivel de execución para unha consulta de chkconfig
non se agardaba a ruta %s en %s
ruta á alternativa agardada en %s
lendo %s
executando %s
o servicio %s non soporta chkconfig
o servizo %s admite chkconfig, pero non está referenciado por ningún runlevel (execute «chkconfig --add %s»)
agardábase unha ruta esclava en %s
a ligazón primaria para %s debe ser %s
fin de ficheiro non agardado en %s
liña non agardada en %s: %s
uso:   %s [--list] [--type <tipo>] [nome]
uso: %s [nome]
uso: alternatives --install <ligazón> <nome> <ruta> <prioridade>
debería ligar a %s -> %s
debería eliminar %s
servicios baseados en xinetd:
PK�m�\��LC_MESSAGES/popt.monu�[������|����"',3JQUa{��/��

'C6z~)����������/�,Lh:{#����
	
ARGDOUBLEDisplay brief usage messageFLOATINTLONGNONESTRINGShow this help messageUsage:VAL[OPTION...]aliases nested too deeplyerror in parameter quotinginvalid numeric valuemissing argumentmutually exclusive logical operations requestednumber too large or too smallunknown errnounknown errorunknown optionProject-Id-Version: popt 1.11
Report-Msgid-Bugs-To: <rpm-maint@lists.rpm.org>
PO-Revision-Date: 2001-01-17 01:01+0100
Last-Translator: Jesús Bravo Álvarez <jba@pobox.com>
Language-Team: Galician <trasno@ceu.fi.udc.es>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
ARGDOUBLEAmosar brevemente o xeito de utilizaciónFLOATINTLONGNADACADEAAmosar esta mensaxe de axudaUso:VAL[OPCIÓN...]aliases aniñados a un nivel demasiado profundoerro nas comiñas do parámetrovalor numérico non válidofalta un argumentosolicitáronse operacións lóxicas mutuamente excluíntesnúmero demasiado grande ou pequenoerrno descoñecidoerro descoñecidoopción descoñecidaPK�m�\(ّ�D^D^LC_MESSAGES/gdk-pixbuf.monu�[�������\
�)�&�:Y%y���)�-!6X-q,�,�� -$N*s
�"���*!)Lv�,�0�.
%</b���<�'Db"'���%`C*�R�(""K&n�V�!N(w ��'��"6ZP�8�8�7!O"q&�%�%�BNJ0�.�&�	 *&1$X}�!��"�"$(qM;��$ .? $n *� O� *!%9!/_!-�!e�!%#"xI"�"�"�"##N5#S�#N�#N'$2v$H�$�$�$$%,9%f%,z%2�%"�%"�%# &&D&k&�&U�&Z�&CN'C�'!�' �'&(@(_(-}(4�(4�()!)!()-J)Fx)A�)**!3*	U*_* n*�*&�*9�*2
+D@+D�+3�+�+L,#i, �,�,E�,'-*<--g-C�-)�- .+$.(P. y."�.�.!�."�.!/!7/+Y/G�/2�/90':0b0%h0�0�0%�0)�0V1r1�1�1�1�1�1�1�12-2?2R2$c2�2�2�2�2'�4)�4)'5/Q5/�55�5#�5!6-60<60m64�6'�6C�67?77w7&�7*�7*84,86a8
�8*�8%�8"�8-9CH9D�9%�9#�95:;Q::�:-�:A�:%8;&^;&�;M�;�;)<)<<%f<2�<?�<*�<0*=7[=0�=��=4]>t�>6?.>??m?)�?��?/Z@x�@(A1,A/^A5�A*�A3�A)#BzMB,�BI�BI?C#�C+�C;�C?D)UD#DB�D]�D:DE6E)�E�E�E'�E,F"CF!fF-�F*�F5�F1G)IGlsG=�G+H5JHE�H5�H>�He;I4�I5�I8JHEJ}�J$K�1K�K�K(�KL(8LVaL[�LVMSkMH�M`NiN"oN+�N:�N�N-O?EO5�O5�O3�O5%P.[P�P]�Pb�PK]QK�Q,�Q-"R-PR3~R4�R7�RCS:cS�S�S*�S4�SjT[�T+�TU*&U	QU[U'qU&�U)�U3�U2VLQVL�V0�VWC9W}W�W�WQ�W/+X2[X8�XN�X1Y&HY<oY>�Y'�Y+Z,?Z'lZ4�Z�Z(�Z3[^D[;�[A�[&!\H\)N\,x\-�\1�\8]z>]�]�]�]�]	�]�]�]�]	�]^^^^+^<^@^<kX��yK5��IrtxBL�*?��#^9,�Zqg�R��=\ -�_�����Q�H3$
c��|~�U��1f�m�s(�}�u/��J��`�W���V�4�7)�	phT8�6�
2����N��&�>�FESG'�����jY�liv�Ca�.��z[�@�w�:!��o�n+P��d��D��]���"���O0�A%M��;��{����beA pointer to the pixel data of the pixbufANI image was truncated or incomplete.BMP image has bogus header dataBMP image has oversize paletteBMP image has unsupported depthBMP image has unsupported header sizeBMP image width too largeBad code encounteredBits per SampleBits per channel of PNG image is invalid.Bits per channel of transformed PNG is not 8.Cannot allocate TGA header memoryCannot allocate colormapCannot allocate memory for TGA context structCannot allocate memory for loading PNM imageCannot allocate memory for loading XPM imageCannot allocate new pixbufCannot read XPM colormapCircular table entry in GIF fileColor profile has invalid length %d.Color profile has invalid length “%u”.ColorspaceCompressed icons are not supportedCould not allocate memory: %sCould not create stream: %sCould not decode ICNS fileCould not get image height (bad TIFF file)Could not get image width (bad TIFF file)Could not read from stream: %sCould not seek stream: %sCouldn’t allocate memory for color profileCouldn’t allocate memory for loading JPEG fileCouldn’t allocate memory for saving BMP fileCouldn’t allocate memory for streamCouldn’t allocate memory to buffer image dataCouldn’t decode imageCouldn’t load bitmapCouldn’t load metafileCouldn’t recognize the image file format for file “%s”Couldn’t saveCouldn’t write to BMP fileCouldn’t write to TIFF fileCursor hotspot outside imageDimensions of TIFF image too largeError interpreting JPEG image file (%s)Error reading ICNS image: %sError while decoding colormapError writing to image file: %sError writing to image streamFailed to allocate %d byte for file read bufferFailed to allocate %d bytes for file read bufferFailed to allocate QTIF context structure.Failed to close “%s” while writing image, all data may not have been saved: %sFailed to create GdkPixbufLoader object.Failed to find an image data atom.Failed to load RGB data from TIFF fileFailed to load TIFF imageFailed to load animation “%s”: reason not known, probably a corrupt animation fileFailed to load image “%s”: %sFailed to load image “%s”: reason not known, probably a corrupt image fileFailed to open TIFF imageFailed to open file “%s”: %sFailed to open temporary fileFailed to open “%s” for writing: %sFailed to read QTIF headerFailed to read from temporary fileFailed to save TIFF imageFailed to skip the next %d byte with seek().Failed to skip the next %d bytes with seek().Failed to write TIFF dataFailed to write to temporary file when loading XBM imageFailed to write to temporary file when loading XPM imageFailure reading GIF: %sFatal error in PNG image file: %sFatal error reading PNG image fileFatal error reading PNG image file: %sFile does not appear to be a GIF fileFile error when reading QTIF atom: %sGIF file was missing some data (perhaps it was truncated somehow?)GIF image has no global colormap, and a frame inside it has no local colormap.GIF image is corrupt (incorrect LZW compression)GIF image loader cannot understand this image.GIF image was truncated or incomplete.Has AlphaHeightICO image was truncated or incomplete.Image file “%s” contains no dataImage format unknownImage header corruptImage is too wide for BMP format.Image pixel data corruptImage too large to be saved as ICOImage type currently not supportedImage type “%s” is not supportedImage-loading module %s does not export the proper interface; perhaps it’s from a different gdk-pixbuf version?Incremental loading of image type “%s” is not supportedInput file descriptor is NULL.Insufficient memory to load PNG fileInsufficient memory to load PNM context structInsufficient memory to load PNM fileInsufficient memory to load XBM image fileInsufficient memory to load image, try exiting some applications to free memoryInsufficient memory to open JPEG 2000 fileInsufficient memory to open TIFF fileInsufficient memory to save image into a bufferInsufficient memory to save image to callbackInsufficient memory to store a %lu by %lu image; try exiting some applications to reduce memory usageInternal error in the GIF loader (%s)Internal error: Image loader module “%s” failed to complete an operation, but didn’t give a reason for the failureInvalid XBM fileInvalid XPM headerInvalid header in animationInvalid header in iconInvalid header in icon (%s)JPEG quality must be a value between 0 and 100; value “%d” is not allowed.JPEG quality must be a value between 0 and 100; value “%s” could not be parsed.JPEG x-dpi must be a value between 1 and 65535; value “%s” is not allowed.JPEG y-dpi must be a value between 1 and 65535; value “%s” is not allowed.Keys for PNG text chunks must be ASCII characters.Keys for PNG text chunks must have at least 1 and at most 79 characters.LoopMalformed chunk in animationMaximum color value in PNM file is 0Maximum color value in PNM file is too largeNo XPM header foundNot all frames of the GIF image were loaded.Not enough memory to composite a frame in GIF fileNot enough memory to load GIF fileNot enough memory to load ICO fileNot enough memory to load animationNot enough memory to load bitmap imageNot enough memory to load iconNumber of ChannelsPNG compression level must be a value between 0 and 9; value “%d” is not allowed.PNG compression level must be a value between 0 and 9; value “%s” could not be parsed.PNG x-dpi must be greater than zero; value “%s” is not allowed.PNG y-dpi must be greater than zero; value “%s” is not allowed.PNM file has an image height of 0PNM file has an image width of 0PNM file has an incorrect initial bytePNM file has an invalid heightPNM file has an invalid widthPNM file is not in a recognized PNM subformatPNM image loader does not support this PNM subformatPNM loader expected to find an integer, but didn’tPixel BytesPixelsPremature end-of-file encounteredPseudocolor image does not contain a colormapQTIF atom size too large (%d byte)QTIF atom size too large (%d bytes)Raw PNM formats require exactly one whitespace before sample dataRaw PNM image type is invalidReadonly pixel dataResulting GIF image has zero sizeRowstrideStack overflowTGA image has invalid dimensionsTGA image type not supportedTGA image was truncated or incomplete.TIFF bits-per-sample doesn’t contain a supported value.TIFF compression doesn’t refer to a valid codec.TIFF x-dpi must be greater than zero; value “%s” is not allowed.TIFF y-dpi must be greater than zero; value “%s” is not allowed.The colorspace in which the samples are interpretedThe number of bits per sampleThe number of bytes between the start of a row and the start of the next rowThe number of columns of the pixbufThe number of rows of the pixbufThe number of samples per pixelThis build of gdk-pixbuf does not support saving the image format: %sTopdown BMP images cannot be compressedTransformed JPEG has zero width or height.Transformed JPEG2000 has zero width or heightTransformed PNG has unsupported number of channels, must be 3 or 4.Transformed PNG has zero width or height.Transformed PNG not RGB or RGBA.Unable to load image-loading module: %s: %sUnexpected bitdepth for colormap entriesUnexpected end of PNM image dataUnexpected icon chunk in animationUnrecognized image file formatUnsupported JPEG color space (%s)Unsupported depth for ICO file: %dUnsupported icon typeUnsupported image format for GDI+Unsupported number of color components (%d)Value for PNG text chunk %s cannot be converted to ISO-8859-1 encoding.Version %s of the GIF file format is not supportedWhether the animation should loop when it reaches the endWhether the pixbuf has an alpha channelWidthWidth or height of TIFF image is zeroXPM file has image height <= 0XPM file has image width <= 0XPM file has invalid number of colorsXPM has invalid number of chars per pixelfailed to allocate image buffer of %u bytefailed to allocate image buffer of %u bytesimage formatBMPimage formatEMFimage formatGIFimage formatJPEGimage formatJPEG 2000image formatMacOS X iconimage formatPNGimage formatPNM/PBM/PGM/PPMimage formatQuickTimeimage formatTIFFimage formatTargaimage formatWMFimage formatWindows animated cursorimage formatWindows iconimage formatXBMimage formatXPMProject-Id-Version: gtk+-master-po-gl-77922___.merged
Report-Msgid-Bugs-To: https://bugzilla.gnome.org/enter_bug.cgi?product=gdk-pixbuf&keywords=I18N+L10N&component=general
POT-Creation-Date: 2017-12-05 15:46+0000
PO-Revision-Date: 2018-02-10 19:46+0200
Last-Translator: Fran Dieguez <frandieguez@gnome.org>
Language-Team: Galician
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
X-Project-Style: gnome
Un punteiro ao datos do pixel do pixbufA imaxe ANI está truncada ou incompleta.A imaxe BMP ten datos de cabeceira falsosA imaxe BMP ten ten unha paleta grande de máisA imaxe BMP ten unha profundidade incompatíbelA imaxe BMP ten un tamaño de cabeceira non permitidoAncho de imaxe BMP demasiado grandeEncontrouse un código incorrectoBis por mostraOs bits por canal non son válidos na imaxe PNG.Os bits por canal do PNG transformado non son 8.Non é posíbel asignar memoria para a cabeceira TGANon é posíbel asignar o mapa de coresNon é posíbel asignar memoria para a estrutura de contexto de TGANon é posíbel asignar memoria para cargar a imaxe PNMNon é posíbel asignar memoria para cargar a imaxe XPMNon é posíbel asignar un novo pixbufNon é posíbel ler o mapa de cores de XPMEntrada de táboa circular no ficheiro GIFO perfíl de cor ten unha lonxitude '%d' incorrecta.O perfil de cor ten unha lonxitude «%u» non válida.Espazo de corAs iconas comprimidas non son compatíbeisNon é posíbel asignar a memoria: %sNon foi posíbel crear o fluxo: %sNon foi posíbel descodificar o ficheiro ICNSNon foi posíbel obter a altura da imaxe (ficheiro TIFF incorrecto)Non foi posíbel obter a largura da imaxe (ficheiro TIFF incorrecto)Non é posíbel ler desde o fluxo: %sNon foi posíbel buscar o fluxo: %sNon foi posíbel asignar memoria para o perfil de corNon é posíbel asignar memoria para cargar o ficheiro JPEGNon é posíbel asignar memoria para gardar o ficheiro BMPNon foi posíbel asignar memoria para o fluxoNon foi posíbel asignar memoria para os datos de imaxe do búferNon foi posíbel descodificar a imaxeNon foi posíbel cargar o mapa de bitsNon foi posíbel cargar o metaficheiroNon foi posíbel recoñecer o formato do ficheiro de imaxe no ficheiro «%s»Non foi posíbel gardarNon foi posíbel escribir no ficheiro BMPNon foi posíbel escribir o ficheiro TIFFPunto activo do cursor fóra da imaxeAs dimensións da imaxe TIFF son demasiado grandesProduciuse un erro ao interpretar o ficheiro de imaxe JPEG (%s)Produciuse un erro ao ler a imaxe ICNS: %sProduciuse un erro ao descodificar o mapa de corProduciuse un erro ao escribir no ficheiro de imaxe: %sProduciuse un erro ao escribir no fluxo de imaxeProduciuse un erro ao asignar %d byte para o búfer de lectura de ficheirosProduciuse un erro ao asignar %d bytes para o búfer de lectura de ficheirosProduciuse un fallo na asignación do contexto QTIF.Produciuse un erro ao pechar «%s» mentres se escribía a imaxe; é posíbel que non se gardaran todos os datos: %sProduciuse un erro ao crear o obxecto GdkPixbufLoader.Non de puido atopar un atom de datos de imaxe.Produciuse un erro ao cargar os datos RGB desde o ficheiro TIFFProduciuse un erro ao cargar a imaxe TIFFProduciuse un erro ao cargar a animación «%s»: o motivo é descoñecido, é probábel que o ficheiro da animación estea danadoProduciuse un erro ao cargar a imaxe «%s»: %sProduciuse un erro ao cargar a imaxe «%s»: o motivo é descoñecido, é probábel que o ficheiro de imaxe estea danadoProduciuse un erro ao abrir a imaxe TIFFProduciuse un erro ao abrir o ficheiro «%s»: %sProduciuse un erro ao abrir o ficheiro temporalProduciuse un erro ao abrir «%s» para escritura: %sProduciuse un erro ao ler a cabeceira QTIFProduciuse un erro ao ler desde o ficheiro temporalProduciuse un erro ao gardar a imaxe TIFFProduciuse un erro ao saltar o seguinte %d byte con seek().Produciuse un erro ao saltar os seguintes %d bytes con seek().Produciuse un erro ao escribir os datos TIFFProduciuse un erro ao escribir no ficheiro temporal ao cargar a imaxe XBMProduciuse un erro ao escribir no ficheiro temporal ao cargar a imaxe XPMProduciuse un erro ao ler o GIF: %sErro moi grave no ficheiro de imaxe PNG: %sProduciuse un erro moi grave ao ler o ficheiro de imaxe PNGProduciuse un erro moi grave ao ler o ficheiro de imaxe PNG: %sO ficheiro non parece ser un ficheiro GIFProduciuse un erro ao ler o GIF: %sAo ficheiro GIF fáltanlle algúns datos (foron talvez truncados?)A imaxe GIF non ten un mapa de cores global e o marco interno non ten un mapa de cores local.A imaxe GIF está danada (a compresión LZW é incorrecta)O cargador de imaxes GIF non pode entender esta imaxe.A imaxe GIF está truncada ou incompleta.Ten alfaAltoA imaxe ICO foi truncada ou incompleta.O ficheiro de imaxe «%s» non contén datosO formato de imaxe é descoñecidoA cabeceira da imaxe está danadaA imaxe é demasiado ancha para o formato BMPOs datos do píxel da imaxe están danadosA imaxe é demasiado grande para ser gardada como ICOEste tipo de imaxe non é compatíbel actualmenteO tipo de imaxe «%s» non é compatíbelO módulo de carga de imaxes %s non exporta a interface axeitada; é dunha versión do gdk-pixbuf diferente?A carga incremental das imaxes do tipo «%s» non é posíbelO descritor do ficheiro de entrada é NULL.Non hai suficiente memoria para cargar o ficheiro PNGNon hai suficiente memoria para cargar a estrutura de contexto do PNMNon hai suficiente memoria para cargar o ficheiro PNMNon hai suficiente memoria para cargar o ficheiro de imaxe XBMNon hai suficiente memoria para cargar a imaxe, tente saír dalgúns aplicativos para liberar memoriaMemoria insuficiente para abrir o ficheiro JPEG 2000Non hai suficiente memoria para abrir o ficheiro TIFFNon hai suficiente memoria para gardar a imaxe no búferNon hai suficiente memoria para gardar a imaxe para a chamada de retornoNon hai memoria dabondo para almacenar unha imaxe %lu por %lu; tente saír dalgúns aplicativos para reducir o uso de memoriaErro interno no cargador de GIF (%s)Erro interno: Produciuse un erro ao completar unha operación co módulo de carga de imaxes «%s», mais non deu ningún motivo do falloO ficheiro XBM é incorrectoCabeceira XPM incorrectaA cabeceira na animación non é válidaCabeceira non válida na iconaA cabeceira non é válida na icona (%s)A calidade dun JPEG debe ser un valor entre 0 e 100; o valor '%d' non está permitido.A calidade dun JPEG debe ser un valor entre 0 e 100; o valor «%s» non pode ser analizado.O x-dpi do JPEG debe ser un valor entre 1 e 65535; o valor «%s» non está permitido.O y-dpi JPEG debe ser un valor entre 1 e 65535; o valor «%s» non está permitido.As chaves para os fragmentos de texto de PNG deben ser caracteres ASCII.As chaves para os fragmentos de texto de PNG deben ter polo menos 1 carácter e como máximo 79.BucleFragmento malformado na animaciónO valor máximo de cor no ficheiro PNM é 0O valor máximo de cor no ficheiro PNM é demasiado grandeNon se atopou a cabeceira XPMNon se cargaron todos os marcos da imaxe GIF.Non hai suficiente memoria para compor un marco no ficheiro GIFNon hai suficiente memoria para cargar o ficheiro GIFNon hai suficiente memoria para cargar o ficheiro ICONon hai suficiente memoria para cargar a animaciónNon hai suficiente memoria para cargar o mapa de bitsNon hai suficiente memoria para cargar a iconaNúmero de canlesO nivel de compresión PNG debe ser un valor entre 0 e 9; o valor «%d» non está permitido.O nivel de compresión PNG debe ser un valor entre 0 e 9; non é posíbel analizar o valor «%s».O x-dpi do PNG debe ser maior que cero; o valor «%s» non está permitido.O y-dpi do PNG debe ser maior que cero; o valor «%s» non está permitido.O ficheiro PNM ten unha altura de imaxe de 0O ficheiro PNM ten unha largura de imaxe de 0O ficheiro PNM ten un byte inicial incorrectoO ficheiro PNM ten unha altura de imaxe non válidaO ficheiro PNM ten unha largura de imaxe non válidaO ficheiro PNM non está nun subformato PNM recoñecidoO cargador de imaxes PNM non é compatíbel con este subformato PNMO cargador PNM esperaba atopar un enteiro, mais non o fixoBytes do pixelPixelesEncontrouse un final de ficheiro prematuroA imaxe en falsas cores non contén un mapa de coresO tamaño do QTIFF atom é demasiado longo (%d byte)O tamaño do QTIFF atom é demasiado longo (%d bytes)Os formatos PNM en bruto requiren exactamente un espazo en branco antes dos datos de mostraO tipo de imaxe PNM en bruto non é válidoDatos do pixel de só lecturaA imaxe GIF resultante ten un tamaño ceroRowstrideDesbordamento da pilaA imaxe TGA ten dimensións incorrectasO tipo de imaxe TGA non é compatíbelA imaxe TGA está truncada ou incompleta.TIFF bits-por-mostra non contén un valor admitido.A compresión TIFF non informa dun códec válido.O x-dpi do TIFF debe ser maior que cero; o valor «%s» non está permitido.O y-dpi do TIFF debe ser maior que cero; o valor «%s» non está permitido.O espazo de cor no cal se interpretan as mostrasO número de bits por mostraO número de bytes entre o inicio dunha fila e o inicio da seguinteO número de columnas do pixbufo número de filas do pixbufO número de mostras por pixelEsta construción de gdk-pixbuf non permite a gravación de imaxes co formato: %sNon é posíbel comprimir as imaxes BMP TopdownO JPEG transformado ten cero en largura ou altura.O JPEG 2000 transformado ten unha largura ou altura ceroO PNG transformado posúe un número de canais non admitido: deben ser 3 ou 4.O PNG transformado ten cero en largura ou altura.O PNG transformado non é RGB ou RGBA.Non foi posíbel cargar o módulo de carga de imaxes: %s: %sProfundidade de cor inesperada para as entradas do mapa de corFinal inesperado dos datos da imaxe PNMFragmento de icona inesperado na animaciónFormato do ficheiro de imaxe non recoñecidoEspazo de cor JPEG non compatíbel (%s)Profundidade non compatíbel para o ficheiro ICO: %dTipo de icona non compatíbelFormato de imaxe incompatíbel para GDI+Número de compoñentes de cor non compatíbel (%d)Non é posíbel converter o valor do fragmento de texto %s de PNG á codificación ISO-8859-1.A versión %s do formato de ficheiro GIF non é compatíbelIndica que a animación debería reiniciarse cando chega ao finalINdica se o pixbuf ten unha canle alfaAnchoA largura ou altura da imaxe TIFF é ceroO ficheiro XPM ten unha altura de imaxe <= 0O ficheiro XPM ten unha largura de imaxe <= 0O ficheiro XPM ten un número incorrecto de coresO XPM ten un número incorrecto de caracteres por píxelProduciuse un erro ao asignar un búfer de imaxe de %u bytes Produciuse un erro ao asignar un búfer de imaxe de %u bytesBMPEMFGIFJPEGJPEG 2000Icona de MacOS XPNGPNM/PBM/PGM/PPMQuickTimeTIFFTargaWMFCursor animado da xanelaIconas de xanelaXBMXPMPK�m�\8F@9�9�LC_MESSAGES/glib20.monu�[�����l|#��Fx^.y^7�^_�^1@_&r_�_9�_Q�_9B`+|`�`�`&�`a	aaa#a+a3a<aEaMaVa_agaoaxa�a�a�a�a�a�a�a�a�a�a�a�a:�a0b<bDb]blbY}b_�ba7c�c�c�c�c)d@0d*qd�d!�d"�d�de'4e4\e;�e,�e&�e%!fEGfR�f(�fZ	g+dg#�g"�g(�gJh,Kh/xh!�h[�h&&i6Mi'�i-�i1�iij"vj9�jJ�j<k$[k*�k1�k$�kl	ll(l	8l
BlMlBll!�l�l�l5�l)1m[mOpmU�m8nOngn}n?�n+�n�n
o "o0Co!to�o�o4�o�o(p=-p)kp,�p(�p4�p& qGq^dqa�qg%rB�r"�r��r/�s)�s*�st"&t&It1pt0�t$�t"�t8u>Tu%�u�u�u4�u;$v#`v6�v1�v8�v-&w3Tw/�w1�w%�w"x,3x`x)~x!�x �xA�x�-y�y�y"z"(z#Kz	oz
yz7�z��{�o|/}$E}j}�}�}�}�})�}.~K~&k~C�~4�~60Bs2��d�1�&K�r�"��$��,΀��#�2>�6q�'��'Ё+��$�7�K�/e���*��ق�	���%�:�S�(k�!����$Ճ��:�$Q�&v�a��F��4F�2{�:��A�@+�;l�W��W�1X�/��2��6�$�$B�)g�A��ӈ؈?ވ5�)T�$~�$��&ȉ%�&�<�IK�����Ɗߊ����y��>!��`� ��(�G�^�){�7��/ݍ!
�/�F�_�x�����ǎ%�%
�+3�Q_���͏�(�?4�Ht�M��=�HI�x��!�!-�!O�q�����$��ߒ��,�,F�%s�$����0֓�'�A�&a�����A”*�!/�Q�j���"��ĕ���!�<�U�'r���$��ܖ���)�MC�!��-��-��'�<E���,��&ɘ��#�Y=�&��9��6��4/�:d�%��.Ś0�=%�8c�(��$ś�� �
8�"C�(f�%����%Ԝ*��.%�4T�0��$��$ߝ'�$,�$Q�'v���4���_�Mc�B��=�$2��W�G�;7�Ms�!���	����+�"D�?g���$Ƣ-�%�5?�u�!��C��=�(-�1V�.��)�� �1�/4��d�2�&"�+I�3u�#��%ͦ-�8!�AZ�%��?§1�14�.f�)��!��"��*�J�TZ�+��۩5�*&�Q�d�z�������.ƪ��K�Z�Dq���%˫&��-� 5�"V� y�!��1��
���(
�26�2i�2���ϭ&q�>��"׮ ���60�&g�%��%��*گ#�)�A�$Y�~�������%ܰ3�-6�(d�(��(��߱)��)�A�ZP���˲ܲ���7-�ue�-۳?	�GI�J��ܴ��+�$@�0e���+��!�� �#>�#b���1��2Ҷ^�Ld�E��P��/H�%x�5��$ԸG��WA�����4��(�!�E8�~�����3��G�v(����1U�;��ü߼#��,"�EO�&����Խ�)�2�;I�;����"ʾ3�9!�[�@x�"��DܿV!�Ex�@��1��1�K�\�ht�.�)�<6�s���)��)��6��&�9�X�x���!��&��'���+0�'\�3��������*���+�G�0f�5�� �� ���2$�DW�"�� ��%���*�F�=Y���������~��}�+��H��B	�L�b�v���-��-��(�*�>�X�)v�������#���)#�IM�)���������L0�N}����z}���)�>�'T�X|�����-�?3�8s�*����'���	(�2�27�8j�-��*��5��@2�6s�4��?��*�!J�l�0��L��
�	"�
,�:�V�
f�q�
��"��#�������)0�4Z���'��1��!�*)�T�h���
������9��1�+F�r�*����
��������"� *�%K�Aq�a��]�.s�@��*��5�5D�z�@��8��U��!Q�s�F��/���!�>�\�"r�i�����/�F�X� j�!����
����H��<�Q�j���#�� �������7�<�Y�l�!��*��8��&
�J4�B���-��R�*c�3��6����C�Y�s�&����N��&� ?�`�+{���5��"��)�-C�1q�'��-��+��)%�)O�-y�2��#��Y��X�Vk���"�����,�$@�%e� ��?��.���82�k���!��.��.��/�0M�-~�"����<��%*�!P�r�����4����2�I�Oh�C��"��9�0Y�8��'��.��!�<�Y�m�.��������>��"8�[�z�C����(����-�H2�2{���������"��t����6�L�j�)��1��)��6
�A�0G�x�2��7��1��)� H�Ri�L��_	��i�1��23�;f�����+�&�	=�	G�	Q�[�g�|�����&����)�_,�?��?�%�2�M�h���������
�%�@�[�#v�#��#��#�#�#*�#N�#r�#��#��#�#�&�C�`�}������/�*!�)L�/v�?���DU
p/{0�
�1�- Mn�B���-7M+����#�M#,q6��(�)@Yr������)H!h!� ���	(!E g"�����,F4b���PN	V
�W��%�

)
F
"U
cx
!�
$�
#*;+f2�(��"
-!Eg)}%�%�/�;#%_C�'�'�G:a'��	�&�
1%Q w
��^�c!2�%���&$,Qq
��#��3�'=G�+�8�(/	?I/i���
��$-&H o �"���� 89 r)���"� =�^(SF|{�*? j"�?�T�BC0�"��&�&.7@HPYbjs|�������������
�BUiq
��b�k lx � #!'!E!4\!B�!2�!"$"-?"m"%�"2�"H�"7,#$d#'�##�#I�#L$)l$o�$,%!3% U%*v%R�%/�%8$&]&f}&(�&4
'.B'3q'5�'d�' @(=a(X�(G�("@)'c)B�)$�)�)�)**/*	8*0B*Ms**�*�*+E!+6g+�+a�+o,5�,�,�,�,G
-5U-�-�-%�-2�-9.+E.!q.:�.�.,�.C/8D/5}/=�/[�/=M0)�0x�0|.1|�1](21�2��2;P38�37�3'�3B%4Bh4N�4N�4,I5*v5U�5f�57^6)�6*�6K�6T77<�7L�7G8H^8C�8I�8E59G{96�92�99-:+g:%�:(�:'�:E
;�P;"�;(<&;<&b<(�<�<�<;�<��=��>4~?(�?&�?@@!9@[@0o@7�@%�@9�@E8A9~A9�A;�A.B2KB~Bz�B C2-C`C+|C-�C4�C)D25D5hD9�D6�D8ECHE�E�E�E.�E!�E'F?FGF
SF0^F*�F�F!�F5�F1G!QG&sG�GD�G-�G,+HuXHX�H?'I?gIP�IT�IFMJ@�Jg�Jk=K:�K<�K/!L7QL#�L,�L8�LDMXM]MHfMG�M0�M1(N-ZN+�N-�N,�NO^ OO�O&�O!�OP�P��PTVQ��Q)6R`R-{R#�R.�R:�RO7S=�S8�S+�S,*T)WT.�T#�T4�T/	U/9U<iUF�U_�U,MV-zV-�VI�VC WKdW`�WAXJSX|�X3Y2OY8�Y-�Y�Y	Z3Z-RZ-�ZH�ZB�ZD:[;[+�[B�[0*\+[\/�\6�\)�\*]gC]B�].�]'^+E^0q^I�^3�^6 _0W_6�_%�_)�_6`/F`6v`,�`,�`&a*.a]Ya8�aA�aI2b3|b1�bf�b;IcX�c8�c-d5Ed,{dq�d<eCWeE�eA�eJ#f0nfM�f;�fS)gX}gK�g;"h.^h/�h(�h	�h'�h.i+Gi si0�i0�i4�i-+j-Yj$�j+�j.�j.k)6k,`k�kA�k�k\lcalK�lGm+Ym��m\1nz�nP	o'Zo�o
�o�o&�o7�o1pR:p3�p3�p:�p80qGiq%�q6�qUrOdr9�r@�r8/s<hs1�sB�s@t�[t?u6Cu;zuM�u:v5?v:uvM�vS�v@RwT�wD�wD-x-rx8�x)�x,y%0yDVy�y[�y3zIz6bz,�z�z�z�z�z{{6{={QY{�{J�{,|.A|/p|�|�|3�|'�|2}(N}Bw}�}�}7�}2~CN~C�~��~8�E�,�+2�^�;x�=��+�&�7E�/}�!��ρ5��!0�R�'h�(��G��C�5E�6{�6���=	�G�e�by�&܄!�$%�J�h���N��~�4r�I��L�H>���+�� χ�/�>?�+~�2��!݈2��&2�&Y�"����A��A�iC�Y��H�ZP�@��(�7�%M�Fs�Y���!�67�4n�2��J֍!�(� ;�6\�]�������:a�M���$�%*�4P�N��.ԑ��#?�0c���>��>�1�::�Ju�P��/�IA�4��Y��_�Sz�CΕA�T�p������;,�9h�Y�����..�1]�A��ј%�&�*9�d�,w�&��)˙��1�2C�:v�����К2�-�*J�,u�9��@ܛ0�0N�#�@��F�0+�-\�6����?ܝ �G=�!�� ��&Ȟ�����4ϟQ�cV���ՠ��3-�3a�.��ġ'�&�R3�0����Ѣ/�/�:E�S��.ԣ*�!.�&P�w�c��i���c��/���.ئ�0�iP���ӧ+�F�Da�/��	֨,�
�
'�2�?:�Jz�>ũ.�;3�Oo�C��<�K@�;��$ȫ$�4�\G�����ˬ!ݬ���(�D�(U�)~���(ȭ(�1�ML�#��1��&�$�-<�2j�����ү�#��R!�/t�3��.ذI�Q�g�v�������ű$α(�D�ia�e˲:1�Wl�@ijA�8G���G��Aδ\�#m���>��A�#1�4U�#����)ʶV�#K�"o�����η,�-�&F�m�~�[��)��!�!A�c�z�'����'ֹ/��.�!3�U�#u�,��"ƺ:�-$�MR�A��(�:�MF�'��>��6��2�=N�����&���Y��"X�&{�"��+ž�9�(J�*s�0��2Ͽ�6!�&X�,�,��/�:	�'D�il� �|��!t�/��������*�$A�f�<��-����?�N�"_�1��C��Q��<J�;��K��.�&>�Ae�0��(��.�(0�+Y�Z��0��1�(C�Pl�?��!��F�3f�C��+��9
�&D�#k�����B��	�''�O�Hg�(��'���W�	k�8u���5��P��7>�"v������� �����d�=K�/�� ��(��2�=6�Ot���M���</�Dl�;��#��'�[9�H��Z���9�2����/
�3=�+q���!��2��2
�	=�	G�Q�X�e�{�����*������)	�y3�T��O�,R��������������������������������������������������������������;�.<�2k�4��A��)�?�RK�&����;��<�U�0n���,��-��	�$'�BL���%������%��6�/P�!��%����;��|�<��A��%�B<�������������������������������������
����&�/�6�;�C�K�Q�	X�Kb�����|��F���������"z�)����������m8�%��0����5�2P�2��2��*��6� K�)l���0��*��$�;1�Em� ��@��"�%8�F^�C��'���	.�*8�c�t�,��/�����0�}L����>L�-��$����3��('�'P�*x�
����)����?��'5�(]�B��#��0��B�$a���	��'��?��
�#!� E�f� x�3���.�(�(=�&f�������$�?��!6�/X�'��"��"���"��	=/a��|^c������y�M�08i����.X���W����#j�A4�;3%�yU?���G.8�w$F+��/����3�����V�������%�����I��sx[��,�pj��5�U���,P���2�j���Y���X�w�2�Fq�:��W	��
c�����0f(	�bB���� DkT~��������\G�������� B���`:4_uIN14��StQ����Y]��;H'L�WA��b<��X�;*z��>h#�B:&0���yL����<o{-�&
���sjW��%����Ud{�2������vk#�������C�V�BYD�<��9�"�"�]"�0]rY?���������;����N���nlnT�8����TE-������J�\�e����f\7���6>)�l7
bk~�UJ�_!c�� R-]z��MG�
~HH��26!B��N�
 ��{Y�C�\�,�e��Xi�i�`��K�5U���i��m�(���6a�Asl�rxqm'��h�~)�N����-5���`�Kg��ce�w(�2&?9O5������Pw�����mi3�k�������}j+�DF�
��]<�^l�)a/q*�O����P���@��=('�!d �4����hK���6En$T�c��
=_@9b�WFu����C��}Hr�aQ��v��,>/EL'��%:y��[��#��Z�ALII8�^}�J+�3�E%z�&�����>X��^�e$$6o^QE�+���S��"���q�4pg���}�&Rgf7#*d��p���K<M.���{�����|�Z1�r�KO@Z�7����QZ��J����)��@D������[�Ln��������m_3��T�O���M���.��[/O���9fx+�I�PZ�
�����k������,7CN���9���CJV'���D�AV*-�x��dz����s���
"��g*���t�G�)�`�Sf�t:a>!F�������
�0�|��$����S	.p=��R�	?��!?h��5;��|��R�lv1�Qd�M����v�8g1�=���S��R��1[ou(h��uVP���b��G��@�to�eH�`�\�_���  COMMAND   The (optional) command to explain
  FILE      An elf file (a binary or a shared library)
  FILE      An elf file (a binary or a shared library)
            or a compiled resource file
  KEY       The (optional) key within the schema
  KEY       The key within the schema
  PATH      A resource path
  PATH      An (optional) resource path (may be partial)
  SCHEMA    The name of the schema
  PATH      The path, for relocatable schemas
  SCHEMADIR A directory to search for additional schemas
  SECTION   An (optional) elf section name
  VALUE     The value to set
 (invalid encoding) and --strict was specified; exiting.
%.1f EB%.1f Eb%.1f EiB%.1f Eib%.1f GB%.1f Gb%.1f GiB%.1f Gib%.1f KB%.1f KiB%.1f Kib%.1f MB%.1f Mb%.1f MiB%.1f Mib%.1f PB%.1f Pb%.1f PiB%.1f Pib%.1f TB%.1f Tb%.1f TiB%.1f Tib%.1f kB%.1f kb%s bit%s bits%s byte%s bytes%s command requires an application id to directly follow

%s filetype%s type%s: overwrite “%s”? %u bit%u bits%u byte%u bytes'%s' is not a valid character following a '<' character; it may not begin an element name'%s' is not a valid character following the characters '</'; '%s' may not begin an element name'%s' is not a valid character following the close element name '%s'; the allowed character is '>''%s' is not a valid name'%s' is not a valid name: '%c'(*MARK) must have an argument(*VERB) not recognized(?R or (?[+-]digits must be followed by )(Additionally, releasing the lock for “%s” also failed: %s) (Type any character to close this window)
) without opening (--strict was specified; exiting.
; ignoring override for this key.
<%s id='%s'> already specified<%s id='%s'> not (yet) defined.<%s> contains a string not in <choices><%s> contains string not in the specified flags type<%s> is not a valid member of the specified enumerated type<%s> is not contained in the specified range<%s> must contain at least one <value><alias value='%s'/> already specified<alias value='%s'/> given when <choice value='%s'/> was already given<alias value='%s'/> given when “%s” is already a member of the enumerated type<aliases> already specified for this key<aliases> can only be specified for keys with enumerated or flags types or after <choices><aliases> must contain at least one <alias><child name='%s'> already specified<choice value='%s'/> already given<choices> already specified for this key<choices> cannot be specified for keys tagged as having an enumerated type<choices> must contain at least one <choice><choices> not allowed for keys of type “%s”<key name='%s'> already specified<key name='%s'> shadows <key name='%s'> in <schema id='%s'>; use <override> to modify value<override name='%s'> already specified<override> given but schema isn’t extending anything<range/> already specified for this key<range> not allowed for keys of type “%s”<range> specified minimum is greater than maximum<schema id='%s' list-of='%s'> extends <schema id='%s' list-of='%s'> but “%s” does not extend “%s”<schema id='%s'> already specified<schema id='%s'> extends not yet existing schema “%s”<schema id='%s'> is a list, extending <schema id='%s'> which is not a list<schema id='%s'> is list of not yet existing schema “%s”<value nick='%s'/> already specifiedA bookmark for URI “%s” already existsA path, if given, must begin and end with a slashA subtree is already exported for %sACTIONAPPIDAPPID ACTION [PARAMETER]APPID [FILE…]ATTRIBUTEATTRIBUTESAbort on any errors in schemasAbstract UNIX domain socket addresses not supported on this systemAbstract name space not supportedActivate an actionAdded socket is closedAddress element “%s” does not contain a colon (:)Address has bits set beyond prefix lengthAddress to listen onAddress “%s” is invalid (need exactly one of path, tmpdir or abstract keys)Amount of memory required to process the write is larger than available address spaceAn object is already exported for the interface %s at %sAnonymous access deniedAppend to end of fileApplication Options:Application identifier in D-Bus format (eg: org.example.viewer)Application information lacks an identifierArguments:
Attribute not specifiedAttribute value must be non-NULLAttribute “%s” of element “%s” not foundBackup existing destination filesBackup file creation failedBad HTTP proxy replyC identifier name used for the generated source codeCOMMANDCancellable initialization not supportedCancelled via GDBusAuthObserver::authorize-authenticated-peerCannot add keys to a “list-of” schemaCannot autolaunch D-Bus without X11 $DISPLAYCannot be a list of a schema with a pathCannot convert fallback “%s” to codeset “%s”Cannot decrypt PEM-encoded private keyCannot deserialize message: Cannot determine bus address because the DBUS_STARTER_BUS_TYPE environment variable is not setCannot determine bus address from DBUS_STARTER_BUS_TYPE environment variable - unknown value '%s'Cannot determine bus address from DBUS_STARTER_BUS_TYPE environment variable — unknown value “%s”Cannot determine session bus address (not implemented for this OS)Cannot extend a schema with a pathCannot invoke method; proxy is for a well-known name without an owner and proxy was constructed with the G_DBUS_PROXY_FLAGS_DO_NOT_AUTO_START flagCannot listen on unsupported transport “%s”Cannot parse double value “%s” for %sCannot parse integer value “%s” for %sCannot serialize message: Cannot set permissions on symlinksCannot spawn a message bus when setuidCannot spawn a message bus without a machine-id: Cannot specify nonce file when creating a serverCannot truncate GBufferedInputStreamCannot truncate GMemoryInputStreamCannot use datagram operations on a non-datagram socket.Cannot use datagram operations on a socket with a timeout set.Can’t copy directory over directoryCan’t copy over directoryCan’t copy special fileCan’t create user MIME configuration folder %s: %sCan’t create user application configuration folder %s: %sCan’t create user desktop file %sCan’t do a raw read in g_io_channel_read_line_stringCan’t do a raw read in g_io_channel_read_to_endCan’t handle the supplied version of the icon encodingCan’t handle version %d of GEmblem encodingCan’t handle version %d of GEmblemedIcon encodingCan’t handle version %d of GFileIcon encodingCan’t handle version %d of GThemedIcon encodingCan’t move directory over directoryCan’t recursively copy directoryCan’t rename file, filename already existsCan’t rename root directoryChannel terminates in a partial characterCharacter out of range for UTF-16Character out of range for UTF-8Character reference '%-.*s' does not encode a permitted characterCharacter reference did not end with a semicolon; most likely you used an ampersand character without intending to start an entity - escape ampersand as &amp;Check if KEY is writableChild process exited abnormallyChild process exited with code %ldChild process killed by signal %ldChild process stopped by signal %ldCommands:Commands:
Commands:
  help         Shows this information
  introspect   Introspect a remote object
  monitor      Monitor a remote object
  call         Invoke a method on a remote object
  emit         Emit a signal
  wait         Wait for a bus name to appear

Use “%s COMMAND --help” to get help on each command.
Compile a resource specification into a resource file.
Resource specification files have the extension .gresource.xml,
and the resource file have the extension called .gresource.Compile all GSettings schema files into a schema cache.
Schema files are required to have the extension .gschema.xml,
and the cache file is called gschemas.compiled.Concatenate files and print to standard output.Concatenate files to standard outputConnect to given D-Bus addressConnect to the session busConnect to the system busConnection Endpoint Options:Connection in progressConnection refused through SOCKSv5 proxy.Connection through SOCKSv4 server was rejectedContaining mount does not existContaining mount for file %s not foundConversion from character set “%s” to “%s” is not supportedCopy (reflink/clone) between mounts is not supportedCopy (reflink/clone) is not supported or didn’t workCopy (reflink/clone) is not supported or invalidCopy one or more filesCopy one or more files from SOURCE to DESTINATION.Copy with fileCould not allocate %lu byte to read file “%s”Could not allocate %lu bytes to read file “%s”Could not connect to %s: Could not connect to proxy server %s: Could not connect: Could not create network monitor: Could not create network monitor: %sCould not determine the disk usage of %s: %sCould not get network status: Could not load schemas from %s: %s
Could not open converter from “%s” to “%s”Could not open converter from “%s” to “%s”: %sCould not parse PEM-encoded certificateCould not parse PEM-encoded private keyCould not parse “%s” as IP address maskCreate directoriesCreate directories.Create parent directoriesCredentials spoofing is not possible on this OSCustom definition for %sDEFINE group contains more than one branchDESTINATIONDEVICEDIRECTORYDTLS support is not availableDefault application for “%s”: %s
Delete one or more filesDelete the given files.Desktop file didn’t specify Exec fieldDestination %s is not a directoryDestination name to introspectDestination name to invoke method onDestination name to monitorDidn’t find cookie with id %d in the keyring at “%s”Do not enforce key name restrictionsDo not write the gschema.compiled fileDocument ended unexpectedly after the equals sign following an attribute name; no attribute valueDocument ended unexpectedly inside a comment or processing instructionDocument ended unexpectedly inside an attribute nameDocument ended unexpectedly inside an element nameDocument ended unexpectedly inside an element-opening tag.Document ended unexpectedly inside the close tag for element '%s'Document ended unexpectedly just after an open angle bracket '<'Document ended unexpectedly while inside an attribute valueDocument ended unexpectedly with elements still open - '%s' was the last element openedDocument ended unexpectedly, expected to see a close angle bracket ending the tag <%s/>Document must begin with an element (e.g. <book>)Document was empty or contained only whitespaceDon’t automatically create and register resourceDon’t export functions; declare them G_GNUC_INTERNALDon’t follow symbolic linksDon’t use copy and delete fallbackDouble value “%s” for %s out of rangeERROR message: REPLY_SERIAL or ERROR_NAME header field is missingETAGEjectElement '%s' was closed, but the currently open element is '%s'Element '%s' was closed, no element is currently openElement <%s> not allowed at the top levelElement <%s> not allowed at toplevelElement <%s> not allowed inside <%s>Element <default> is required in <key>Embedded NUL byte in conversion inputEmbedded NUL byte in conversion outputEmit a signal.Empty entity '&;' seen; valid entities are: &amp; &quot; &lt; &gt; &apos;Empty names are not permittedEmpty path given.
Empty schema name given
Empty string is not a numberEmpty the trashEncountered array of length %u byte. Maximum length is 2<<26 bytes (64 MiB).Encountered array of length %u bytes. Maximum length is 2<<26 bytes (64 MiB).Encountered array of type “a%c”, expected to have a length a multiple of %u bytes, but found to be %u bytes in lengthEnter GApplication service mode (use from D-Bus service files)Entity did not end with a semicolon; most likely you used an ampersand character without intending to start an entity - escape ampersand as &amp;Entity name '%-.*s' is not knownEnumerator is closedError accepting connection: %sError auto-launching: Error binding to address: %sError calling StartServiceByName for %s: Error checking if SO_PASSCRED is enabled for socket: %sError closing (unlinked) lock file “%s”: %sError closing file descriptor: %sError closing file: %sError closing handle: %sError closing socket: %sError compressing file %sError connecting: %s
Error creating backup copy: %sError creating directory %s: %sError creating directory “%s”: %sError creating lock file “%s”: %sError deleting stale lock file “%s”: %sError deserializing GVariant with type string “%s” from the D-Bus wire formatError during conversion: %sError enabling SO_PASSCRED: %sError flushing connection: %s
Error getting filesystem info for %s: %sError in address “%s” — the family attribute is malformedError in address “%s” — the host attribute is missing or malformedError in address “%s” — the noncefile attribute is missing or malformedError in address “%s” — the port attribute is malformedError in address “%s” — the port attribute is missing or malformedError in address “%s” — the unix transport requires exactly one of the keys “path” or “abstract” to be setError joining multicast group: %sError leaving multicast group: %sError making symbolic link %s: %sError moving file %s: %sError on line %d char %d: Error on line %d: %sError opening directory “%s”: %sError opening file %s: %sError opening file “%s”: %sError opening keyring “%s” for reading: Error opening keyring “%s” for writing: Error opening nonce file “%s”: %sError parsing introspection XML: %s
Error parsing option %sError parsing parameter %d of type “%s”: %s
Error parsing parameter %d: %s
Error reading file %s: %sError reading file “%s”: %sError reading from file descriptor: %sError reading from file: %sError reading from handle: %sError reading from nonce file “%s”, expected 16 bytes, got %dError reading from nonce file “%s”: %sError reading from standard inputError receiving data: %sError receiving message: %sError removing file %s: %sError removing old backup link: %sError removing old file: %sError removing target file: %sError renaming file %s: %sError renaming temporary file: %sError resolving “%s”Error resolving “%s”: %sError return with body of type “%s”Error return with empty bodyError reverse-resolving “%s”: %sError seeking in file: %sError sending credentials: Error sending data: %sError sending message: %sError serializing GVariant with type string “%s” to the D-Bus wire formatError setting SELinux context: %sError setting extended attribute “%s”: %sError setting modification or access time: %sError setting owner: %sError setting permissions: %sError setting property '%s': Expected type '%s' but got '%s'Error setting symlink: %sError setting symlink: file is not a symlinkError spawning command line “%s”: Error splicing file: %sError trashing file %s: %sError truncating file: %sError unescaping key or value in Key/Value pair %d, “%s”, in address element “%s”Error unlinking lock file “%s”: %sError when getting information for directory “%s”: %sError when getting information for file descriptor: %sError when getting information for file “%s”: %sError while compiling regular expression %s at char %d: %sError while disabling SO_PASSCRED: %sError while matching regular expression %s: %sError while optimizing regular expression %s: %sError while parsing replacement text “%s” at char %lu: %sError writing contents of nonce file “%s” to stream:Error writing nonce file at “%s”: %sError writing to file descriptor: %sError writing to file: %sError writing to handle: %sError writing to stdoutError: %s
Error: %s is not a valid bus name
Error: %s is not a valid interface name
Error: %s is not a valid member name
Error: %s is not a valid name
Error: %s is not a valid object path
Error: %s is not a valid unique bus name.
Error: %s is not a valid well-known bus name.
Error: A service to activate for must be specified.
Error: A service to wait for must be specified.
Error: Destination is not specified
Error: Method name is not specified
Error: Method name “%s” is invalid
Error: Object path is not specified
Error: Signal name is not specified
Error: Signal name “%s” is invalid
Error: Too many arguments.
Error: can’t monitor a non-message-bus connection
Etag not available
Exactly one of “type”, “enum” or “flags” must be specified as an attribute to <key>Exhausted all available authentication mechanisms (tried: %s) (available: %s)Existing file “%s” could not be removed: g_unlink() failed: %sExpected NUL byte after the string “%s” but found byte %dExpected a GEmblem for GEmblemedIconExpected valid UTF-8 string but found invalid bytes at byte offset %d (length of string is %d). The valid UTF-8 string up until that point was “%s”Expecting 1 control message, got %dExpecting 1 control message, got %dExpecting one fd, but got %d
Expecting one fd, but got %d
Expecting to read a single byte for receiving credentials but read zero bytesExtract a resource file to stdoutFILEFILE PATHFILE [PATH]Failed to allocate memoryFailed to change to directory “%s” (%s)Failed to create file “%s”: %sFailed to create pipe for communicating with child process (%s)Failed to create temp file: %sFailed to execute child process (%s)Failed to execute child process “%s” (%s)Failed to execute helper program (%s)Failed to expand exec line “%s” with URI “%s”Failed to fork (%s)Failed to fork child process (%s)Failed to get attributes of file “%s%s%s%s”: fstat() failed: %sFailed to get attributes of file “%s”: fstat() failed: %sFailed to load info for handler “%s”Failed to locate “%s” in any source directoryFailed to locate “%s” in current directoryFailed to map %s%s%s%s: mmap() failed: %sFailed to open file “%s”: %sFailed to open file “%s”: fdopen() failed: %sFailed to open file “%s”: open() failed: %sFailed to parse '%-.*s', which should have been a digit inside a character reference (&#234; for example) - perhaps the digit is too largeFailed to parse <default> value of type “%s”: Failed to read data from child processFailed to read data from child process (%s)Failed to read enough data from child pid pipe (%s)Failed to read from child pipe (%s)Failed to read from file “%s”: %sFailed to read the symbolic link “%s”: %sFailed to redirect output or input of child process (%s)Failed to rename file “%s” to “%s”: g_rename() failed: %sFailed to resize memory output streamFailed to set “%s” as the default handler for “%s”: %s
Failed to write file “%s”: fsync() failed: %sFailed to write file “%s”: write() failed: %sFile %s appears multiple times in the resourceFile enumerator has outstanding operationFile enumerator is already closedFile names cannot contain “%c”File “%s” is too largeFilesystem does not support symbolic linksFilesystem rootFirst token of line %d of the keyring at “%s” with content “%s” is malformedFollow symbolic links, mounts and shortcutsGApplication optionsGCredentials does not contain a process ID on this OSGCredentials is not implemented on this OSGDateTime%H:%M:%SGDateTime%I:%M:%S %pGDateTime%a %b %e %H:%M:%S %YGDateTime%m/%d/%yGDateTimeAMGDateTimePMGSocketControlMessage not supported on WindowsGenerate dependency listGenerate output in the format selected for by the target filename extensionGenerate source headerGenerate sourcecode used to link in the resource file into your codeGet file system infoGet or set the handler for a mimetypeGet or set the handler for a mimetype.Get the value of KEYHANDLERHTTP proxy authentication failedHTTP proxy authentication requiredHTTP proxy connection failed: %iHTTP proxy connection not allowedHTTP proxy server closed connection unexpectedly.Help Options:Host unreachableHost unreachable through SOCKSv5 server.Hostname “%s” contains “[” but not “]”Hostname “%s” is too long for SOCKSv4 protocolHostname “%s” is too long for SOCKSv5 protocolIf no handler is given, lists registered and recommended applications
for the mimetype. If a handler is given, it is set as the default
handler for the mimetype.Ignore nonexistent files, never promptIgnore outstanding file operations when unmounting or ejectingIgnored, for compat with GTestDbusIgnoring override for this key.
Ignoring this file.
Include phony targets in the generated dependency fileIncomplete multibyte sequence in inputInput stream doesn’t implement readInput stream doesn’t implement seekInteger value “%s” for %s out of rangeInteger value “%s” out of rangeInterface name too longInterface not found: %sInternal SOCKSv5 proxy server error.Internal error: %sIntrospect a remote object.Introspect childrenInvalid GSeekType suppliedInvalid GVariant type string “%s”Invalid UTF-8 encoded text in name - not valid '%s'Invalid attribute type (byte string expected)Invalid attribute type (string expected)Invalid attribute type (uint32 expected)Invalid attribute type (uint64 expected)Invalid attribute type “%s”Invalid byte sequence in conversion inputInvalid compressed dataInvalid domainInvalid endianness value. Expected 0x6c (“l”) or 0x42 (“B”) but found value 0x%02xInvalid extended attribute nameInvalid filenameInvalid filename %sInvalid group name: %sInvalid hostnameInvalid key name: %sInvalid major protocol version. Expected 1 but found %dInvalid name “%s”: invalid character “%c”; only lowercase letters, numbers and hyphen (“-”) are permittedInvalid name “%s”: maximum length is 1024Invalid name “%s”: names must begin with a lowercase letterInvalid name “%s”: the last character may not be a hyphen (“-”)Invalid name “%s”: two successive hyphens (“--”) are not permittedInvalid numeric valueInvalid object, not initializedInvalid program name: %sInvalid seek requestInvalid sequence in conversion inputInvalid socket, initialization failed due to: %sInvalid socket, not initializedInvalid string in argument vector at %d: %sInvalid string in environment: %sInvalid symlink value givenInvalid working directory: %sInvoke a method on a remote object.Invoke an action on the applicationKeep with file when movedKey file contains escape character at end of lineKey file contains invalid escape sequence “%s”Key file contains key “%s” in group “%s” which has a value that cannot be interpreted.Key file contains key “%s” which has a value that cannot be interpreted.Key file contains key “%s” with value “%s” which is not UTF-8Key file contains line “%s” which is not a key-value pair, group, or commentKey file contains unsupported encoding “%s”Key file does not have group “%s”Key file does not have key “%s” in group “%s”Key file does not start with a groupKey “%s” in group “%s” has value “%s” where %s was expectedKey/Value pair %d, “%s”, in address element “%s” does not contain an equal signLOCATIONLaunch an applicationLaunch the application (with optional files to open)Leftover unconverted data in read bufferLength %u is too long for addressLine %d of the keyring at “%s” with content “%s” is malformedListList applicationsList available actionsList contents of directories in a tree-like format.List keys and values, recursively
If no SCHEMA is given, list all keys
List resources
If SECTION is given, only list resources in this section
If PATH is given, only list matching resourcesList resources with details
If SECTION is given, only list resources in this section
If PATH is given, only list matching resources
Details include the section, size and compressionList sections containing resources in an elf FILEList static actions for an application (from .desktop file)List the children of SCHEMAList the contents of locationsList the contents of the locations.List the installed (non-relocatable) schemasList the installed D-Bus activatable applications (by .desktop files)List the installed relocatable schemasList the keys in SCHEMAList writable attributesListener is already closedLists the contents of locations in a treeLocation not specifiedMETHOD_CALL message: PATH or MEMBER header field is missingMETHOD_RETURN message: REPLY_SERIAL header field is missingMIMETYPEMalformed input data for GFileIconMalformed number of tokens (%d) in GEmblem encodingMalformed number of tokens (%d) in GEmblemedIcon encodingMalformed version number: %sMeaningless key/value pair combination in address entry “%s”Memory output stream not resizableMessage body has signature “%s” but there is no signature headerMessage body has type signature “%s” but signature in the header field is “%s”Message body is empty but signature in the header field is “(%s)”Method '%s' on interface '%s' with signature '%s' does not existMethod '%s' returned type '%s', but expected '%s'Method and interface nameMissing argumentMissing argument for %sMonitor KEY for changes.
If no KEY is specified, monitor all keys in SCHEMA.
Use ^C to stop monitoring.
Monitor a directory (default: depends on type)Monitor a file (default: depends on type)Monitor a file directly (notices changes made via hardlinks)Monitor a remote object.Monitor eventsMonitor files and directories for changesMonitor files or directories for changes.Monitors a file directly, but doesn’t report changesMount as mountableMount or unmount the locationsMount or unmount the locations.Mount volume with device fileMounted %s at %s
Move between mounts not supportedMove files or directories to the trashMove files or directories to the trash.Move one or more filesMove one or more files from SOURCE to DEST.Multiple connection endpoints specifiedMust specify a single mimetype, and maybe a handlerNAMENeed more inputNetwork unreachableNetwork unreachable through SOCKSv5 proxy.NetworkManager version too oldNever follow symbolic linksNo <key name='%s'> to overrideNo DNS record of the requested type for “%s”No MIME type defined in the bookmark for URI “%s”No PEM-encoded certificate foundNo PEM-encoded private key foundNo address specifiedNo application is registered as handling this fileNo application with name “%s” registered a bookmark for “%s”No bookmark found for URI “%s”No connection endpoint specifiedNo default applications for “%s”
No destination givenNo groups set in bookmark for URI “%s”No locations givenNo private flag has been defined in bookmark for URI “%s”No recommended applications
No registered applications
No schema files found: No schemas installed
No signature header in message but the message body is %u byteNo signature header in message but the message body is %u bytesNo such interface '%s'No such interface '%s' on object at path %sNo such interface 'org.freedesktop.DBus.Properties' on object at path %sNo such key '%s' in schema '%s' as specified in override file '%s'No such key “%s”
No such method '%s'No such property '%s'No such schema “%s”
No support for IPv4 source-specific multicastNo support for IPv6 source-specific multicastNo support for source-specific multicastNo target directoryNo type for class name %sNo valid addresses were foundNo valid bookmark file found in data dirsNo volume for device fileNot a regular fileNot enough memoryNot enough space for socket addressNot enough space in destinationNot expecting control message, but got %dNumber of file descriptors in message (%d) differs from header field (%d)Number “%s” is out of bounds [%s, %s]Object path to emit signal onObject path to introspectObject path to invoke method onObject path to monitorOdd character '%s', expected a '=' after attribute name '%s' of element '%s'Odd character '%s', expected a '>' character to end the empty-element tag '%s'Odd character '%s', expected a '>' or '/' character to end the start tag of element '%s', or optionally an attribute; perhaps you used an invalid character in an attribute nameOdd character '%s', expected an open quote mark after the equals sign when giving value for attribute '%s' of element '%s'Only create if not existingOnly one <%s> element allowed inside <%s>Only print propertiesOpen files with the default applicationOpen files with the default application that
is registered to handle files of this type.Operation not supportedOperation was cancelledOptional destination for signal (unique name)Optional parameter to the action invocation, in GVariant formatOptional relative or absolute filenames, or URIs to openOptions specifying the connection endpointOptions:Output stream doesn’t implement writeOverride the application’s IDPARAMETERPATHPCRE library is compiled with incompatible optionsPCRE library is compiled without UTF8 properties supportPCRE library is compiled without UTF8 supportPOSIX collating elements are not supportedPOSIX named classes are supported only within a classParsed value “%s” for variant is not a valid D-Bus signatureParsed value “%s” is not a valid D-Bus object pathParsed value “%s” is not a valid D-Bus signatureParsed value “%s” is not a valid D-Bus signature (for body)Partial character sequence at end of inputPath must begin with a slash (/)
Path must end with a slash (/)
Path must not contain two adjacent slashes (//)
Permissions on directory “%s” are malformed. Expected mode 0700, got 0%oPreserve all attributesPrint XMLPrint addressPrint address in shell modePrint full URIsPrint helpPrint new etag at endPrint versionPrint version information and exitPrint version information and exit.Prompt before overwriteProperty '%s' is not readableProperty '%s' is not writableProxy protocol “%s” is not supported.Proxying over a non-TCP connection is not supported.Query the description for KEYQuery the range of valid values for KEYQuoted text doesn’t begin with a quotation markRead from standard input and saveRead from standard input and save to DEST.Received invalid fdRecommended applications:
Registered applications:
Rename a fileRename a file.Rename successful. New uri: %s
Report moves and renames as simple deleted/created eventsRequested seek before the beginning of the streamRequested seek beyond the end of the streamReset KEY to its default valueReset all keys in SCHEMA to their defaultsRun a dbus serviceSCHEMA[:PATH]SCHEMA[:PATH] KEYSCHEMA[:PATH] KEY VALUESCHEMA[:PATH] [KEY]SCHEMESECTIONSELinux context must be non-NULLSELinux is not enabled on this systemSIGNAL message: PATH, INTERFACE or MEMBER header field is missingSIGNAL message: The INTERFACE header field is using the reserved value org.freedesktop.DBus.LocalSIGNAL message: The PATH header field is using the reserved value /org/freedesktop/DBus/LocalSOCKSv4 does not support IPv6 address “%s”SOCKSv5 authentication failed due to wrong username or password.SOCKSv5 connection not allowed by ruleset.SOCKSv5 proxy does not support provided address type.SOCKSv5 proxy does not support “connect” command.SOURCESchema “%s” is not relocatable (path must not be specified)
Schema “%s” is relocatable (path must be specified)
Second token of line %d of the keyring at “%s” with content “%s” is malformedSeek not supported on base streamSeek not supported on streamService to activate before waiting for the other one (well-known name)Session dbus not running, and autolaunch failedSet a file attributeSet a file attribute of LOCATION.Set the value of KEY to VALUESettable attributes:
Setting attribute %s not supportedSeveral passwords entered have been incorrect, and your access will be locked out after further failures.Show GApplication optionsShow all help optionsShow extra informationShow help optionsShow hidden filesShow information about locationsShow information about locations.Show program version and exitShow progressSignal and interface nameSignature header with signature “%s” found but message body is emptySocket I/O timed outSocket is already closedSource stream is already closedSplice not supportedStream doesn’t support query_infoStream has outstanding operationStream is already closedSymbolic links not supportedTLS support is not availableTYPETarget %s is not a directoryTarget file existsTarget file is a directoryTarget file is not a regular fileTemplate “%s” doesn’t contain XXXXXXTemplate “%s” invalid, should not contain a “%s”Temporarily unable to resolve “%s”Text ended before matching quote was found for %c. (The text was “%s”)Text ended just after a “\” character. (The text was “%s”)Text may not appear inside <%s>Text was empty (or contained only whitespace)The SOCKSv5 proxy requires an authentication method that is not supported by GLib.The SOCKSv5 proxy requires authentication.The SOCKSv5 proxy server uses unknown address type.The URI “%s” contains invalidly escaped charactersThe URI “%s” is invalidThe URI “%s” is not an absolute URI using the “file” schemeThe action name to invokeThe attributes to getThe command to print detailed help forThe connection is closedThe directories where files are to be read from (default to current directory)The etag of the file being overwrittenThe file was externally modifiedThe given address is emptyThe hostname of the URI “%s” is invalidThe key is not writable
The local file URI “%s” may not include a “#”The password entered is incorrect.The path of a list must end with “:/”The pathname “%s” is not an absolute pathThe provided value is outside of the valid range
The resource at “%s” does not existThe resource at “%s” failed to decompressThe resource at “%s” is not a directoryThe server is not a SOCKSv4 proxy server.The server is not a SOCKSv5 proxy server.The string “%s” is not a valid D-Bus GUIDThere is no GCredentials support for your platformThis entire file has been ignored.
This is the last chance to enter the password correctly before your access is locked out.Timeout in secondsTimeout to wait for before exiting with an error (seconds); 0 for no timeout (default)Timeout was reachedToo large count value passed to %sToo many argumentsTransferred %s out of %s (%s/s)Trash not supportedTruncate not allowed on input streamTruncate not supported on base streamTruncate not supported on streamType %s does not implement from_tokens() on the GIcon interfaceType %s does not implement the GIcon interfaceType %s is not classedType of message, '%s', does not match expected type '%s'Type of the attributeUnable to create socket: %sUnable to create trash dir %s: %sUnable to create trashing info file for %s: %sUnable to find default local file monitor typeUnable to find or create trash directory for %sUnable to find terminal required for applicationUnable to find toplevel directory to trash %sUnable to get Hardware profile: %sUnable to get pending error: Unable to load /var/lib/dbus/machine-id or /etc/machine-id: Unable to read socket credentials: %sUnable to retrieve property %s.%sUnable to set property %s.%sUnable to shutdown socket: %sUnable to trash file %sUnable to trash file %s across filesystem boundariesUnable to trash file %s: %sUnexpected attribute “%s” for element “%s”Unexpected early end-of-streamUnexpected error in g_io_channel_win32_poll() reading data from a child processUnexpected error in select() reading data from a child process (%s)Unexpected error in waitpid() (%s)Unexpected lack of content trying to (safely) read a lineUnexpected lack of content trying to read a lineUnexpected reply %d from StartServiceByName("%s") methodUnexpected tag “%s” inside “%s”Unexpected tag “%s”, tag “%s” expectedUnexpected type of ancillary dataUnknown SOCKSv5 proxy error.Unknown bus type %dUnknown command %s

Unknown error executing child process “%s”Unknown error on connectUnknown family was specifiedUnknown option %sUnknown or unsupported transport “%s” for address “%s”Unknown processing option “%s”Unknown protocol was specifiedUnknown typeUnmatched quotation mark in command line or other shell-quoted textUnmountUnmount all mounts with the given schemeUnnamedUnrepresentable character in conversion inputUnsupported flags encountered when constructing a client-side connectionUnsupported key “%s” in address entry “%s”Unsupported socket addressUnsupported socket familyUsage:Usage:
Usage:
  gresource %s%s%s %s

%s

Usage:
  gresource [--section SECTION] COMMAND [ARGS…]

Commands:
  help                      Show this information
  sections                  List resource sections
  list                      List resources
  details                   List resources with details
  extract                   Extract a resource

Use “gresource help COMMAND” to get detailed help.

Usage:
  gsettings --version
  gsettings [--schemadir SCHEMADIR] COMMAND [ARGS…]

Commands:
  help                      Show this information
  list-schemas              List installed schemas
  list-relocatable-schemas  List relocatable schemas
  list-keys                 List keys in a schema
  list-children             List children of a schema
  list-recursively          List keys and values, recursively
  range                     Queries the range of a key
  describe                  Queries the description of a key
  get                       Get the value of a key
  set                       Set the value of a key
  reset                     Reset the value of a key
  reset-recursively         Reset all values in a given schema
  writable                  Check if a key is writable
  monitor                   Watch for changes

Use “gsettings help COMMAND” to get detailed help.

Usage:
  gsettings [--schemadir SCHEMADIR] %s %s

%s

Use %s to get detailed help.
Use a long listing formatUse an anonymous user when authenticatingUse “%s help COMMAND” to get detailed help.

Username is too long for SOCKSv4 protocolUsername or password is too long for SOCKSv5 protocol.VALUEValid key file could not be found in search dirsValue not specifiedValue “%s” cannot be interpreted as a boolean.Value “%s” cannot be interpreted as a float number.Value “%s” cannot be interpreted as a number.Wait for a bus name to appear.Waiting for socket condition: %sWanted to read %lu byte but only got %luWanted to read %lu bytes but only got %luWarning: According to introspection data, interface “%s” does not exist
Warning: According to introspection data, method “%s” does not exist on interface “%s”
Warning: Schema “%s” has path “%s”.  Paths starting with “/apps/”, “/desktop/” or “/system/” are deprecated.Warning: undefined reference to <schema id='%s'/>Watch for mount eventsWhen creating, restrict access to the current userWhen replacing, replace as if the destination did not existWritable attribute namespaces:
Wrong args
Wrong number of tokens (%d)You should give exactly one directory name
You should give exactly one file name
[ARGS...][ARGS…][COMMAND][OPTION…][OPTION…] BUS-NAME[PATH][SCHEMA[:PATH]]\ at end of pattern\C not allowed in lookbehind assertion\N is not supported in a class\c at end of pattern\c must be followed by an ASCII character\g is not followed by a braced, angle-bracketed, or quoted name or number, or by a plain number\k is not followed by a braced, angle-bracketed, or quoted name] is an invalid data character in JavaScript compatibility modea numbered reference must not be zeroabbreviated month nameAprabbreviated month nameAugabbreviated month nameDecabbreviated month nameFebabbreviated month nameJanabbreviated month nameJulabbreviated month nameJunabbreviated month nameMarabbreviated month nameMayabbreviated month nameNovabbreviated month nameOctabbreviated month nameSepabbreviated month name with dayAprabbreviated month name with dayAugabbreviated month name with dayDecabbreviated month name with dayFebabbreviated month name with dayJanabbreviated month name with dayJulabbreviated month name with dayJunabbreviated month name with dayMarabbreviated month name with dayMayabbreviated month name with dayNovabbreviated month name with dayOctabbreviated month name with daySepabbreviated weekday nameFriabbreviated weekday nameMonabbreviated weekday nameSatabbreviated weekday nameSunabbreviated weekday nameThuabbreviated weekday nameTueabbreviated weekday nameWedaction name must be given after application id
actions accept a maximum of one parameter
alias target “%s” is not in <choices>alias target “%s” is not in enumerated typean argument is not allowed for (*ACCEPT), (*FAIL), or (*COMMIT)assertion expected after (?(attributes:
back references as conditions are not supported for partial matchingbacktracking limit reachedbad offsetcharacter value in \u.... sequence is too largecharacter value in \x{...} sequence is too largecode overflowconditional group contains more than two branchescorrupted objectcould not get local address: %scould not get remote address: %scould not listen: %screating GSocket from fd: %sdifferent names for subpatterns of the same number are not alloweddigit expecteddigit expected after (?+display name: %s
doing nothing.
drive doesn’t implement ejectdrive doesn’t implement eject or eject_with_operationdrive doesn’t implement polling for mediadrive doesn’t implement startdrive doesn’t implement stopedit name: %s
error parsing action parameter: %s
error parsing key '%s' in schema '%s' as specified in override file '%s': %s.error sending %s message to application: %s
escapes \L, \l, \N{name}, \U, and \u are not supportedfailed to get memoryflags values must have at most 1 bit setfull month nameAprilfull month nameAugustfull month nameDecemberfull month nameFebruaryfull month nameJanuaryfull month nameJulyfull month nameJunefull month nameMarchfull month nameMayfull month nameNovemberfull month nameOctoberfull month nameSeptemberfull month name with dayAprilfull month name with dayAugustfull month name with dayDecemberfull month name with dayFebruaryfull month name with dayJanuaryfull month name with dayJulyfull month name with dayJunefull month name with dayMarchfull month name with dayMayfull month name with dayNovemberfull month name with dayOctoberfull month name with daySeptemberfull weekday nameFridayfull weekday nameMondayfull weekday nameSaturdayfull weekday nameSundayfull weekday nameThursdayfull weekday nameTuesdayfull weekday nameWednesdayg_socket_get_credentials not implemented for this OSgio cat works just like the traditional cat utility, but using GIO
locations instead of local files: for example, you can use something
like smb://server/resource/file.txt as location.gio copy is similar to the traditional cp utility, but using GIO
locations instead of local files: for example, you can use something
like smb://server/resource/file.txt as location.gio info is similar to the traditional ls utility, but using GIO
locations instead of local files: for example, you can use something
like smb://server/resource/file.txt as location. File attributes can
be specified with their GIO name, e.g. standard::icon, or just by
namespace, e.g. unix, or by “*”, which matches all attributesgio list is similar to the traditional ls utility, but using GIO
locations instead of local files: for example, you can use something
like smb://server/resource/file.txt as location. File attributes can
be specified with their GIO name, e.g. standard::icongio mkdir is similar to the traditional mkdir utility, but using GIO
locations instead of local files: for example, you can use something
like smb://server/resource/mydir as location.gio move is similar to the traditional mv utility, but using GIO
locations instead of local files: for example, you can use something
like smb://server/resource/file.txt as locationhexadecimal digit expectedhexadecimal digit or “}” expectedhidden
illegal symbolic referenceinconsistent NEWLINE optionsinternal errorinternal error or corrupted objectinvalid action name: “%s”
action names must consist of only alphanumerics, “-” and “.”
invalid application id: “%s”
invalid combination of newline flagsinvalid condition (?(0)invalid escape sequence in character classl10n requested, but no gettext domain givenlist-actions command takes only the application idlookbehind assertion is not fixed lengthmalformed \P or \p sequencemalformed number or name after (?(missing ) after commentmissing subpattern name after (?&missing terminating )missing terminating ] for character classmissing terminator in subpattern namemissing “<” in symbolic referencemount doesn’t implement content type guessingmount doesn’t implement synchronous content type guessingmount doesn’t implement “eject”mount doesn’t implement “eject” or “eject_with_operation”mount doesn’t implement “remount”mount doesn’t implement “unmount”mount doesn’t implement “unmount” or “unmount_with_operation”name is too long in (*MARK), (*PRUNE), (*SKIP), or (*THEN)name of the dependency file to generatename of the output filename: %s
nick must be a minimum of 2 charactersnothing to repeatnumber is too bignumber too big in {} quantifiernumbers out of order in {} quantifieroctal value is greater than \377out of memoryoverran compiling workspaceoverride for key '%s' in schema '%s' in override file '%s' is not in the list of valid choicesoverride for key '%s' in schema '%s' in override file '%s' is outside the range given in the schemapreviously-checked referenced subpattern not foundrange out of order in character classrecursion limit reachedrecursion looprecursive call could loop indefinitelyreference to non-existent subpatternregular expression is too largeremoved existing output file.
short utf8size: source-specific not an IPv4 addressstray final “\”subpattern name is too long (maximum 32 characters)symlink must be non-NULLtext may not appear inside <%s>the pattern contains items not supported for partial matchingtoo many forward referencestoo many named subpatterns (maximum 10,000)translation context given for value without l10n enabledtwo named subpatterns have the same nametype is INVALIDtype: %s
unable to connect to D-Bus: %s
unable to find desktop file for application %s
unexpected repeatunfinished symbolic referenceunknown POSIX class nameunknown errorunknown escape sequenceunknown property name after \P or \punrecognised command: %s

unrecognized character after (? or (?-unrecognized character after (?<unrecognized character after (?Punrecognized character following \unsupported l10n category: %suri: %s
value='%s' already specifiedvolume doesn’t implement ejectvolume doesn’t implement eject or eject_with_operationvolume doesn’t implement mountwhere to store the gschemas.compiled filezero-length symbolic reference“%s” is not a signed number“%s” is not an unsigned number“%s” takes no arguments

“version” takes no argumentsProject-Id-Version: glib.master
Report-Msgid-Bugs-To: https://bugzilla.gnome.org/enter_bug.cgi?product=glib&keywords=I18N+L10N&component=general
POT-Creation-Date: 2018-02-16 20:43+0000
PO-Revision-Date: 2018-02-17 00:29+0200
Last-Translator: Fran Dieguez <frandieguez@gnome.org>
Language-Team: Galician
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Virtaal 0.7.1
X-Project-Style: gnome
  ORDE   A orde que explicar (opcional)
  FICHEIRO      Un ficheiro elf (un binario ou biblioteca compartida)
  FICHEIRO      Un ficheiro elf (un binario ou unha biblioteca compartida)
            ou un ficheiro de recurso compilado
  KEY       A clave (opcional) no esquema
  KEY       A clave nun esquema
  RUTA      Unha ruta dun recurso
  RUTA      Unha ruta (optional) de recurso (pode ser parcial)
  SCHEMA    O nome do esquema
  KEY       A ruta, para os esquemas reposicionábeis
  CARTAFOL_ESQUEMA: un directorio para buscar esquemas adicionais
  SECCIÓN   Un nome de sección elf (opcional)
  VALUE     O valor a estabelecer
 (codificación non válida)e --strict foi especificado; saíndo.
%.1f EB%.1f Eb%.1f EiB%.1f Eib%.1f GB%.1f Gb%.1f GiB%.1f Gib%.1f KB%.1f KiB%.1f Kib%.1f MB%.1f Mb%.1f MiB%.1f Mib%.1f PB%.1f Pb%.1f PiB%.1f Pib%.1f TB%.1f Tb%.1f TiB%.1f Tib%.1f kiB%.1f kb%s bit%s bit%s byte%s bytesA orde %s require un id de aplicativo ao que seguir directamente

tipo de ficheiro %stipo %s%s: sobrescribir «%s»?%u bit%u bit%u byte%u bytes«%s» non é un carácter válido despois dun carácter '<'; non pode iniciar un nome de elemento«%s» non é un carácter válido despois dos caracteres '</'; «%s» non pode comezar o nome dun elemento«%s» non é un carácter válido despois do nome de elemento de peche «%s»; o carácter permitido é '>'«%s» non é un nome válido«%s» non é un nome válido: '%c'(*MARK) debe ter un argumento(*VERB) no recoñecido(?R ou os díxitos (?[+-] deben estar seguidos por )(Ademais, a liberación do bloqueo para «%s» tamén fallou: %s) (Prema calquera caracter para pechar esta xanela)
) sen ( que o abra--strict foi especificado; saíndo.
; ignorando a sobrescritura para esta clave.
<%s id='%s'> xa especificado<%s id='%s'> aínda non especificado.<%s> contén unha cadea que non está en <choices><%s> contén unha cadea que non está especificada no tipo das bandeiras<%s> non é un membro válido do enumerado especificado<%s> non está no rango especificado<%s> debe conter cando menos un <value><alias value='%s'/> xa especificado<alias value='%s'/> fornecido cando <choice value='%s'/> xa foi fornecido<alias value='%s'/> fornecido cando «%s» xa é un membro do tipo enumerado<aliases> xa especificado para esta chave<aliases> só pode ser especificado para as chaves con enumerados ou bandeiras de tipos ou despoisd e <choices><aliases> debe conter cando menos un <alias><child name='%s'> xa especificado<choice value='%s'> xa fornecido<choices> xa especificadas para esta chave<choices> non pode especificarse para as chaves etiquetadas como un tipo enumerado<choices> debe conter cando menos unha <choice><choices> non permitidas para as chaves do tipo “%s”<key name='%s'> xa especificada<key name='%s'> enmascara a <key name='%s'> en <schema id='%s'>; use <override> para modificar o valor<override name='%s'> xa foi especificada<override> fornecido pero o esquema non estende nada<range/> xa está especificado para esta chave<range> non permitido para as chaves do tipo «%s»o <range> mínimo especificado é maior que o máximo<schema id='%s' list-of='%s'> estende <schema id='%s' list-of='%s'> pero «%s» non estende a «%s»<schema id='%s'> xa especificado<schema id='%s'> estende ao aínda esquema inexistente «%s»<schema id='%s'> é unha lista, estase estendendo <schema id='%s'> que non é unha lista<schema id='%s'> é unha lista de esquemas aínda non existentes «%s»<value nick='%s'/> xa especificadoXa existe un marcador para o URI «%s»Unha ruta, se se especifica, debe comezar e rematar con unha barraXa se exportou un subárbore para %sACCIÓNAPPIDAPPID ACCIÓN [PARAMETRO]APPID [FICHEIRO...]ATRIBUTOATRIBUTOSInterromper ao atopar calquera erro nos esquemasNeste sistema non se permiten enderezos de socket de dominios UNIX abstractosNon se admite un espazo de nomes abstractoActivar unha acciónO socket engadido está pechadoO elemento do enderezo «%s» non contén un caracter dous puntos (:)O enderezo ten bits máis aló da lonxitude do prefixoEnderezo no que escoitarO enderezo «%s» non é válido (necesítase exactamente unha ruta, tmpdir ou claves abstractas)A cantidade de memoria requirida para procesar a escrita é máis grande que o espazo de enderezos dispoñíbelXa hai un obxecto exportado para a interface %s en %sAcceso anónimo denegadoEngadir ao final do ficheiroOpcións do aplicativo:Identificador de aplicativo en formato D-Bus (p.ex.: org.exemplo.visor)A información do aplicativo carece dun identificadorArgumentos:
Atributo non especificadoO valor do atributo debe ser non nuloNon se atopou o atributo «%s» do elemento «%s»Facer unha copia de respaldo para os ficheiros de destinoFallou a creación do ficheiro de seguranzaResposta do proxi HTTP incorrectaO nome de identificador C usado para xerar o código fonteORDENon se permite a inicialización cancelábelCancelando mediante GDBusAuthObserver::authorize-authenticated-peerNon é posíbel engadir claves a un esquema «lista-de»Non é posíbel autoiniciar D-Bus sen un $DISPLAY X11Non é posíbel que sexa unha lista de esquemas con unha rutaNon é posíbel converter o modo de emerxencia «%s» na codificación de caracteres «%s»Non foi posíbel descifrar a chave privada codificada con PEMNon foi posíbel deserializar a mensaxe: Non é posíbel determinar o enderezo do bus xa que a variábel de ambiente DBUS_STARTER_BUS_TYPE non está estabelecidaNon é posíbel determinar o enderezo do bus desde a variábel de ambiente DBUS_STARTER_BUS_TYPE - valor descoñecido «%s»Non é posíbel determinar o enderezo do bus desde a variábel de ambiente DBUS_STARTER_BUS_TYPE - valor descoñecido «%s»Non é posíbel determinar o enderezo do bus de sesión (non está implementado para este SO)Non é posíbel estender un esquema con unha rutaNon é posíbel invocar ao método; o proxy non ten dono para un nome coñecido e o proxy construíuse coa opción G_DBUS_PROXY_FLAGS_DO_NOT_AUTO_STARTNon é posíbel escoitar nun transporte «%s» non admitidoNon é posíbel analizar o valor "double" «%s» para %sNon é posíbel analizar o valor enteiro «%s» para %sNon foi posíbel serializar a mensaxe: Non foi posíbel estabelecer os permisos nas ligazóns simbólicasNon é posíbel iniciar («spawn») unha bus de mensaxe sen setuidNon é posíbel iniciar («spawn») unha mensaxe ao bus sen un ID de máquina:Non é posíbel especificar o ficheiro de uso de unha vez ao crear un servidorNon é posíbel truncar GBufferedInputStreamNon é posíbel truncar GMemoryInputStreamNon é posíbel usar as operacions de datagramas nun socket que non é de datagramas.Non é posíbel usar operacións de datagramas nun socket con un tempo de espera máximo estabelecido.Non é posíbel copiar un directorio sobre o directorioNon é posíbel copiar sobre o directorioNon é posíbel copiar o ficheiro especialNon é posíbel crear o directorio de configuración MIME %s do usuario: %sNon é posíbel crear o directorio de configuración do aplicativo de usuario %s: %sNon é posíbel crear o ficheiro de escritorio %s do usuarioNon é posíbel facer unha lectura en bruto en g_io_channel_read_line_stringNon é posíbel facer unha lectura en bruto en g_io_channel_read_to_endNon é posíbel manipular a versión fornecida da codificación da iconaNon é posíbel manipular a versión %d da codificación de GEmblemNon é posíbel manipular a versión %d da codificación de GEmblemediconNon é posíbel manipular a versión %d da codificación de GFileIconNon é posíbel manipular a versión %d da codificación de GThemedIconNon é posíbel mover o directorio sobre un directorioNon é posíbel copiar o directorio recursivamenteNon é posíbel renomear o ficheiro, o ficheiro xa existeNon é posíbel renomear o directorio raízO canal termina nun carácter parcialCarácter fóra de intervalo para UTF-16Carácter fóra do intervalo para UTF-8A referencia de carácter '%-.*s' non codifica un carácter permitidoA referencia de carácter non remataba con punto e coma, probabelmente utilizou un carácter & sen intención de comezar unha entidade - escape o & como &amp;Comproba se a CLAVE é escribíbelO proceso fillo rematou de forma anormalO proceso fillo rematou co código %ldO proceso fillo rematou polo sinal %ldO proceso fillo detívose polo sinal %ldOrdes:Ordes:
Ordes:
  help        Mostra esta axuda
  introspect  Instrospecciona un obxecto remoto
  monitor     Monitorizar un obxecto remoto
  call        Invoca un método nun obxecto remoto
  emit        Emite un sinal
  wait        Agarda que apareza un nome de bus

Use '%s ORDE --help' para obter axuda sobre cada orde.
Compilaa unha especificación de recurso nun ficheiro de recurso.
Os ficheiros de especificación de recursos teñen a extensión .gresource.xml,
e o ficheiro do recurso ten a extensión .gresource.Compilar todos os ficheiros de esquema GSettings nunha caché
de esquemas. Os ficheiros de esquema deben ter a extensión
.gschema.xml e o ficheiro de caché chámase gschemas.compiled.Concatenar ficheiros e imprimir á saída estándar.Concatenar ficheiros á saída estándarConectar a un enderezo D-Bus fornecidoConectar ao bus de sesiónConectar ao bus do sistemaOpcións da conexión do extremo:Conexión en marchaRexeitouse a conexión mediante o proxy SOCKSv5.A conexión a través do servidor SOCKSv4 foi rexeitadaO punto de montaxe contido non existeNon se atopa o punto de montaxe que contén o ficheiro %sNon se admite a conversión do conxunto de caracteres «%s» a «%s»Copiar (reflink/clonar) entre montaxes non é compatíbelCopiar (reflink/clone) non é compatíbel ou non funcionaCopiar (reflink/clone) non é compatíbel ou non é válidoCopiar un ou máis ficheirosCopia un ou máis ficheiros desde ORIXE a DESTINO.Copiar co ficheiroNon foi posíbel asignar %lu byte para ler o ficheiro «%s»Non foi posíbel asignar %lu bytes para ler o ficheiro «%s»Non foi posíbel conectar a %s: Non foi posíbel conectarse ao servidor proxy %s: Non foi posíbel conectar: Non foi posíbel crear un monitor de rede: Non foi posíbel crear un monitor de rede: %sNon foi posíbel determinar o uso de disco de %s: %sNon foi posíbel obter o estado da rede: Non foi posíbel cargar os esquemas desde %s a %s
Non foi posíbel abrir o conversor de «%s» a «%s»Non foi posíbel abrir o conversor de «%s» a «%s»: %sNon foi posíbel analizar o certificado PEM codificadoNon foi posíbel analizar a chave privada PEM codificadaNon foi posíbel analizar «%s» como unha máscara dun enderezo IPCrear cartafolesCrear cartafoles.Crear directorios paisNon é posíbel burlar as credenciais neste SODefinición personalizada para %so grupo DEFINE contén máis dunha ramaDESTINODISPOSITIVODIRECTORIOA compatibilidade de DTLS non está dispoñíbelAplicativo predeterminado para «%s»: %s
Eliminar un ou máis ficheirosEliminar os ficheiros fornecidos.O ficheiro de escritorio non especificou o campo ExecO destino %s non é un cartafolNome de destino a introspeccionarNome do destino onde invocar o métodoNome de destino a monitorizarNon foi posíbel atopar a cookie co id %d no anel de chave en «%s»Non respetar as restricións de nome de claveNon escribir o ficheiro compilado de gschemaO documento rematou inesperadamente despois do signo igual que segue a un nome de atributo; non hai valor de atributoO documento rematou inesperadamente dentro dun comentario ou instrución de procesamentoO documento rematou inesperadamente dentro dun nome de atributoO documento rematou inesperadamente dentro dun nome de elementoO documento rematou inesperadamente dentro dunha etiqueta de comezo de elemento.O documento rematou inesperadamente dentro da etiqueta que pechaba o elemento «%s»O documento rematou inesperadamente despois dun símbolo menor que '<'O documento rematou inesperadamente dentro dun valor de atributoO documento rematou inesperadamente con elementos aínda abertos - «%s» foi o último elemento abertoO documento rematou inesperadamente, esperábase ver un símbolo maior que '>' que pechase a etiqueta <%s/>O documento debe comezar cun elemento (por exemplo <book>)O documento estaba baleiro ou só contiña espazos en brancoNon crear e rexistrar o recurso automaticamenteNon exporte as funcións; decláreas en G_GNUC_INTERNALNon seguir as ligazóns simbólicasNon usar a copia e eliminación alternativasO valor "double" «%s» para %s está fóra do intervalomensaxe ERROR: falta o campo da cabeceira REPLY_SERIAL ou ERROR_NAMEETAGExpulsarPechouse o elemento «%s», mais o elemento aberto actualmente é «%s»Pechouse o elemento «%s», actualmente non hai ningún elemento abertoNon se permite o elemento <%s> no nivel superiorNon se permite o elemento <%s> non nivel superiorNon se permite o elemento <%s> dentro de <%s>Requírense os elementos <default> en <key>Byte NUL incrustado na entrada de conversiónByte NUL incrustado na saída de conversiónEmitir un sinal.Detectada unha entidade baleira '&;'; as entidades válidas son: &amp; &quot; &lt; &gt; &apos;Non se permiten nomes baleirosForneceuse unha ruta baleira.
Forneceuse un nome de esquema baleiro
A cadea baleira non é un númeroBaleirar o lixoAtopouse unha matriz cunha lonxitude de %u byte. A lonxitude máxima é 2<<26 bytes (64 MiB).Atopouse unha matriz cunha lonxitude de %u bytes. A lonxitude máxima é 2<<26 bytes (64 MiB).Atopouse unha matriz de tipo «a%c», agardábase ter unha de lonxitude de varios %u bytes, aínda que se atopou unha de %u bytes.Escriba o modo de servizo de GApplication (usar desde os ficheiros de servizo D-Bus)A entidade non remata cun punto e coma, probabelmente usou o carácter & sen a intención de comezar unha entidade, escriba o & como &amp;Non se coñece o nome de entidade '%-.*s'O enumerador está pechadoProduciuse un erro ao aceptar a conexión: %sProduciuse un erro ao autoiniciar: Produciuse un erro ao conectar co enderezo: %sProduciuse un erro ao chamar a StartServiceByName para %s:Produciuse un erro ao comprobar se SO_PASSCRED está activado para o socket: %sProduciuse un erro ao pechar o ficheiro de bloqueo «%s»: %sProduciuse un erro ao pechar o descritor do ficheiro: %sProduciuse un erro ao pechar o ficheiro: %sProduciuse un erro ao pechar o manexador: %sProduciuse un erro ao pechar o socket: %sProduciuse un erro ao comprimir o ficheiro: %sProduciuse un erro ao conectar: %s
Produciuse un erro ao crear a copia de seguranza: %sProduciuse un erro ao crear o directorio %s: %sProduciuse un erro ao crear o directorio %s: %sProduciuse un erro ao crear o ficheiro de bloqueo «%s»: %sProduciuse un erro ao eliminar o ficheiro de bloqueo antigo «%s»: %sProduciuse un erro ao deserializar o GVariant co tipo cadea «%s» desde o formato ligado D-BusProduciuse un erro durante a conversión: %sProduciuse un erro ao activar SO_PASSCRED: %sProduciuse un erro ao limpar a conexión: %s
Produciuse un erro ao obter a información do sistema de ficheiros %s: %sErro no enderezo «%s» — o atributo da familia está mal formadoErro no enderezo «%s» — falta o atributo do equipo ou está mal formadoErro no enderezo «%s» — falta o atributo do ficheiro de uso de unha vez ou está mal formadoErro no enderezo «%s» — o atributo do porto está mal formadoErro no enderezo «%s» — falta o atributo do porto ou está mal formadoErro no enderezo «%s» — o transporte unix require que se estabeleza exactamente unha das claves «path» ou «abstract»Produciuse un erro ao unirse ao grupo multicast: %sProduciuse un erro ao deixar o grupo multicast: %sProduciuse un erro ao crear a ligazón simbólica %s: %sProduciuse un erro ao mover o ficheiro %s: %sErro na liña %d carácter %d: Erro na liña %d: %sProduciuse un erro ao abrir o directorio «%s»: %sProduciuse un erro ao abrir o ficheiro %s: %sProduciuse un erro ao abrir o ficheiro %s: %sProduciuse un erro ao abrir o anel de chaves «%s» para a súa lectura:Produciuse un erro ao abrir o anel de chaves «%s» para escribir:Produciuse un erro ao abrir o ficheiro de uso de unha vez «%s»: %sProduciuse un erro ao analizar o XML de introspección: %s
Produciuse un erro ao analizar a opción %sProduciuse un erro ao analizar o parámetro %d do tipo «%s»: %s
Produciuse un erro ao analizar a opción %d: %s
Produciuse un erro ao ler o ficheiro %s: %sProduciuse un erro ao ler o ficheiro «%s»: %sProduciuse un erro ao ler do descritor do ficheiro: %sProduciuse un erro ao ler do ficheiro: %sProduciuse un erro ao ler do manexador: %sProduciuse un erro ao ler o ficheiro de uso de unha vez «%s»:, esperábanse 16 bytes, obtivéronse %dProduciuse un erro ao ler o ficheiro de uso de unha vez «%s»: %sProduciuse un erro ao ler da entrada estándarProduciuse un erro ao recibir datos: %sProduciuse un erro ao recibir a mensaxe: %sProduciuse un erro ao eliminar o ficheiro %s: %sProduciuse un erro ao retirar a ligazón da copia de seguranza antiga: %sProduciuse un erro ao retirar o ficheiro antigo: %sProduciuse un erro ao retirar o ficheiro obxectivo: %sProduciuse un erro ao renomear o ficheiro %s: %sProduciuse un erro ao renomear o ficheiro temporal: %sProduciuse un erro ao resolver «%s»Produciuse un erro ao resolver «%s»: %sProduciuse un erro ao devolver co corpo de tipo «%s»Produciuse un erro ao devolver co corpo baleiroProduciuse un erro ao resolver inversamente «%s»: %sProduciuse un erro ao buscar no ficheiro: %sProduciuse un erro ao enviar as credenciais:Produciuse un erro ao enviar datos: %sProduciuse un erro ao enviar a mensaxe: %sProduciuse un erro ao serializar o GVariant co tipo cadea «%s» desde o formato ligado D-BusProduciuse un erro ao estabelecer o contexto SELinux: %sProduciuse un erro ao estabelecer o atributo estendido «%s»: %sProduciuse un erro ao modificar a configuración ou o tempo de acceso: %sProduciuse un erro ao estabelecer o propietario: %sProduciuse un erro ao estabelecer os permisos: %sProduciuse un erro ao estabelecer a propiedade «%s»: Esperábase o tipo «%s» pero obtívose «%s»Produciuse un erro ao estabelecer a ligazón simbólica: %sProduciuse un erro ao estabelecer a ligazón simbólica: o ficheiro non é unha ligazónProduciuse un erro ao iniciar («spawn») a orde «%s»:Produciuse un erro ao empalmar o ficheiro: %sProduciuse un erro ao mover ao lixo o ficheiro %s: %sProduciuse un erro ao truncar o ficheiro: %sProduciuse un erro ao desescapar a clave ou o valor no par clave/valor %d, «%s», no elemento de enderezo «%s»Produciuse un erro ao abrir o ficheiro de bloqueo «%s»: %sProduciuse un erro ao obter a información do directorio «%s»: %sProduciuse un erro ao obter información do descritor do ficheiro: %sProduciuse un erro ao obter a información do ficheiro «%s»: %sProduciuse un erro ao compilar a expresión regular %s no carácter %d: %sProduciuse un erro ao desactivar SO_PASSCRED: %sProduciuse un erro ao estabelecer a equivalencia da expresión regular %s: %sProduciuse un erro ao optimizar a expresión regular %s: %sProduciuse un erro ao analizar o texto de substitución «%s» no carácter %lu: %sProduciuse un erro ao gravar os contidos do ficheiro de uso de unha vez «%s» ao fluxo:Produciuse un erro ao escribir no ficheiro de uso de unha vez en «%s»: %sProduciuse un erro ao escribir no descritor do ficheiro: %sProduciuse un erro ao escribir no ficheiro: %sProduciuse un erro ao escribir no manexador: %sProduciuse un erro ao escribir ao stdoutErro: %s
Erro: %s non é un nome de bus válido
Erro: %s non é un nome de interface correcto
Erro: %s non é un nome de membro correcto
Erro: %s non é un nome válido
Erro: %s non é unha ruta a un obxecto correcta
Erro: %s non é un nome de bus único correcto.
Erro: %s non é un nome de bus válido e coñecido.
Erro: Debe especificar un servizo a activar.
Erro: Debe especificar un servizo a agardar.
Erro: non se especificou un destino
Erro: non se especificou o nome do método
Erro: o nome do método «%s» non é válido
Erro: non se especificou unha ruta de obxecto
Erro: non se especificou o nome do sinal
Erro: o nome do sinal «%s» non é válido
Erro: Demasiados argumentos.
Erro: non é posíbel monitorizar unha conexión non-message-bus
ETAG non dispoñíbel
Debe especificar exactamente un de «type», «enum» ou «flags» como un atributo de <key>Agotáronse todos os mecanismos de autenticación dispoñíbel (tentaronse: %s) (dispoñíbeis: %s)Non foi posíbel retirar o ficheiro existente «%s»: g_unlink() fallou: %sEsperábase un byte NUL despois da cadea «%s» pero atopouse o byte %dEsperábase un GEmblem para o GEmblemedIconEsperábase unha cadea UTF-8 correcta pero atopáronse bytes non válidos no byte desvío %d (a lonxitude da cadea é %d). A cadea UTF-8 correcta até ese punto foi «%s»Esperando 1 mensaxe de control, obtívose %dEsperando 1 mensaxe de control, obtivéronse %dEsperando un descritor de ficheiro (fd), pero obtívose %d
Esperando un descritor de ficheiro (fd), pero obtivéronse %d
Esperábase ler un só byte para recibir as credenciais pero léronse creo bytesExtraer un ficheiro de recurso a stdoutFICHEIROFICHEIRO RUTAFICHEIRO [RUTA]Produciuse un erro ao reservar memoriaProduciuse un erro ao cambiar ao directorio «%s» (%s)Produciuse un erro ao crear o ficheiro «%s»: %sProduciuse un erro ao crear a canalización para comunicarse co proceso fillo (%s)Produciuse un erro ao crear o ficheiro temporal: %sProduciuse un erro ao executar o proceso fillo (%s)Produciuse un erro ao executar o proceso fillo «%s» (%s)Produciuse un erro ao executar o programa asistente (%s)Produciuse un erro ao expandir a liña executábel «%s» co URI «%s»Produciuse un erro ao facer fork (%s)Produciuse un erro ao facer fork ao proceso fillo (%s)Produciuse un erro ao obter os atributos do ficheiro «%s%s%s%s»: fstat() fallou: %sProduciuse un erro ao obter os atributos do ficheiro «%s»: fstat() fallou: %sProduciuse un erro ao ler a información do xestor «%s»Produciuse un erro ao buscar «%s» en calquera directorio fonteProduciuse un erro ao buscar «%s» no directorio actualProduciuse un erro ao mapear «%s%s%s%s»: mmap() fallou: %sProduciuse un erro ao abrir o ficheiro «%s»: %sProduciuse un erro ao abrir o ficheiro «%s»: fdopen() fallou: %sProduciuse un erro ao abrir o ficheiro «%s»: open() fallou: %sProduciuse un erro ao analizar '%-.*s', que debería ser un díxito dentro dunha referencia de carácter (por exemplo &#234;) - pode que o díxito sexa grande de máisProduciuse un erro ao analizar o valor <default> do tipo «%s»Produciuse un erro ao ler datos desde un proceso filloProduciuse un erro ao ler datos desde un proceso fillo (%s)Fallo de lectura de suficientes datos desde a canalización filla co PID (%s)Produciuse un erro ao ler desde a canalización filla (%s)Produciuse un erro ao ler desde o ficheiro «%s»: %sProduciuse un erro ao ler a ligazón simbólica «%s»: %sProduciuse un erro ao redireccionar a saída ou entrada do proceso fillo (%s)Produciuse un erro ao renomear o ficheiro «%s» como «%s»: g_rename() fallou: %sProduciuse un erro ao redimensionar o fluxo de saída da memoriaProduciuse un erro ao estabelecer «%s» como xestor predeterminado para «%s»: %s
Produciuse un erro ao escribir o ficheiro «%s»: fsync() fallou: %sProduciuse un erro ao escribir o ficheiro «%s»: write() fallou: %sO ficheiro %s aparece varias veces no recursoO enumerador do ficheiro ten unha operación excepcionalO enumerador do ficheiro xa está pechadoOs nomes de ficheiro non poden conter «%c»O ficheiro «%s» é demasiado grandeO sistema de ficheiros non é compatíbel coas ligazóns simbólicasRaíz do sistema de ficheirosO primeiro token da liña %d no anel de chaves en «%s» co contido «%s» está malformadoSeguir as ligazóns simbólicas, montaxes e atallosOpcións de GApplicationGCredentials non contén un ID de proceso para este SOGCredentials non está implementado neste SO%H:%M:%S%I:%M:%S %p%a %H:%M:%S, %e de %B de %Y%d/%m/%yAMPMO GSocketControlMessage non está permitido en WindowsXerar lista de dependenciasXerar saída no formato seleccionado pola extensión do nome do ficheiro obxetivoXerar unha cabeceira de orixeXera o código fonte usado para ligar o ficheiro do recurso no seu códigoObter a información do sistema de ficheirosObtén ou estabelece o xestor para o tipo mimeObtén ou estabelece o xestor para o tipo mime.Obtén o valor de CLAVEXESTORProduciuse un fallo na autenticación co proxi HTTPRequírese autenticación no proxy HTTPProduciuse un fallo na conexión co proxi HTTP: %iNon se permite a conexión co proxi HTTPA conexión co servidor proxi HTTP pechouse de forma non esperada.Opcións de axuda:Equipo non atinxíbelO equipo non é atinxíbel mediante o servidor SOCKSv5.O nome do host «%s» contén «[» mais non «]»O nome do equipo «%s» é demasiado longo para o protocolo SOCKSv5O nome do equipo «%s» é demasiado longo para o protocolo SOCKSv5Se non se fornece un xestor, mostra os aplicativos rexistrados e
recomendados para o tipo mime. Se se fornece o xestor, estabelecese
o xestor predeterminado para o tipo mime. Ignorar os ficheiros non existentes, non preguntar nuncaIgnorar operacións de ficheiro non resoltas ao desmontar ou expulsarIgnorado, para compatibilidade con GTestDbusIgnorando a sobrescritura para esta clave.
Ignorando este ficheiro.
Inclúe obxectivos phony no ficheiro de dependencias xeradoA secuencia de bytes non é válida na entrada da conversiónO fluxo de entrada non implementa a lecturaO fluxo de entrada non implementa seekO valor enteiro «%s» para %s está fóra do intervaloO valor enteiro «%s» está fóra do intervaloNome da interface demasiado largaInterface non atopada: %sProduciuse un erro interno no servidor proxy SOCKSv5.Erro interno: %sIntrospecciona un obxecto remoto.Introspeccionar filloProporcionouse un GSeekType non válidoTipo de cadea GVarian «%s» non válidaO texto do nome codificado en UTF-8 non é válido - «%s» non válidoO tipo de atributo non é válido (esperábase unha cadea de bytes)Tipo de atributo non válido (esperábase unha cadea)O tipo de atributo non é válido (esperábase uint32)O tipo de atributo non é válido (esperábase uint64)Tipo de atributo %s non válidoA secuencia de bytes non é válida na entrada da conversiónDatos comprimidos incorrectosDominio non válidoValor de «endianness» non válido. Esperábase 0x6c («|») ou 0x42 («B») pero atopouse 0x%02xNome estendido do atributo non válidoO nome do ficheiro non é válidoO nome do ficheiro non é válido %sNome de grupo non válido: %sO nome do host non é válidoNome de clave non válido: %sA versión maior do protocolo non é válida. Esperábase 1 pero atopouse a %dNome «%s» non válido: o carácter «%c» non é válido; só se permiten letras en minúsculas, números e guións («-»).Nome «%s» non válido: a lonxitude máxima é 1024Nome «%s» non válido: os nomes deben comezar por unha letra minúsculaNome «%s» non válido: o último carácter non pode ser un guión («-»).Nome «%s» non válido: non se permiten dous guións seguidos («--»).Valor numérico non válidoO socket non é válido, non se inicializouNome de programa non válido: %sPetición de busca non válidaSecuencia non válida na entrada da conversiónO socket non é válido, a inicialización fallou debido a: %sO socket non é válido, non se inicializouCadea non válida no vector de argumento en %d: %sCadea non válida no ambiente: %sO valor da ligazón simbólica dada non é válidoDirectorio de traballo non válido: %sInvocar un método nun obxecto remoto.Invocar unha acción no aplicativoManter co ficheiro ao moverO ficheiro clave contén un carácter de escape ao final da liñaO ficheiro clave contén a secuencia de escape non válida «%s»O ficheiro clave contén a clave «%s» no grupo «%s» que ten un valor que non é posíbel interpretar.O ficheiro clave contén a clave «%s» que ten un valor que non é posíbel interpretar.O ficheiro clave contén a clave «%s» co valor «%s» que non é UTF-8O ficheiro clave contén a liña «%s» que non é un par valor-clave, grupo ou comentarioO ficheiro clave contén unha codificación non permitida «%s»O ficheiro clave non ten un grupo «%s»O ficheiro clave non ten a clave «%s» no grupo «%s»O ficheiro clave non comeza cun grupoA clave «%s» do grupo «%s» ten o valor «%s», pero agardábase %sO par clave/valor %d, «%s» no elemento do enderezo «%s» non contén un signo de igualLOCALICCIÓNIniciar un aplicativoInicia un aplicativo (con ficheiros opcionais a abrir)Datos restantes non convertidos no búfer de lecturaA lonxitude %u é demasiado longa para un enderezoA liña %d do anel de chaves en «%s» con contido «%s» está malformadaListarListar aplicativosListar as accións dispoñíbeisLista os contidos dos directorios nun formato árbore.Lista as clave e valores, recursivamente
Se non se fornece un ESQUEMA, lista todas as claves
Listar os recursos
Se se fornece SECCIÓN, só se listarán os recursos desta sección
Se se fornece RUTA, só se listarán os recursos que coincidanListar os recursos con detalles
Se se fornece SECCIÓN, só se listarán os recursos desta sección
Se se fornece RUTA, só se listarán os recursos que coincidan
Os detalles inclúen a sección, tamaño e compresiónLista as seccións que conteñen recursos nun ficheiro elfListar as accións estáticas para un aplicativo (desde un ficheiro .desktop)Lista dos fillos do SCHEMALista os contidos das localizaciónsLista os contidos das localizacións.Lista dos esquemas instalados (non reposicionábeis)Lista os aplicativos activábeis por D-Bus instalados (por ficheiros .desktop)Lista dos esquemas instalados reposicionábeisLista das claves de ESQUEMALista de atributos escribíbeisO porto de escoita xa está pechadoLista os contidos da localización nunha árboreLocalización non especificadamensaxe METHOD_CALL: falta o campo da cabeceira PATH ou MEMBERmensaxe METHOD_RETURN: falta o campo da cabeceira REPLY_SERIALTIPOMIMEDatos de entrada formados incorrectamente para o GFileIconNúmero formado incorrectamente de tokens (%d) na codificación de GEmblemNúmero formado incorrectamente de tokens (%d) na codificación de GEmblemediconNúmero de versión formado incorrectamente: %sCombinación de par clave/valor sen sentido na entrada do enderezo «%s»O fluxo de saída da memoria non é redimensionábelO corpo da mensaxe ten a sinatura «%s» máis non está presente a cabeceira de sinaturaO corpo da mensaxe ten a sinatura de tipo «%s» pero a sintura no campo da cabeceira é «%s»O corpo da mensaxe está baleiro máis a sinatura do campo da cabeceira é «(%s)»O método «%s» na interface «%s» coa sinatura «%s» non existeO método «%s» devolveu un tipo «%s» máis esperábase «%s»Método e nome da interfaceFalta un argumentoArgumento que falta para %sMonitorizar os cambios da CLAVE.
Se non se especifica a CLAVE, monitoriza todos os cambios en ESQUEMA.
Use ^C para deter a monitorización.
Monitorizar un directorio (predeterminado: depende do tipo)Monitorizar un ficheiro (predeterminado: depende do tipo)Monitorizar un ficheiro directamente (detecta os cambios feitos mediante ligazóns duras)Monitoriza un obxecto remoto.Monitorizar eventosMonitorizar cambios en ficheiros ou cartafolesMonitorizar os cambios en ficheiros e cartafoles.Monitoriza un ficheiro directamente, pero non informa dos cambiosMonitorizar como montábelMontar ou desmontar as localizaciónsMontar ou desmontar as localizacións.Montar volume como ficheiro de dispositivoMontado %s en  %s
Non se permite mover entre puntos de montaxeMover ficheiros ou directorios ao lixoMove os ficheiros ou directorios ao lixo.Mover un ou máis ficheirosMove un ou máis ficheiros desde ORIXE a DESTINO.Especificáronse varios puntos finais da conexiónDebe especificar un tipo mime único, e pode que un xestorNOMENecesítase máis entradaA rede non é atinxíbelA rede non é atinxíbel mediante o proxy SOCKSv5.A versión NetworkManager é demasiado antigaNon mostrar nunha as ligazóns simbólicasNon existe <key name='%s'> para sobrescribirNon hai un rexistro de DNS do tipo solicitado para «%s»Non hai ningún tipo MIME definido no marcador para o URI «%s»Non se atopou ningún certificado PEM codificadoNon se atopou ningún certificado PEM codificadoNon se especificou ningún enderezoNon hai ningún aplicativo rexistrado para manexar este ficheiroNingún aplicativo denominado «%s» rexistrou un marcador para «%s»Non se atopou ningún marcador para o URI «%s»Non se especificou o punto final da conexiónNon hai ningún aplicativo predeterminado para «%s»
Non se forneceu un destinoNon existe ningún grupo definido no marcador para o URI «%s»Non se forneceron localizaciónsNon se definiu ningún parámetro privado no marcador para o URI «%s»Non hai aplicativos recomendados
Non hai aplicativos rexistrados
Non se atoparon ficheiros de esquema: Non hai esquemas instalados
Non hai unha cabeceira da sinatura na mensaxe pero o corpo da mensaxe ten %u byteNon hai unha cabeceira da sinatura na mensaxe pero o corpo da mensaxe ten %u bytesNon existe a interface «%s»Non existe a interface «%s» no obxecto coa ruta %sNon existe a interface «org.freedesktop.DBus.Properties» no obxecto coa ruta %sNon existe a clave «%s» no esquema «%s» como se especificou no ficheiro de sobrescritura «%s»Non existe a clave «%s»
Non existe o método «%s»Non existe a propiedade «%s»Non existe o esquema «%s»
Non se admite o multicast IPv4 específico da fonteNon se admite o multicast IPv6 específico da fonteNon se admite o multicast específico da fonteNon hai un directorio obxectivoNon hai un tipo para o nome de clase %sNon se atopou ningún enderezo válidoNon foi posíbel atopar un ficheiro de marcadores válido nos directorios de datosNon hai un volume para o ficheiro de dispositivoNon é un ficheiro normalSen memoria dabondoNon hai espazo abondo para o enderezo do socketNon hai espazo abondo para o enderezo do socketNon se esperaba unha mensaxe de control, pero obtívose %dO número de descritores de ficheiro no mensaxe (%d) difire do campo cabeceira (%d)O número «%s» está fóra de rango [%s, %s]Ruta do obxecto sobre o que emitir o sinalRuta do obxecto a introspeccionarRuta ao obxecto onde invocar o métodoRuta do obxecto a monitorizarCarácter estraño «%s», esperábase un '=' despois do nome do atributo «%s» do elemento «%s»Carácter estraño «%s», esperábase un carácter '>' para pechar a etiqueta de elemento baleiro «%s»Carácter estraño «%s», esperábase un carácter '>' ou '/' para pechar a etiqueta de comezo do elemento «%s» ou opcionalmente un atributo; quizais usou un carácter non válido no nome dun atributoCarácter estraño «%s», esperábase unhas comiñas de apertura despois do signo igual para dar un valor ao atributo «%s» do elemento «%s»Só crear se non existeNon se permite un elemento <%s> dentro de <%s>Só mostrar propiedadesAbrir ficheiros con un aplicativo predeterminadoAbrir os ficheiros co aplicativo predeterminado
que está rexistrado para xestionar ficheiros
deste tipo.Operación non permitidaA operación foi canceladaDestino opcional para o sinal (nome único)Parámetro opcional para a invocación da acción, en formato GVariantNomes de ficheiros relativos ou relativos opcionais, ou URIs a abrirOpción para especificar a conexión do extremoOpcións:O fluxo de saída non implementa a escrituraOmitir o ID do aplicativoPARÁMETROCAMIÑOA biblioteca PCRE está compilada con opcións non compatíbeisA biblioteca PCRE está compilada sen compatibilidade con propiedades UTF8A biblioteca PCRE está compilada sen compatibilidade con UTF8os elementos de colación POSIX non se admitenAs clases de nomes POSIX só se permiten dentro dunha claseO valor «%s» analizado para a variante non é unha sinatura de D-Bus correctaO valor analizado «%s» non é unha ruta de obxecto D-Bus correctaO valor analizado «%s» non é unha sinatura D-Bus correctaO valor analizado «%s» non é unha sinatura D-Bus correcta (para o corpo)Hai unha secuencia de carácter parcial ao final da entradaA ruta debe comezar cunha barra (/)
A ruta debe rematar cunha barra (/)
A ruta non debe conter dúas barras adxacentes (//)
Os permisos no directorio «%s» están malformados. Esperábase o modo 0700 e obtívose 0%oManter todos os atributosImprimir XMLImprimir enderezoImprimir enderezo en modo consolaMostrar os URIs completosImprimir axudaImprimir novo etag ao finalMostrar versiónMostrar información da versión e saírMostrar información da versión e saír.Preguntar antes de sobrescribirNon é posíbel escribir a propiedade %sNon é posíbel escribir a propiedade %sNon é posíbel usar o proxy co protocolo «%s».Non se permite a conexión ao proxy mediante unha conexión que non sexa TCP.Consulta a descrición para a CLAVEConsulta o intervalo de valores válidos de CLAVEO texto citado non comeza con comiñasLer da entrada en estándar e gardarLer da entrada en estándar e gardar en DEST.Recibiuse un descritor de ficheiro (fd) incorrectoAplicativos recomendados:
Aplicativos rexistrados:
Renomear un ficheiroRenomear un ficheiro.Renomeado con éxito. Nova uri: %s
Informa dos movementos e renomeados como eventos de eliminación/creación simplesSolicitouse unha busca antes do inicio do fluxoSolicitouse unha busca máis aló do final do fluxoEstabelece a CLAVE ao seu valor predeterminadoRestabelecer todas as claves nun ESQUEMA aos seus valores predeterminadosExecutar servizo dbusESQUEMA[:RUTA]ESQUEMA[:RUTA] CLAVEESQUEMA[:RUTA] CLAVE VALORESQUEMA[:RUTA] [CLAVE]ESQUEMASECCIÓNO contexto SELinux debe ser non-NULLSELinux non está activado neste sistemamensaxe SIGNAL: falta o campo da cabeceira PATH, INTERFACE ou MEMBERmensaxe SIGNAL: O campo da cabeceira INTERFACE está usando un valor reservado org.freedesktop.DBus.Localmensaxe SIGNAL: o campo da cabeceira PATH está usando un valor reservado /org/freedesktop/DBus/LocalSOCKSv4 non ten compatibilidade para enderezos IPv6 «%s»A autenticación SOCKSv5 fallou debido a un nome de usuario ou contrasinal incorrectos.Non se permite a conexión SOCKSv5 debido ao conxunto de regras.O proxy SOCKSv5 non é compatíbel co tipo de enderezo fornecido.O proxy SOCKSv5 non é compatíbel coa orde «connect».ORIXEO esquema «%s» non pode reposicionarse (non debe especificar a ruta)
O esquema «%s» pode reposicionarse (debe especificarse a ruta)
O segundo token da liña %d no anel de chaves en «%s» co contido «%s» está malformadoNon se permite buscar no fluxo baseNon se permite buscar no fluxoServizo a activar antes de agardar polo outro (nome coñecido)O DBus de sesión non está executándose e o autoiniciado fallouEstabelecer un atributo de ficheiroEstabelece un atributo de ficheiro da LOCALIZACIÓN.Estabelece o valor de CLAVE a VALORAtributos estabelecíbeis:
Non se permite estabelecer o atributo %s Escribiu varias veces o contrasinal incorrecto, se falla de novo bloquearase o acceso.Mostrar as opcións de GApplicationMostrar todas as opcións de axudaMostrar información adicionalMostrar as opcións de axudaMostrar os ficheiros ocultosMostrar información sobre as localizaciónsMostrar información sobre as localizacións.Mostrar a versión do programa e saírMostrar progresoNomes da interface e sinalAtopouse a cabeceira de sinatura coa sinatura «%s» máis o corpo da mensaxe está baleiroTempo de espera do Socket de E/S superadoO fluxo de orixe xa está pechadoO fluxo de orixe xa está pechadoNon se admite a uniónO fluxo non permite query_infoO fluxo ten unha operación excepcionalO fluxo xa se pechouAs ligazóns simbólicas non se admitenA compatibilidade de TLS non está dispoñíbelTIPOO destino %s non é un directorioO ficheiro de destino xa existeO ficheiro destino é un directorioO ficheiro destino non é un ficheiro normalO modelo «%s» non contén XXXXXXO modelo «%s» non é válido, non debería conter «%s»Non é posíbel resolver temporalmente «%s»O texto rematou antes de atopar a comiña final para %c. (O texto era «%s»)O texto rematou despois dun carácter «\». (O texto era «%s»)O texto non debe aparecer dentro de <%s>O texto estaba baleiro (ou só contiña espazos en branco)SOCKSv5 require un método de autenticación que non é compatíbel con GLib.O proxy SOCKSv5 require autenticación.O servidor proxy SOCKSv5 usa un tipo de enderezo descoñecido.O URI «%s» contén caracteres de escape non válidosO URI «%s» non é válidoO URI «%s» non é un URI absoluto usando o esquema «file»O nome de acción a invocarOs atributos a obterA orde para imprimir a axuda detalladaA conexión está pechadoO directorio da que se ten que ler os ficheiros (o predeterminado é o directorio actual)O etag do ficheiro foi sobrescritoO ficheiro foi modificado externamenteO enderezo fornecido está baleiroO nome de host do URI «%s» non é válidoEsta chave non é escribíbel
O URI do ficheiro local «%s» non pode incluír un «#»O contrasinal introducido é incorrecto.A ruta dunha lista debe rematar con «:/»O nome da ruta «%s» non é un camiño absolutoO valor fornecido está fora do intervalo válido
Non existe o recurso en «%s»Produciuse un erro ao descomprimir o recurso en «%s»O recurso en «%s» non é un cartafolO servidor non é un servidor proxy SOCKSv4.O servidor non é un servidor proxy SOCKSv5.A cadea «%s» non é un GUID de D-BUS correctaA súa plataforma non ten compatibilidade con GCredentialsIgnorouse este ficheiro completamente.
Esta é a última oportunidade para escribir o contrasinal corretamente antes de que se bloquee o acceso.Tempo de expiración en segundosTempo de espera máximo a agardar antes de saír con un erro (segundos); 0 para non ter tempo de espera (valor por omisión)Tempo de espera máximo alcanzadoO valor de conta pasado a %s é demasiado longoDemasiados argumentosTransferíronse %s de %s (%s/s)O Lixo non é compatíbelNon se permite truncar no fluxo de entradaNon se permite truncar no fluxo baseNon se permite truncar no fluxoO tipo %s non implementa from_tokens() na interface do GIconO tipo %s non implementa unha interface GIconO tipo %s non ten unha claseO tipo da mensaxe, «%s», non coincide co tipo «%s» esperadoTipo do atributoNon é posíbel crear o socket: %sNon é posíbel crear o directorio do lixo %s: %sNon é posíbel crear a información de lixo para o ficheiro %s: %sNon é posíbel atopar o tipo de monitorización do ficheiro local predeterminadoNon é posíbel atopar ou crear o directorio do lixo para %sNon é posíbel atopar o terminal requirido polo aplicativoNon é posíbel atopar o directorio de nivel superior para mover ao lixo %sNon é posíbel obter o perfil de hardware: %sNon é posíbel obter o erro pendente:Non é posíbel ler /var/lib/dbus/machine-id ou /etc/machine-id: Non é posíbel ler as credenciais do socket: %sNon é posíbel obter a propiedade %s.%sNon é posíbel estabelecer a propiedade %s.%sNon é posíbel desconectar o socket: %sNon é posíbel mover ao lixo o ficheiro %sNon é posíbel mover ao lixo o ficheiro %s a través dos límites do sistema de ficheirosNon é posíbel mover ao lixo o ficheiro %s:  %sAtributo «%s» inesperado para o elemento «%s»Final de fluxo inesperadamente prematuroErro inesperado en g_io_channel_win32_poll() ao ler datos desde un proceso filloErro inesperado en select() ao ler datos dun proceso fillo (%s)Erro inesperado en waitpid() (%s)Falta de contido inesperada ao tentar ler (de forma segura) unha liñaFalta o contido inesperada ao tentar ler unha liñaResposta %d non esperada desde o método StartServiceByName(«%s»)Etiqueta «%s» inesperada dentro de «%s»Etiqueta «%s» inesperada, esperábase a etiqueta «%s»Tipo de datos subsidiarios inesperadosErro no proxy SOCKSv5 descoñecido.Tipo de bus %d descoñecidoOrde «%s» descoñecida

Produciuse un erro descoñecido ao executar o proceso fillo «%s»Erro descoñecido ao conectarEspecificouse unha familia descoñecidaOpción %s descoñecidaTransporte «%s» descoñecido ou non compatíbel para o enderezo «%s»Opción de procesado descoñecida «%s»Especificouse un protocolo descoñecidoTipo descoñecidoComiñas non pechadas na liña de ordes ou noutro texto citado nun intérprete de ordesDesmontarDesmonta todos os puntos de montaxe co esquema fornecidoSen nomeCaracter non representábel na entrada da conversiónAtopáronse opcións non compatíbeis ao construír a conexión da parte clienteClave «%s» non admitida na entrada do enderezo «%s»Non se admite o enderezo do socketFamilia de socket non admitidaUso:Uso:
Uso:
  gresource %s%s%s %s

%s

Uso:
  gresource [--section SECCIÓN] ORDE [ARGS...]

Ordes:
  help                      Mostra esta información
  sections                  Mostra as seccións do recurso
  list                      Mostra os recursos
  details                   Mostra os recursos con detalles
  extract                   Extraer un recurso

Use 'gresource help ORDE' para obter axuda detallada.

Uso:
  gsettings --version
  gsettings [--schemadir CARTAFOL_ESQUEMA] COMANDO [ARGS…]

Ordes:
  help                      Mostra esta información
  list-schemas              Mostra os esquemas instalados
  list-relocatable-schemas  Mostra os esquemas instalados reubicábeis
  list-keys                 Mostra as claves dun esquema
  list-children             Mostra os fillos nun esquema
  list-recursively          Lista claves e valores, recursivamente
  range                     Consulta o rango dunha chave
  describe                  Consulta a descrición dunha chave
  get                       Obtén os valores dunha clave
  set                       Estabelece o valor dunha clave
  reset                     Restabelece o valor dunha clave
  reset-recursively         Restabelecer todos os valores dun esquema fornecido
  writable                  Comproba se a clave é escribíbel
  monitor                   Monitoriza cambios

Use 'gsettings help ORDE' para obter máis axuda.

Uso:
  gsettings [--schemadir DIRECTORIO_ESQUEMA] %s %s

%s

Use '%s help ORDE' para obter axuda detallada.
Usar un formato de listado longoUsar un usuario anónimo ao autenticarseUse «%s help ORDE» para obter axuda detallada.

O nome de usuario é demasiado longo para o protocolo SOCKSv5O nome de usuario ou contrasinal son demasiado longos para o protocolo SOCKSv5.VALORNon é posíbel atopar un ficheiro de clave correcto nos directorios de buscaValor non especificadoNon é posíbel interpretar o valor «%s» como un booleano.Non é posíbel interpretar o valor «%s» como un número flotante.Non é posíbel interpretar o valor «%s» como un número.Agardar que apareza un nome de bus.Agardando pola situación do socket: %sQuíxose ler %lu byte pero obtívose un %luQuixéronse ler %lu bytes pero obtívose un %luAviso: segundo os datos de introspección a interface «%s» non existe
Aviso: segundo os datos de introspección o método «%s» non existe na interface «%s»
Aviso: O esquema «%s» ten unha ruta «%s».  As rutas que comezan con «/apps/», «/desktop/» ou «/system/» están obsoletas.Aviso: referencia non definida a <schema id='%s'/>Seguir os eventos de montaxeAo crear, restrinxir o acceso ao usuario actualAo substituír, substituír se o destino non existeEspazos de nomes de atributo escribíbeis:
Argumentos incorrectos
Número incorrecto de tokens (%d)Debería fornecer exactamente un nome de cartafol
Debería fornecer exactamente un nome de ficheiro
[ARGS...][ARGS...][ORDE][OPCIÓN…][OPCIÓN…] NOME-BUS[RUTA][ESQUEMA[:RUTA]]\ ao final do patrónnon se permite \C en asercións lookbehindnon se permite \N nunha clase\c ao final do patrón\c debe estar seguido dun carácter ASCII\g non está seguido por un nome entre chaves, corchetes angulares ou un número entre comiñas, ou por un número simple\k non está seguido por un nome entre chaves, corchetes angulares ou entre comiñas] é un carácter de datos non válido no modo de compatibilidade de JavaScriptunha referencia co número non pode ser ceroAbrAgoDecFebXanXulXuñoMarMaioNovOutSepAbrAgoDecFebXanXulXuñMarMaiNovOutSepVenLunSábDomXovMarMero nome da acción debe fornecerse logo do id de aplicativo
as accións aceptan un máximo dun parámetro
o alias do obxectivo «%s» non está en <choices>o alias do obxectivo «%s» non é un tipo enumeradonon se permite un argumento para (*ACCEPT), (*FAIL), ou (*COMMIT)esperábase unha aserción despois de (?(atributos:
as referencias anteriores como condicións non se permiten na coincidencia parcialalcanzouse o límite de "backtracking"desplazamento erróneoo valor do carácter na secuencia \u.... é demasiado longoo valor do carácter na secuencia \x{…} é demasiado longodesbordamento de códigoo grupo condicional contén máis de dúas ramasobxecto danadonon foi posíbel obter un enderezo local: %snon foi posíbel obter un enderezo remoto: %snon foi posíbel escoitar: %screando o GSocket a partir de fd: %snon se permiten diferentes nomes para subpatróns do mesmo númeroesperábase un díxitoagardábase un díxito despois de (?+nome en pantalla: %s
sen facer nada.
a unidade non implementa a expulsióna unidade non implementa eject ou eject_with_operationa unidade non implementa a consulta para mediosa unidade non implementa o inicioa unidade non implementa a detenciónnome de edición: %s
produciuse un erro ao analizar o parámetro da acción: %s
produciuse un erro ao analizar a clave «%s» no esquema «%s» como se especificou no ficheiro de sobrescritura «%s»: %s.produciuse un erro ao enviar a mensaxe %s ao aplicativo: %s
as secuencias de escape \L, \l, \N{nome}, \U, e \u non se admitenproduciuse un erro ao obter a memoriaos balores das bandeiras deben ter cando menos un bit estabelecidoAbrilAgostoDecembroFebreiroXaneiroXulloXuñoMarzoMaioNovembroOutubroSetembroAbrilAgostoDecembroFebreiroXaneiroXulloXuñoMarzoMaioNovembroOutubroSetembroVenresLunsSábadoDomingoXovesMartesMércoresg_socket_get_credentials non está implementado para este sistema operativogio pode traballar como a utilidade cat tradicional, pero usando localizacións
GIO no lugar de ficheiros locais: por exemplo, pode usar algo así como 
smb:////server/resource/file.txt como localización.gio copy é similar á utilidade cp tradicional, pero usando localizacións
GIO no lugar de ficheiros locais: por exemplo, pode usar algo así como 
smb:////server/resource/file.txt como localización.gio info é similar á utilidade ls tradicional, pero usando localizacións
GIO no lugar de ficheiros locais: por exemplo, pode usar algo así como 
smb:////server/resource/file.txt como localización. Os atributos de
ficheiro poden especificarse como un nome GIO, p.ex. standard::icon,
ou simplemente polo espazo de nomes, p.ex. unix. ou por «*», que
coincide con todos os atributos.gio list é similar á utilidade ls tradicional, pero usando localizacións
GIO no lugar de ficheiros locais: por exemplo, pode usar algo así como 
smb:////server/resource/file.txt como localización. Os atributos de ficheiro
poden especificarse co nome GIO, p.ex. standard::icongio mkdir é similar á utilidade mkdir tradicional, pero usando localizacións
GIO no lugar de ficheiros locais: por exemplo, pode usar algo así como 
smb:////server/resource/file.txt como localización.gio move é similar á utilidade mv tradicional, pero usando localizacións
GIO no lugar de ficheiros locais: por exemplo, pode usar algo así como 
smb:////server/resource/file.txt como localización.esperábase un díxito hexadecimalesperábase un díxito hexadecimal ou '}'oculto
referencia simbólica ilegalopcións NEWLINE inconsistenteserro internoerro interno ou obxecto danadonome da acción non válido: «%s»
os nomes de acción deben consistir só de alfanuméricos, «-» e «.»
id de aplicativo non válido: «%s»
combinación non válida de marcas de liña novacondición non válida (?(0)secuencia de escape non válida na clase de carácterl10n solicitado, pero non existe o dominio gettexta orde list-actions recolle só o id de aplicativoa aserción lockbehind non ten unha lonxitude fixasecuencia \P ou \p formada incorrectamentenúmero ou nome formado incorrectamente despois de (?(falta un ) despois do comentariofalta o nome do subpatrón despois de (?&falta o ) de terminaciónfalta a terminación ] para a clase de carácterfalta a terminación no nome do subpatrónfalta «<» na referencia simbólicaa montaxe non implementa a averiguación do tipo de contidoa montaxe non implementa a averiguación síncrona do tipo de contidomount non implementa «extraer»a montaxe non implementa a «eject» ou a "eject_with_operation"a montaxe non implementa "remount"montaxe non implementa «desmontaxe»a montaxe non implementa o «unmount» ou a «unmount_with_operation»o nome é demasiado longo en (*MARK), (*PRUNE), (*SKIP), ou (*THEN)nome do ficheiro de dependencia a xeraro nome do ficheiro de saídanome: %s
o alcume debe ter cando menos 2 caracteresnada que repetiro número é demasiado grandenúmero demasiado grande no cuantificador {}números fóra do intervalo no cuantificador {}o valor octal é maior que \377sen memoriadesbordouse o espazo de traballo de compilacióna clave de sobrescritura «%s» no esquema «%s» no ficheiro de sobrescritura «%s» non está na lista de opcións válidasa clave de sobrescritura «%s» no esquema «%s» no ficheiro de sobrescritura «%s» está fora do intervalo indicado no esquemanon se atopou o subpatrón referenciado comprobado previamenteintervalo fóra de orde na clase de carácteratinxiuse o límite de recursividadebucle de repeticiónunha chamada recursiva pode crear un bucle infinitoreferencia a un subpatrón non existentea expresión regular é demasiado longaretirouse o ficheiro de saída existente.
UTF8 curtotamaño:o source-specific non é un enderezo IPv4«\» final perdidoo nome do subpatrón é demasiado longo (máximo 32 caracteres)a ligazón simbólica debe ser non nulao texto non debe aparecer dentro de <%s>o patrón contén elementos non permitidos na coincidencia parcialdemasiadas referencias cara adiantedemasiados subpatróns con nome (máximo 10.000)conexto de tradución fornecido para o valor sen ter l10n activadodous subpatróns teñen o mesmo nomeo tipo é INVALIDtipo: %s
non foi posíbel conectar ao D-Bus: %s
non é posíbel atopar o ficheiro desktop para o aplicativo %s
repetición inesperadareferencia simbólica sen finalizarnome de clase POSIX descoñecidaerro descoñecidosecuencia de escape descoñecidanome de propiedade descoñecido despois de \P ou \porde descoñecida: %s

carácter non recoñecido despois de (? ou (?-carácter non recoñecido despois de (?<carácter non recoñecido despois de (?Pcarácter non recoñecido despois de \categoría l10n no admitida: %suri: %s
value='%s' xa especificadoo volume non implementa a expulsióno volume non implementa a «eject» ou «eject_with_operation»o volume non implementa o montadoonde almacenar o ficheiro compilado de gschemasreferencia simbólica de lonxitude cero«%s» non é un número con signo«%s» non é un número sen signo«%s» non recolle argumentos

«version» non recolle argumentosPK�m�\8.^��%�%LC_MESSAGES/sed.monu�[�����U�ql0�1,,5YN�7�\	_s	`�	u4
i�
bVw��D^%���5�B0
s
�
�
�
�
$�
/JWct}
�#�����
1H>��!���#=a{$���#�2P d���*�*+K
[#i#�&���,3L-a����
���4.'A:i`�?bEm�g�~�u�e
�pD*T�E�_a$z'�#��'/Hgt�
�(�
�#�"�$-MauL�!��1 @ [ x "� $� (� (!2*!0]!$�!-�!:�!"(/"+X"(�"�"9�"2�"(2#[#s#/�#/�#6�#$(7$@`$!�$�$>�$%+%:%Y%u%�%�%+�%&0617.8=23	EBU5O(*+DT
>@%9"K:/C#HPLQA)4F!JN;?$M
-I'RGS< ,
If no -e, --expression, -f, or --file option is given, then the first
non-option argument is taken as the sed script to interpret.  All
remaining arguments are names of input files; if no input files are
specified, then the standard input is read.

      --help     display this help and exit
      --version  output version information and exit
  --follow-symlinks
                 follow symlinks when processing in place
  --posix
                 disable all GNU extensions.
  -R, --regexp-perl
                 use Perl 5's regular expressions syntax in the script.
  -b, --binary
                 open files in binary mode (CR+LFs are not processed specially)
  -e script, --expression=script
                 add the script to the commands to be executed
  -f script-file, --file=script-file
                 add the contents of script-file to the commands to be executed
  -i[SUFFIX], --in-place[=SUFFIX]
                 edit files in place (makes backup if SUFFIX supplied)
  -l N, --line-length=N
                 specify the desired line-wrap length for the `l' command
  -n, --quiet, --silent
                 suppress automatic printing of pattern space
  -u, --unbuffered
                 load minimal amounts of data from the input files and flush
                 the output buffers more often
  -z, --null-data
                 separate lines by NUL characters
%s: -e expression #%lu, char %lu: %s
%s: can't read %s: %s
%s: file %s line %lu: %s
%s: warning: failed to get security context of %s: %s%s: warning: failed to set default file creation context to %s: %s: doesn't want any addressesInvalid back referenceInvalid character class nameInvalid collation characterInvalid content of \{\}Invalid preceding regular expressionInvalid range endInvalid regular expressionJay FenlasonKen PizziniMemory exhaustedNo matchNo previous regular expressionPaolo BonziniPremature end of regular expressionRegular expression too bigSuccessTom LordTrailing backslashUnmatched ( or \(Unmatched ) or \)Unmatched \{Usage: %s [OPTION]... {script-only-if-no-other-script} [input-file]...

`e' command not supported`}' doesn't want any addressescan't find label for jump to `%s'cannot remove %s: %scannot rename %s: %scannot stat %s: %scommand only uses one addresscomments don't accept any addressescouldn't attach to %s: %scouldn't edit %s: is a terminalcouldn't edit %s: not a regular filecouldn't follow symlink %s: %scouldn't open file %s: %scouldn't open temporary file %s: %sdelimiter character is not a single-byte charactererror in subprocessexpected \ after `a', `c' or `i'expected newer version of sedextra characters after commandincomplete commandinvalid reference \%d on `s' command's RHSinvalid usage of +N or ~N as first addressinvalid usage of line address 0missing commandmultiple `!'smultiple `g' options to `s' commandmultiple `p' options to `s' commandmultiple number options to `s' commandno input filesno previous regular expressionnumber option to `s' command may not be zerooption `e' not supportedread error on %s: %sstrings for `y' command are different lengthsunexpected `,'unexpected `}'unknown command: `%c'unknown option to `s'unmatched `{'unterminated `s' commandunterminated `y' commandunterminated address regexProject-Id-Version: sed 4.2.2
Report-Msgid-Bugs-To: bug-gnu-utils@gnu.org
POT-Creation-Date: 2018-03-31 18:40-0700
PO-Revision-Date: 2016-08-07 17:31+0200
Last-Translator: Francisco Javier Tsao Santín <tsao@members.fsf.org>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=n!=1;

Se non se indican as opcións -e, --expression, -f ou --file, entón o primeiro
argumento que non é unha opción tómase como o script sed para interpretar. Tódolos
argumentos restantes son nomes de ficheiros de entrada; se non se especifican
ficheiros de entrada, entón se le a entrada standard.

     --help     amosa esta axuda e sae
     --version  amosa-la información da versión e saír
  --follow-symlinks
                 segue ligazóns simbólicas cando se procesan no seu sitio
  --posix
                 desactiva tódalas extensións GNU.
  -R, --regexp-perl
                 usa-la sintaxe de expresións regulares de Perl 5 no script.
  -b, --binary
                 ficheiros abertos en modo binario (non se procesan de xeito especial CR+LFs)
-e script, --expression=script
                  engade script ás instruccións que serán executadas
  -f ficheiro-de-script, --file=ficheiro-de-script
                 engade o contido do ficheiro do script ás instruccións que serán executadas
  -i[SUFIXO], --in-place[=SUFIXO]
                 edita ficheiros no seu sitio (fai copia de seguridade se se indica un SUFIXO)
  -l N, --line-length=N
                 especifica a lonxitude de axuste da liña desexado para a instrucción `l' 
  -n, --quiet, --silent
                 suprime a visualización automática do espacio de patróns
  -u, --unbuffered 
                 carga cantidades mínimas de datos dos ficheiros de entrada
                 e baleira os buffers de saída máis decote
  -z, --null-data
                 separa liñas por caracteres NUL
%s: -e expresión #%lu, carácter %lu: %s
%s: non se puido ler %s: %s
%s: ficheiro %s liña %lu: %s
%s: advertencia: fallou ó adoita-lo contexto de seguridade de %s: %s%s: advertencia: fallou ó establecer un contexto de creación de ficheiro por defecto a %s: %s: non acepta un enderezoReferencia cara a atrás non válidaNome de clase de caracteres non válidoCarácter de ordeamento non válidoContido de \{\} non válidoExpresión regular anterior non válidaFin de rango non válidaExpresión regular non válidaJay FenlasonKen PizziniMemoria esgotadaNon se atopouNon hai unha expresión regular anteriorPaolo BonziniFin prematura da expresión regularExpresión regular grande de máisÉxitoTom LordBarra invertida á fin de liña( ou \( sen parella) ou \) sen parella\{ sen parellaUso: %s [OPCIÓN]... {script-só-sen-outro-script} [ficheiro-de-entrada]...
o comando `e' non está soportado`}' non acepta un enderezonon se puido atopa-la etiqueta para saltar a `%s'non se puido borrar %s: %snon se puido renomear %s: %snon se puido ler %s: %sa instrucción só usa un enderezoos comentarios non aceptan enderezosnon se puido adxuntar elemento en %s: %snon se puido editar %s: é unha terminalnon se puido editar %s: non é un ficheiro regularnon se puido segui-la ligazón simbólica %s: %snon se puido abri-lo ficheiro %s: %snon se puido abri-lo ficheiro temporal %s: %so carácter delimitador non é un carácter de byte simpleerro no subprocesoesperábase \ despois de `a', `c' ou `i'se esperaba unha versión de sed máis novacaracteres extra despois da instruccióninstrucción incompletareferencia \%d non válida no lado dereito do comando `s'non se pode usar +N ou ~N como primeira direcciónuso non válido da dirección de liña 0falta unha instrucciónmúltiples `!'smúltiples opcións `g' para a instrucción `s'múltiples opcións `p' para a instrucción `s'múltiples opcións numéricas para a instrucción `s'non hai ficheiros de entradanon hai unha expresión regular anteriorunha opción numérica para a instrucción `s' non pode ser ceroa opción `e' non está soportadaerro de lectura en %s: %sas cadeas para a instrucción `y' teñen lonxitudes diferentes`,' inesperada`}' inesperadoinstrucción descoñecida:`%c'opción de `s' descoñecida`{' sen parellainstrucción `s' non rematadainstrucción `y' non rematadaexpresión regular de enderezo non rematadaPK�m�\�y���\�\LC_MESSAGES/gettext-tools.monu�[������\
��4�B9I+��	�,� �&16h
����>��,,D,q'�-� �((>g�3��)�//J#z,�+�T�L'N'v���>�<98v6�<�:#.^4�?�!$,*91de�_�c\X�]Ow��'����R�97?q~�0!D!U!k!{!*�!�!&�!�!�!"#"A"^"~"�"�"�"�"<�"I#>Z#K�#>�#K$$p$)�$$�$�$X�$7T%�%�%6�%&�%$&A&!a&�&*�&;�&'"'?'Y's'�'�'�':�'$($'("L(o(�($�(�(�(�()0)G)])}).�)5�)"�)*#,*9P*G�*I�*I+?f+*�+�+$�+6,
J,5X,,�,,�,�,G�,G-b-{-�-�-�-�-�-.!.<.Q.e.y.�.�.?�.�./7/V/q/�/+�/,�/�/*0'103Y0'�0+�0�0�0	1*18C1"|1�1!�1�1�122152�g234FC4A�4*�4�4	5+
5"95(\5=�5�5
�5�5
66X6!s60�66�65�6,371`7#�7-�7-�7%8%889^8�8*�86�8-9 >9-_9+�9c�9:& :&G:$n:$�:#�:N�:N+;Hz;H�;L<LY<3�<4�<H=&X==�==�==�=n>m>��>g�?m�?v^@��@8�B
C,C9CUNCJ�CO�C�?DGG0GNGbG6oG
�G1�G�G�GH#%HIH%iH�H�H�H�H�HH�HY5IL�I]�IJ:J[�J�J-�J/,K,\Kh�KH�K1;L%mLL�LL�L0-M.^M/�M$�M>�MV!N xN&�N�N�N(�N(O GO hOT�O/�O0P/?P oP0�P/�P%�P(Q1@Q-rQ�Q"�Q/�QR9 R@ZR1�R �R9�RF(SWoS[�SY#TM}T2�T'�T"&UCIU�U=�U3�U0V?VNWV�V�V�VW!#WEWbW!sW�W�W�W�W*�W*&X(QXzXH�X)�X�X*YEYaYsY3�Y'�Y�Y1Z.2Z/aZ(�Z,�Z�Z�Z[=%[Oc[#�[�[�[
\'\/9\'i\9�\�4s$�����h�������L�t��*��&l2�a+9P>�J8�-U�<��zoN#�:M����Zg6[7T�A�{�]CeD!��B.���S��kK"���b%|Q����
�dj
w��3E^��V��u q��c�1���r;_�W��m�}HY�O0`\X?Gfn�)�,�ivR�'~y	5@(p�x���=F/�I                                (only language C++)
  -V, --version               output version information and exit
  -h, --help                  display this help and exit
  def.po                      translations
 done.
 failed.
%d translated message%d translated messages%s and %s are mutually exclusive%s and %s are mutually exclusive in %s%s and explicit file names are mutually exclusive%s is only valid with %s%s subprocess%s subprocess I/O error%s%s: warning: %s: %s: error while converting from "%s" encoding to "%s" encoding%s: invalid option -- '%c'
%s: option '%c%s' doesn't allow an argument
%s: option '%s' is ambiguous; possibilities:%s: option '--%s' doesn't allow an argument
%s: option '--%s' requires an argument
%s: option '-W %s' doesn't allow an argument
%s: option '-W %s' is ambiguous
%s: option '-W %s' requires an argument
%s: option requires an argument -- '%c'
%s: unrecognized option '%c%s'
%s: unrecognized option '--%s'
%s: warning: source file contains fuzzy translation%s:%d: iconv failure%s:%d: warning: invalid Unicode character%s:%d: warning: unterminated character constant%s:%d: warning: unterminated regular expression%s:%d: warning: unterminated string%s:%d: warning: unterminated string constant%s:%d: warning: unterminated string literal%sRead %ld old + %ld reference, merged %ld, fuzzied %ld, missing %ld, obsolete %ld.
''%s' does not use %%C but '%s' uses %%C'%s' does not use %%m but '%s' uses %%m'%s' uses %%C but '%s' doesn't'%s' uses %%m but '%s' doesn't'domain %s' directive ignored'msgid' and 'msgid_plural' entries do not both begin with '\n''msgid' and 'msgid_plural' entries do not both end with '\n''msgid' and 'msgstr' entries do not both begin with '\n''msgid' and 'msgstr' entries do not both end with '\n''msgid' and 'msgstr[%u]' entries do not both begin with '\n''msgid' and 'msgstr[%u]' entries do not both end with '\n', %d fuzzy translation, %d fuzzy translations, %d untranslated message, %d untranslated messages--join-existing cannot be used when output is written to stdout...but this definition is similar<stdin>Bruno HaibleC# compiler not found, try installing pnetC# virtual machine not found, try installing pnetCannot convert from "%s" to "%s". %s relies on iconv(), and iconv() does not support this conversion.Cannot convert from "%s" to "%s". %s relies on iconv(). This version was built without iconv().Charset "%s" is not a portable encoding name.
Message conversion to user's charset might not work.
Charset "%s" is not supported. %s relies on iconv(),
and iconv() does not support "%s".
Charset "%s" is not supported. %s relies on iconv().
This version was built without iconv().
Charset missing in header.
Message conversion to user's charset will not work.
Compare two Uniforum style .po files to check that both contain the same
set of msgid strings.  The def.po file is an existing PO file with the
translations.  The ref.pot file is the last created PO file, or a PO Template
file (generally created by xgettext).  This is useful for checking that
you have translated each and every message in your program.  Where an exact
match cannot be found, fuzzy matching is used to produce better diagnostics.
Continuing anyway, expect parse errors.Continuing anyway.Danilo SeganInformative output:
Installing GNU libiconv and then reinstalling GNU gettext
would fix this problem.
Java compiler not found, try installing gcj or set $JAVACJava virtual machine not found, try installing gij or set $JAVAMerges two Uniforum style .po files together.  The def.po file is an
existing PO file with translations which will be taken over to the newly
created file as long as they still match; comments will be preserved,
but extracted comments and file positions will be discarded.  The ref.pot
file is the last created PO file with up-to-date source references but
old translations, or a PO Template file (generally created by xgettext);
any translations or comments in the file will be discarded, however dot
comments and file positions will be preserved.  Where an exact match
cannot be found, fuzzy matching is used to produce better results.
Message selection:
Operation mode:
Operation modifiers:
Output format:
Peter MillerReport bugs to <bug-gnu-gettext@gnu.org>.
Retrieving %s...Try '%s --help' for more information.
Ulrich DrepperUnknown system errorUsage: %s [OPTION]
Usage: %s [OPTION] INPUTFILE
Usage: %s [OPTION] URL FILE
Usage: %s [OPTION] [INPUTFILE]
Valid arguments are:Written by %s and %s.
Written by %s.
_open_osfhandle failed`a format specification for argument %u doesn't exist in '%s'a format specification for argument %u, as in '%s', doesn't exist in '%s'a format specification for argument '%s' doesn't exist in '%s'a format specification for argument '%s', as in '%s', doesn't exist in '%s'a format specification for argument {%u} doesn't exist in '%s'a format specification for argument {%u}, as in '%s', doesn't exist in '%s'ambiguous argument %s for %sat least one sed script must be specifiedat least two files must be specifiedat most one input file allowedbut some messages have only one plural formbut some messages have only %lu plural formscannot create a temporary directory using template "%s"cannot create output file "%s"cannot create pipecannot find a temporary directory, try setting $TMPDIRcannot open backup file %s for writingcannot remove temporary directory %scannot remove temporary file %scannot restore fd %d: dup2 failedcreation of threads faileddomain name "%s" not suitable as file namedomain name "%s" not suitable as file name: will use prefixduplicate message definitionempty 'msgstr' entry ignoredend-of-file within stringend-of-line within stringerror after reading "%s"error after reading %serror reading "%s"error reading %serror while converting from "%s" encoding to "%s" encodingerror while opening "%s" for readingerror while opening "%s" for writingerror while opening %s for readingerror while reading "%s"error while writing "%s" fileerror while writing to %s subprocesserror writing %serror writing stdoutexactly 2 input files requiredexactly one input file requiredexpected two argumentsfailed to create "%s"failed to create directory "%s"fdopen() failedfile "%s" contains a not NUL terminated stringfile "%s" contains a not NUL terminated string, at %sfile "%s" is not in GNU .mo formatfile "%s" is truncatedfirst plural form has nonzero indexformat specifications in '%s' and '%s' are not equivalentformat specifications in '%s' and '%s' for argument %u are not the sameformat specifications in '%s' and '%s' for argument '%s' are not the sameformat specifications in '%s' and '%s' for argument {%u} are not the sameformat specifications in '%s' are not a subset of those in '%s'found %d fatal errorfound %d fatal errorsfuzzy 'msgstr' entry ignoredheader field '%s' missing in header
header field '%s' still has the initial default value
iconv failureimpossible selection criteria specified (%d < n < %d)incomplete multibyte sequence at end of fileincomplete multibyte sequence at end of lineinconsistent use of #~internationalized messages should not contain the '\%c' escape sequenceinvalid argument %s for %sinvalid control sequenceinvalid multibyte sequenceinvalid nplurals valuekeyword "%s" unknownlanguage '%s' unknownmemory exhaustedmissing 'msgid_plural' sectionmissing 'msgstr' sectionmissing 'msgstr[]' sectionmissing command namemissing filter nameno input file givenno input files givennot a valid Java class name: %snplurals = %lunumber of format specifications in '%s' and '%s' does not matchplural form has wrong indexpreserving permissions for %sread from %s subprocess failedsetting permissions for %sstandard inputstandard outputthis file may not contain domain directivesthis is the location of the first definitionthis message is untranslatedthis message is used but not defined in %sthis message is used but not defined...this message needs to be reviewed by the translatorthis message should define plural formsthis message should not define plural formstoo many argumentstoo many errors, abortingwarning: warning: charset conversion will not work
warning: file '%s' extension '%s' is unknown; will try Cwarning: invalid Unicode characterwarning: syntax errorwarning: this message is not usedwarning: unterminated stringwrite errorwrite to %s subprocess failedwrite to stdout failedxgettext cannot work without keywords to look forProject-Id-Version: gettext-tools 0.19-rc1
Report-Msgid-Bugs-To: bug-gnu-gettext@gnu.org
POT-Creation-Date: 2016-06-11 22:08+0900
PO-Revision-Date: 2014-05-20 13:35+0200
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n!=1);
                                (só linguaxe C++)
  -V, --version               Mostra a información da versión e sae
  -h, --help                  Mostra esta mensaxe de axuda e sae
  def.po                      traducións
 rematado.
 fallou.
%d mensaxe traducida%d mensaxes traducidas%s e %s son mutuamente excluíntes%s e %s son mutuamente excluíntes en %s%s e nomes de ficheiro explícitos son mutuamente excluíntes%s só é válido con %ssubproceso %sErro de E/S do subproceso %s%s%s: aviso: %s: %s: produciuse un erro ao converter desde a codificación «%s» á codificación «%s»%s: opción incorrecta -- «%c»
%s: a opción «%c%s» non permite un argumento
%s: a opción «%s» é ambigua; as posibilidades son:%s: a opción «--%s» non permite ningún argumento
%s: a opción «--%s» require un argumento
%s: a opción «-W %s» non permite un argumento
%s: a opción «-W %s» é ambigua
%s: a opción «-W %s» require un argumento
%s: a opción require un argumento -- «%c»
%s: opción «%c%s» non recoñecida
%s: opción «--%s» non recoñecida
%s: aviso: o ficheiro fonte contén traducións dubidosas%s:%d: fallo de iconv%s:%d: aviso: carácter Unicode incorrecto%s:%d: aviso: constante de tipo carácter non rematada%s:%d: aviso: expresión regular non rematada%s:%d: aviso: cadea non rematada%s:%d: aviso: constante de cadea non rematada%s:%d: aviso: literal de cadea non rematada%sLeronse %ld antigas + %ld referencias, mesturadas %ld, dubidosas %ld, faltan %ld, obsoletas %ld.
»«%s» non usa %%C pero «%s» usa %%C«%s» non usa %%m pero «%s» usa %%m«%s» usa %%C pero «%s» non o fai«%s» usa %%m pero «%s» non o faiignorouse a directiva «domain %s»as entradas «msgid» e «msgid_plural» non comezan ámbalas dúas con «\n»as entradas «msgid» e «msgid_plural» non rematan ámbalas dúas con «\n»as entradas «msgid» e «msgstr» non comezan ámbalas dúas con «\n»as entradas «msgid» e «msgstr» non rematan ámbalas dúas con «\n»as entradas «msgid» e «msgstr[%u]» non comezan ámbalas dúas con «\n»as entradas «msgid» e «msgstr[%u]» non rematan ámbalas dúas con «\n», %d tradución dubidosa, %d traducións dubidosas, %d mensaxe sen traducir, %d mensaxes sen traducirnon é posíbel usar --join-existing cando a saída se escribe en stdout...mais esta definición é semellante<stdin>Bruno HaibleNon se atopou ningún compilador de C#, probe a instalar pnetNon se atopou a máquina virtual de C#, probe a instalar pnetNon é posíbel converter desde «%s» a «%s». %s depende de iconv(), e iconv() non admite esta conversión.Non é posíbel converter desde «%s» a «%s». %s depende de iconv(). Esta versión compilouse sen iconv().O xogo de caracteres «%s» non ten un nome de codificación portábel.
A conversión da mensaxe ao xogo de caracteres do usuario podería non funcionar.
O código de caracteres «%s» non está admitido. %s depende de
iconv(), e iconv() non admite «%s».
O xogo de caracteres «%s» non está admitido. %s depende de iconv().
Esta versión compilouse sen iconv().
Falta o xogo de caracteres na cabeceira.
A conversión da mensaxe ao xogo de caracteres do usuario non vai funcionar.
Compara dous ficheiros .po de estilo Uniforum para comprobar que os dous
conteñen o mesmo conxunto de cadeas msgid. O ficheiro def.po é un ficheiro
PO existente, coas traducións antigas. O ficheiro ref.pot é o último
ficheiro PO creado, ou un ficheiro PO Template (xeralmente por xgettext).
Isto é útil para comprobar que todas as mensaxes do programa están
 traducidas. Cando non é posíbel atopar unha coincidencia exacta, úsase
coincidencia difusa, de xeito que se produza un mellor diagnóstico.
Continuando de calquera xeito, espere erros de análise.Continuando de calquera xeito.Danilo SeganSaída informativa:
Se instala GNU libiconv e logo reinstala GNU gettext
podería arranxarse o problema.
Non se atopou o compilador de Java, probe a instalar gcj ou definir $JAVACNon se atopou a máquina virtual de Java, probe a instalar gij ou definir $JAVACombina dous ficheiros .po de estilo Uniforum nun só. O ficheiro def.po é
un ficheiro PO existente coas traducións antigas, que se manterán no novo
ficheiro se coinciden; os comentarios conservaranse, mais os comentarios
e as posicións nos ficheiros hanse desbotar. O ficheiro ref.pot é o último
ficheiro PO creado con referencias de orixe actualizadas pero con traducións
antigas, ou un ficheiro PO Template (xeralmente creado por xgettext);
calquera tradución ou comentario no ficheiro hase desbotar, mentres os
comentarios de punto e as posicións nos ficheiros hanse conservar. Onde
non se atope ningunha coincidencia exacta, empregarase coincidencia difusa
para producir mellores resultados.
Selección de mensaxes:
Modo de operación:
Modificadores de operación:
Formato de saída:
Peter MillerEnvíe informes de fallo a <bug-gnu-gettext@gnu.org>.
Obtendo %s...Use «%s --help» para obter máis información.
Ulrich DrepperErro de sistema descoñecidoUso: %s [OPCIÓN]
Uso: %s [OPCIÓN] FICHEIRO_ENTRADA
Uso: %s [OPCIÓN] URL FICHEIRO
Uso: %s [OPCIÓN] [FICHEIRO_ENTRADA]
Os argumentos válidos son:Escrito por %s e %s.
Escrito por %s.
_open_osfhandle fallou«unha especificación de formato para o argumento %u non existe en «%s»unha especificación de formato para o argumento %u, como en «%s», non existe en «%s»unha especificación de formato para o argumento «%s» non existe en «%s»unha especificación de formato para o argumento «%s», como en «%s», non existe en «%s»unha especificación de formato para o argumento {%u} non existe en «%s»unha especificación de formato para o argumento {%u}, como en «%s», non existe en «%s»argumento %s ambiguo para %stense que indicar polo menos un script de sedtéñense que indicar polo menos dous ficheirospermítese un ficheiro de entrada como moitopero algunhas mensaxes só teñen unha forma pluralpero algunhas mensaxes só teñen %lu formas pluraisnon é posíbel crear un directorio temporal empregando o patrón «%s»non é posíbel crear o ficheiro de saída «%s»non é posíbel crear a canalizaciónnon foi posíbel atopar ningún directorio temporal, probe a definir $TMPDIRnon é posíbel abrir o ficheiro de copia de seguridade «%s» para escribirnon é posíbel retirar o directorio temporal %snon é posíbel retirar o ficheiro temporal %snon foi posíbel restaurar o fd %d: dup2 fallouproduciuse un erro ao crear os fíoso nome de dominio «%s» non é axeitado para nome de ficheiroo nome de dominio «%s» non é axeitado como nome de ficheiro:
empregarase un prefixodefinición de mensaxe duplicadaignorouse a entrada «msgstr» baleirafin de ficheiro nunha cadeafin de liña nunha cadeaproduciuse un erro despois de ler «%s»produciuse un erro despois de ler «%s»produciuse un erro ao ler «%s»produciuse un erro ao ler «%s»produciuse un erro ao converter desde a codificación «%s» á codificación «%s»produciuse un erro ao abrir «%s» para lecturaproduciuse un erro ao abrir «%s» para escribirproduciuse un erro ao abrir «%s» para lecturaproduciuse un erro ao ler «%s»produciuse un erro ao escribir o ficheiro «%s»produciuse un erro ao escribir ao subproceso %sproduciuse un erro ao escribir «%s»produciuse un erro ao escribir en stdoutrequírense exactamente dous ficheiros de entradarequírese exactamente un ficheiro de entradaagardábanse dous argumentosproduciuse un erro ao crear «%s»produciuse un erro ao crear o directorio «%s»fdopen() fallouo ficheiro «%s» contén unha cadea non terminada en NULo ficheiro «%s» contén unha cadea non terminada en NUL, en %so ficheiro «%s» non está no formato .mo de GNUo ficheiro «%s» está truncadoa primeira forma do plural ten un índice distinto a ceroas especificacións de formato en «%s» e «%s» non son equivalentesas especificacións de formato en «%s» e «%s» para o argumento %u non son as mesmasas especificacións de formato en «%s» e «%s» para o argumento «%s» non son as mesmasas especificacións de formato en «%s» e «%s» para o argumento {%u} non son as mesmasas especificacións de formato en «%s» non son un subconxunto das de «%s»atopouse %d erro graveatopáronse %d erros gravesignorouse a entrada «msgstr» dubidosafalta o campo «%s» na cabeceira
o campo «%s» da cabeceira aínda ten o valor inicial predefinido
fallo de iconvo criterio de selección indicado é imposíbel (%d < n < %d)secuencia multibyte incompleta ao final do ficheirosecuencia multibyte incompleta ao final da liñauso inconsistente de #~as mensaxes internacionalizadas non deben conter a secuencia de escape «\%c»argumento incorrecto %s para %ssecuencia de control incorrectasecuencia multibyte non válidavalor de nplurals incorrectopalabra clave «%s» descoñecidalinguaxe «%s» descoñecidamemoria esgotadafalta a sección «msgid_plural»falta a sección «msgstr»falta a sección «msgstr[]»falta o nome da ordefalta o nome do filtronon se indicou ningún ficheiro de entradanon se indicou ningún ficheiro de entradanon é un nome de clase Java válido: %snplurals = %luo número de especificacións de formato en «%s» e «%s» non coincidea forma do plural ten un índice erróneoconservando os permisos de %sproduciuse un erro ao ler do subproceso %sdefinindo os permisos de %sentrada estándarsaída estándareste ficheiro non pode conter directivas de dominioeste é o lugar da primeira definiciónesta mensaxe está sen traduciresta mensaxe úsase mais non está definida en %sesta mensaxe úsase mais non está definida...esta mensaxe ten que ser revisada polo tradutoresta mensaxe debe definir formas pluraisesta mensaxe non debe definir formas pluraisdemasiados argumentosdemasiados erros, interrompendoaviso: aviso: a conversión de xogo de caracteres non vai funcionar
aviso: o ficheiro «%s» coa extensión «%s» é descoñecido; tentarase con Caviso: carácter Unicode incorrectoaviso: erro de sintaxeaviso: esta mensaxe non se usaaviso: cadea non rematadaerro de escrituraproduciuse un erro ao escribir ao subproceso %sproduciuse un erro ao escribir a stdoutxgettext non funciona sen palabras clave polas que buscarPK�m�\[Ѧ��LC_MESSAGES/nano.monu�[������Wh%i%}%�%�%�%
�%�%:&J&Da&	�&�&�&
�&
�&	�&�&''2'(L'u'{'�'�'�'�'�'�'�'�'(

(((
'(	2(4<(q(t(�x(v)})#�) �)�)�)�)*(*G*	L*V*b*	o*y*�*
�*�*-�*��+�-�-�-�-�-�-		.."3.V.u.	�.�.�.�.)�./
/.+/ Z/{/"�/�/	�/�/$�/ 0!/0-Q0@0+�00�0-1K1S1	\1f1&o1*�1�13�1
2
2*2
/2:2.A2%p2&�2�2�2(�2#3"23U3$l3�3'�3'�3�3434Q4d4}4�4�4�4�4
�4�4 �4515H5\5u5�5�5�50�566 26S6r6�6/�6�7�7�7A89I8�8�8:�8��8�:�:�:8�:;';B;
V;
a;&l;(�;�;	�;�;
�;)�;<	<#<
3<><
D=O=e=v=�=7�=�=�=>8%>^>n>�>�>�>�>�>�>
?*?>?X? o? �?�?�?�?@#,@%P@v@�@	�@�@%�@G�@�)A��A�B�B��B'iD#�D"�D�D�DE&5E\E|E#�E�E�E�E#�EF;FRF)hF	�F	�F�F&�F(�F
G�
G�H	�H
�H+�HII0I'?IgI{I
�I*�I>�I
�IJJ
J	 J	*J
4J	BJ	LJVJ
cJnJqJ
tJ!J�J�J(�J�J,K2KLK
jKxK�K!�K �Kt�KZLwL
�L�L�L$�L
�L	�L	�L
M	M	M
)M4M"=M	`M(jM�M!�M%�M)�MN.N@NENdN#lN�N3�N�N�N�N(O)O@O#MO"qO�O#�O�O�O%�OP P@P$\P>�P�P	�P%�P�P�Q�R�R�R�R�R'S*S#BSfS�S�S�S(�S�S��S�U�U�U-�U
VV1V"PVsV!�V%�V�V�V1�V/WJWhWq�W�X,Y9Y>UY
�Y�Y	�Y�Y�Y&�Y�Y)Z/ZLZiZ%�Z�Z%�Z.�Zh[�[�[�[�[�[
�[.�[\"\'\?\S\
e\	s\}\�\�\�\�\&�\ ]:]X]a]p]u]�]�]%�]�]
�]��]	�_�_�_�_�_�_�_�_�_
`	``2`J`a`j`s``�`
�`�`	�`�`��`�b"�b�bc%cCc VcAwc�cU�c&d2d'Adidxd	�d�d"�d�d�d*e+e1e8e	@eJe\eke�e�e�e�e
�e�e�e
�e	�e;�e,f1f6fFg+Wg%�g$�g�g�g�g h(&hOh	Vh`h&qh�h�h&�h�h�hT	i�^j
l&l&Al hl�l�l	�l-�l3�l-m#Gm
kmvm}m�m5�m�m
n=nRn+pn-�n+�n�no.!o"Po/soC�oW�o6?p/vp>�p�p
�p
�p
qCqDSq�q/�q�q�qrrr'r"Gr1jr�r%�r?�rs0sMs%hs*�s/�s-�s%t=t#\t�t*�t�t�t�tu$u(u4u(;u(du�u�u�u�u�u'�u&v=8vvv�v6�v*�v%w'we8w�x�x�x[�xD9y,~y�yG�y
z"|&A|h|Az|
�|"�|�|}
}2}6L}�}�}�}
�}(�}
�}�}�}~~	#-ASh>{��"�=�D�X�w�����!̀�'�.�N�'d���#��#Ɂ%�%�"9�#\�#��3��؂��
��6#�YZ����
��������.{�-��%؇'��+&�*R�+}�*��2Ԉ3�
;�F�e�)��$��!ω"�1�F�	R�\�%m�6��ʊ�֊������.ь��*�6>�u�
��
��1��C؍�
(�6�
?�J�	\�
f�t�	����
������	��(�����7�K�5j���#������('�$P��u� ���
;�I�/[�(��
����	ё
ۑ�	��
��
�,�@�*I�t� ��0��0ג�%�>�%F�l�u���H�����
�+#�O�^�2n�5��ה���,�4K�(��!��,˕I��B�S�0d������>�Y�)f�*����0ǘ#��0�"M�p�����4�����#ț)�	�4 �U�a�x�����'��-�	�!�6:�(q� �����֝��5��ןB�6�E�
Q�\�h�6����<נ�3�R�(r�.��-ʡ7��m0�����ʢ����3�R�l�u�����
£֣ͣ� �"(�&K�1r�!��#Ƥ���
�!�0�8�+E�q������z���������
ɧԧ����

��2�!J�
l�z���
��������ܨ��0��<�3���Y�����
_
�������;*ng��a�x�� �#��������i�%9���^	'y��K���c���a��Iez�pt�����CA.9mh�&B��)P�6@$1��l�V�D����	�rE��.&"0TR8+�>��H�J��Q�l�f�SFuH����_�}7�r��|�
�g���q����
s��?G6���~�sj!p`o#�t�I���bd$C��Z5h-f�V-b3��o��OM�G�v��{44K��},�WX�ES>x���[��L�'Y�n�[�:j+]|���@�2�c���=��Q5uv�q�wN�7RUzL�TJ��\�^(=������O���<��i1N��"Z��/]B��?�k�/):k\���A8���m�2�e�*(��FMU;D`���%�!�~�Xwd{�WP��,������y �
 Compiled options:
Buffer not written to %s: %s

Buffer not written: %s

Buffer written to %s

Press Enter to continue
 (to replace) (to replace) in selection Email: nano@nano-editor.org	Web: https://nano-editor.org/ GNU nano, version %s
 The following function keys are available in Browser Search mode:

 [Backup] [Backwards] [Case Sensitive] [DOS Format] [Mac Format] [Regexp]"%.*s%s" not found"%s" is a device file"%s" is a directory"%s" is not a normal file"start=" requires a corresponding "end="(dir)(huge)(more)(parent dir)--backupdir=<dir>--fill=<#cols>--operatingdir=<dir>--speller=<prog>--tabsize=<#cols>--wordchars=<str>-C <dir>-T <#cols>-X <str>-o <dir>-r <#cols>-s <prog>A '%s' command requires a preceding 'syntax' commandAaAllAlso, pressing Esc twice and then typing a three-digit decimal number from 000 to 255 will enter the character with the corresponding value.  The following keystrokes are available in the main editor window.  Alternative keys are shown in parentheses:

AppendAppend Selection to FileArgument '%s' has an unterminated "Argument of '%s' lacks closing "At first messageAt last messageAuto indentAuto save on exit, don't promptAutomatically indent new linesBackBackspaceBackup FileBackup filesBackwardsBad quote string %s: %sBad regex "%s": %sBeg of ParBrought to you by:Browser Go To Directory Help Text

 Enter the name of the directory you would like to browse to.

 If tab completion has not been disabled, you can use the Tab key to (attempt to) automatically complete the directory name.

 The following function keys are available in Browser Go To Directory mode:

Browser Search Command Help Text

 Enter the words or characters you would like to search for, and then press Enter.  If there is a match for the text you entered, the screen will be updated to the location of the nearest match for the search string.

 The previous search string will be shown in brackets after the search prompt.  Hitting Enter without entering any text will perform the previous search.

Can now UnJustify!Can't go outside of %sCan't move up a directoryCan't write outside of %sCancelCancel the current functionCancelledCannot comment past end of fileCannot map name "%s" to a functionCannot map name "%s" to a menuCannot unset option "%s"Case SensCloseClose buffer without saving itColor syntax highlightingCommand "%s" not allowed in included fileCommand "%s" not understoodComment LinesCommenting is not supported for this file typeConstant cursor position displayConstantly show cursor positionConversion of typed tabs to spacesConvert typed tabs to spacesCopy TextCould not create pipeCould not find syntax "%s" to extendCould not forkCould not get size of pipe bufferCouldn't determine hostname for lock file: %sCouldn't determine my identity for lock file (getpwuid() failed)Couldn't reopen stdin from keyboard, sorry
Count the number of words, lines, and charactersCreating misspelled word list, please wait...Cur PosCut LeftCut RightCut TextCut backward from cursor to word startCut forward from cursor to next word startCut from cursor to end of lineCut from the cursor position to the end of the fileCut to endCutTillEndDIR:DOS FormatDeleteDelete the character to the left of the cursorDelete the character under the cursorDetect word boundaries more accuratelyDirectory '%s' does not existDirectory '%s' is not writableDirectory for saving unique backup filesDiscard bufferDisplay the position of the cursorDisplay this help textDo not read the file (only write it)Do quick statusbar blankingDon't add newlines to the ends of filesDon't convert files from DOS/Mac formatDon't hard-wrap long linesDon't look at nanorc filesDon't show the two help linesEdit a replacementEnable alternate spellerEnable smart home keyEnable soft line wrappingEnable suspensionEnable the use of the mouseEndEnd of ParEnterEnter line number, column numberError deleting lock file %s: %sError expanding %s: %sError invoking "%s"Error invoking "sort -f"Error invoking "spell"Error invoking "uniq"Error opening lock file %s: %sError reading %s: %sError reading lock file %s: Not enough data readError writing %s: %sError writing %s: %s
Error writing backup file %s: %sError writing lock file %s: %sError writing temp file: %sExecute CommandExecute Command Help Text

 This mode allows you to insert the output of a command run by the shell into the current buffer (or a new buffer in multiple file buffer mode).  If you need another blank buffer, do not enter any command.

 The following function keys are available in Execute Command mode:

Execute external commandExitExit from the file browserFailed to write backup file; continue saving? (Say N if unsure.) Fatal error: no keys mapped for function "%s".  Exiting.
File "%s" exists; OVERWRITE? File "%s" not foundFile %s is being edited (by %s with %s, PID %s); continue?File Browser Help Text

 The file browser is used to visually browse the directory structure to select a file for reading or writing.  You may use the arrow keys or Page Up/Down to browse through the files, and S or Enter to choose the selected file or enter the selected directory.  To move up one level, select the directory called ".." at the top of the file list.

 The following function keys are available in the file browser:

File Name to Append toFile Name to Prepend toFile Name to WriteFile was modified since you opened it; continue saving? FinishedFinished checking spellingFinished formattingFirst FileFirst LineFix Backspace/Delete confusion problemFix numeric keypad key confusion problemFor ncurses:FormatterForwardFullJstifyFunction '%s' does not exist in menu '%s'Get HelpGo To DirGo To DirectoryGo To LineGo To Line Help Text

 Enter the line number that you wish to go to and hit Enter.  If there are fewer lines of text than the number you entered, you will be brought to the last line of the file.

 The following function keys are available in Go To Line mode:

Go To TextGo back one characterGo back one wordGo forward one characterGo forward one wordGo just beyond end of paragraph; then of next paragraphGo one screenful downGo one screenful upGo to beginning of current lineGo to beginning of paragraph; then of previous paragraphGo to directoryGo to end of current lineGo to file browserGo to lefthand columnGo to line and column numberGo to next block of textGo to next lineGo to next linter msgGo to previous block of textGo to previous lineGo to previous linter msgGo to righthand columnGo to the first file in the listGo to the first line of the fileGo to the last file in the listGo to the last line of the fileGo to the matching bracketGo to the next file in the listGo to the previous file in the listGot 0 parsable lines from command: %sHard wrapping of overlong linesHelp is not availableHelp modeHomeI can't find my home directory!  Wah!If needed, use nano with the -I option to adjust your nanorc settings.
If you have selected text with the mark and then search to replace, only matches in the selected text will be replaced.

 The following function keys are available in Search mode:

If you need another blank buffer, do not enter any filename, or type in a nonexistent filename at the prompt and press Enter.

 The following function keys are available in Insert File mode:

In Selection:  Indent TextInsert File Help Text

 Type in the name of a file to be inserted into the current file buffer at the current cursor location.

 If you have compiled nano with multiple file buffer support, and enable multiple file buffers with the -F or --multibuffer command line flags, the Meta-F toggle, or a nanorc file, inserting a file will cause it to be loaded into a separate buffer (use Meta-< and > to switch between file buffers).  Insert a newline at the cursor positionInsert a tab at the cursor positionInsert the next keystroke verbatimInvalid line or column numberInvoke formatter, if availableInvoke the linter, if availableInvoke the spell checker, if availableInvoking formatter, please waitInvoking linter, please waitInvoking spell checker, please waitJustifyJustify the current paragraphJustify the entire fileKey invalid in non-multibuffer modeKey is invalid in view modeKey name %s is invalidKey name is too shortKey name must begin with "^", "M", or "F"Last FileLast LineLeft ColumnLog & read location of cursor positionLog & read search/replace string historyMac FormatMain nano help text

 The nano editor is designed to emulate the functionality and ease-of-use of the UW Pico text editor.  There are four main sections of the editor.  The top line shows the program version, the current filename being edited, and whether or not the file has been modified.  Next is the main editor window showing the file being edited.  The status line is the third line from the bottom and shows important messages.  Mark SetMark TextMark UnsetMark text starting from the cursor positionMissing color nameMissing key nameMissing optionMissing regex string after '%s' commandMissing syntax nameModifiedMouse supportMust specify a function to bind the key toMust specify a menu (or "all") in which to bind/unbind the keyNew BufferNew FileNextNext BlockNext FileNext LineNext Lint MsgNext PageNext WordNext word...NextHstoryNnNoNo ReplaceNo conversion from DOS/Mac formatNo current search patternNo file nameNo linter defined for this type of file!No matching bracketNo more errors in unopened files, cancellingNo more open file buffersNon-blank characters requiredNot a bracketNothing in undo buffer!Nothing to re-do!Option		GNU long option		Meaning
Option "%s" requires an argumentPath %s is not a directory and needs to be.
Nano will be unable to load or save search history or cursor positions.
Path '%s' is not a directoryPath '%s' is not accessiblePath '%s': %sPrependPrepend Selection to FilePreserve XON (^Q) and XOFF (^S) keysPrev BlockPrev FilePrev LinePrev Lint MsgPrev PagePrev WordPrevHstoryPreviousPrint version information and exitRead FileRead a file into a new buffer by defaultReading FileReading file into separate bufferRecall the next search/replace stringRecall the previous search/replace stringReceived SIGHUP or SIGTERM
Redid action (%s)RedoRedo the last undone operationRefreshRefresh (redraw) the current screenRefresh the file listRegex strings must begin and end with a " characterRegexpRepeat the last searchReplaceReplace a string or a regular expressionReplace this instance?Replace withRequested fill size "%s" is invalidRequested tab size "%s" is invalidRestricted modeReverse the direction of the searchRight ColumnSaveSave a file by default in Unix formatSave backups of existing filesSave file under DIFFERENT NAME? Save file without promptingSave modified buffer before linting?Save modified buffer?  (Answering "No" will DISCARD changes.) Scroll DownScroll UpScroll by line instead of half-screenSearchSearch Command Help Text

 Enter the words or characters you would like to search for, and then press Enter.  If there is a match for the text you entered, the screen will be updated to the location of the nearest match for the search string.

 The previous search string will be shown in brackets after the search prompt.  Hitting Enter without entering any text will perform the previous search.  Search WrappedSearch for a stringSearch next occurrence backwardSearch next occurrence forwardSearching...Set hard-wrapping point at column #colsSet operating directorySet width of a tab to #cols columnsShow this help text and exitSmart home keySmooth scrollingSoft wrapping of overlong linesSorry, keystroke "%s" may not be reboundSpecial thanks to:Spell Check Help Text

 The spell checker checks the spelling of all text in the current file.  When an unknown word is encountered, it is highlighted and a replacement can be edited.  It will then prompt to replace every instance of the given misspelled word in the current file, or, if you have selected text with the mark, in the selected text.

 The following function keys are available in Spell Check mode:

Spell checking failed: %sSpell checking failed: %s: %sSuspendSuspend the editor (if suspension is enabled)SuspensionSuspension is not enabledSwitch to the next file bufferSwitch to the previous file bufferSwitched to %sSyntax "%s" has no color commandsSyntax definition to use for coloringTabThank you for using nano!The "default" syntax does not accept '%s' regexesThe "default" syntax does not accept extensionsThe "none" syntax is reservedThe Free Software FoundationThe bottom two lines show the most commonly used shortcuts in the editor.

 Shortcuts are written as follows: Control-key sequences are notated with a '^' and can be entered either by using the Ctrl key or pressing the Esc key twice.  Meta-key sequences are notated with 'M-' and can be entered using either the Alt, Cmd, or Esc key, depending on your keyboard setup.  The nano text editorThis function is disabled in restricted modeThis is the only occurrenceThis message is for unopened file %s, open it in a new buffer?To BracketTo FilesTo LinterTo SpellToggle appendingToggle backing up of the original fileToggle prependingToggle the case sensitivity of the searchToggle the use of DOS formatToggle the use of Mac formatToggle the use of a new bufferToggle the use of regular expressionsToo many backup files?Two single-column characters requiredType '%s -h' for a list of available options.
Unable to create directory %s: %s
It is required for saving/loading search history or cursor positions.
Unbindable key: M-[Unbound keyUnbound key: %cUnbound key: M-%cUnbound key: ^%cUncut TextUncut from the cutbuffer into the current lineUndid action (%s)UndoUndo the last operationUnfindable word: %sUnicode Input: %sUnindent TextUnjustifyUnknown option "%s"Unknown sequenceUnknown syntax name: %sUse "fg" to return to nano.
Use (vim-style) lock filesUse bold instead of reverse video textUse of one more line for editingUse one more line for editingVerbatimVerbatim InputViewView mode (read-only)Where IsWhereIs NextWhich other characters are word partsWhitespace displayWord CountWrite File Help Text

 Type the name that you wish to save the current file as and press Enter to save the file.

 If you have selected text with the mark, you will be prompted to save only the selected portion to a separate file.  To reduce the chance of overwriting the current file with just a portion of it, the current filename is not the default in this mode.

 The following function keys are available in Write File mode:

Write OutWrite Selection to FileYesYyand anyone else we forgot...commentdisabledenable/disableenabledline breakline joinmagic_file(%s) failed: %smagic_load() failed: %snano is out of memory!text addtext cuttext deletetext inserttext replacetext uncutthe many translators and the TPuncommentversionProject-Id-Version: nano 2.7.0
Report-Msgid-Bugs-To: nano-devel@gnu.org
POT-Creation-Date: 2018-06-02 10:23+0200
PO-Revision-Date: 2016-09-14 23:15+0200
Last-Translator: Francisco Javier Tsao Santín <tsao@members.fsf.org>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=n!=1;

Opcións de compilación
Non se gravou o buffer en %s: %s

Non se gravou o buffer: %s

Gravouse o buffer en %s

Prema Enter para continuar.
(para substituír)(para substituír) na selección Correo-e: nano@nano-editor.org	Web: https://www.nano-editor.org/GNU nano, versión %s
 As seguintes teclas de función están dispoñibles no modo de Busca do Navegador:

 [CopiaSeg] [Cara Atrás] [Sensible ás Maiúsculas/Minúsculas] [Formato DOS] [Formato Mac] [Expreg]non se atopou "%.*s%s""%s" é un ficheiro de dispositivo"%s" é un directorio"%s" non é un ficheiro normal"start=" precisa dun "end=" correspondente(dir)enorme(máis)(dir pai)--backupdir=<dir>--fill=<#cols>--operatingdir=<dir>--speller=<prog>--tabsize=<#cols>--wordchars=<cad>-C <dir>-T <#cols>-X <cad>-o <dir>-r <#cols>-s <prog>A instrución '%s' require ir precedida do comando 'syntax'TtAaTodoAdemáis, premendo Esc dúas veces e escribindo un decimal de tres díxitos dende 000 a 255 introducirá o carácter co correspondente valor. As seguintes entradas están dispoñibles na fiestra do editor principal. As teclas alternativas son amosadas entre parénteses

Engadir ó FinalEngadir a Selección ó Ficheiro polo FinalO argumento '%s' ten un " sen rematarO argumento '%s' ten un " sen pecharNo comenzo da mensaxeNo final da mensaxeAutosangríaGravar ó saíren, sen preguntarSangra-las novas liñas automáticamenteAtrásRetrocesoCopia SeguridadeFacer copia de seguridade de ficheirosCara atrásCadea de cita %s incorrecta: %sExpresión regular "%s" incorrecta: %sPrin ParágPor cortesía de:Texto de Axuda de Ir ó Directorio do Navegador

 Introduza o nome do directorio ó que quere pasar.

 Se o completado co tabulador non está desactivado, pode emprega-la tecla Tab para (tratar de) completar automáticamente o nome do directorio.

As seguintes teclas de función están dispoñibles no modo Ir Ó Directorio do Navegador:

Texto de Axuda do Comando Busca do Navegador

 Introduza as palabras ou caracteres que quere buscar, e prema Intro. Se hai correspondencia para o texto que introduciu, a pantalla actualizarase na posición da aparición máis cercana de correspondencia da cadea de busca.

 Amosarase a cadea de busca anterior entre corchetes despois do indicativo Busca:. Ó premer Intro sen introducir ningún texto farase a busca anterior.

¡Agora pode De-Xustificar!Non se pode ir fóra de %sNon se pode ascender por un directorioNon se pode escribir fóra de %sCancelarCancela-la función actualCanceladoNon se pode comentar alen do final do arquivoNon se puido sinalar o nome "%s" para unha funciónNon se puido sinalar o nome "%s" para un menuNon se pode desactivar opción "%s"SensMa/minPecharPechar buffer sen gravarSalientar sintaxe con corA directiva "%s" non se permite no ficheiro incluídoNon se entende a directiva "%s"Coment LiñasOs comentarios non están soportados por este tipo de arquivoPosición do cursor constanteAmosa-la posición do cursor constantementeConversión de lingüetas escritas a espaciosConvertir as lingüetas escritas a espaciosCopiar TextoNon se puido crear unha canleNon se puido atopar sintaxe "%s" para extenderNon se puido iniciar outro procesoNon se puido obte-lo tamaño do buffer da canleNon se puido determina-lo nome do host para bloquea-lo ficheiro: %sNon se puido determina-la miña identidade para bloquea-lo ficheiro (fallou getpwuid())Non se puido reabri-la stdin dende o teclado, síntoo
Conta-lo número de verbas, liñas e caracteresCreando a lista de palabras mal escritas, por favor, espere...PosicActCortarEsqrCortarDertCortarTextCortar cara atrás dende o cursor ata o comenzo da seguinte palabraCortar cara adiante dende o cursor ata o comenzo da seguinte palabraCut from cursor to end of lineCortar da posición do cursor ó final da liñaCortar ata o finalCortarAtaFinDIR:Formato DOSBorrarBorra-lo caracter á esquerda do cursorBorra-lo carácter baixo do cursorDetectar contornos das verbas máis axeitadamenteNon existe o directorio '%s'Non se pode gravar no directorio '%s'Directorio para gravar ficheiros de copia de seguridade únicosDescartar bufferAmosa-la posición do cursorAmosar este texto de axudaNon ler o ficheiro (só escribir nel)Facer baleirado rápido da barra de estadoNon engadir novas liñas ó final dos ficheirosNon converti-los ficheiros do formato DOS/MacNon facer cortado forte liñas longasNon mirar nos ficheiros nanorcNon amosa-las dúas liñas de axudaEditar unha substituciónUsar un corrector ortográfico alternativoActivar tecla 'smart home'Activar axuste suave de liñasPermitir suspensiónEmprega-lo ratoFinFin ParágrEntrarIntroduza liña número, columna númeroErro borrando ficheiro de bloqueo %s: %sErro expandindo %s: %sErro ó chamar "%s"Erro ó chamar "sort -f"Erro ó chamar "spell"Erro ó chamar "uniq"Erro abrindo ficheiro de bloqueo %s: %sErro lendo %s: %sErro lendo ficheiro de bloqueo %s: Non abondan datos para lerErro writing %s: %sErro writing %s: %s
Erro escribindo ficheiro de copia de seguridade %s: %sErro escribindo ficheiro de bloqueo %s: %sErro escribindo ficheiro temporal: %sExecutar ComandoTexto de Axuda de Execución de Comandos Externos

 Este modo permítelle inseri-la saída dun comando executado polo intérprete de comandos no buffer actual (ou noutro buffer no modo multibuffer). Se vostede necesita outro buffer baleiro, non introduza ningún comando.

 As seguintes teclas de función están dispoñibles no modo de Comandos Externos:

Executar comando externoSaírSaír do navegador de ficheirosFaio ó escribir ficheiro de respaldo, ¿continuar gravando? (Prema N se non está seguro) Erro fatal: non hai teclas sinaladas para a función "%s". Saíndo.
O ficheiro "%s" xa existe, ¿SOBREESCRIBIR? Non se atopou o arquivo "%s"O ficheiro %s está sendo editado (por %s con %s, PID %s); ¿continuar?Texto de Axuda do Navegador de Ficheiros

 O navegador de ficheiros emprégase para amosar visualmente a estructura de directorios para escoller un ficheiro que ler ou escribir. Pode usa-las teclas das frechas ou AvPáx/RePáx para navegar polos ficheiros, e S ou Intro para escolle-lo ficheiro seleccionado ou entrar no directorio seleccionado. Para subir un nivel, escolla o directorio chamado ".." na parte de enriba da lista de ficheiros.

 As seguintes teclas de función están dispoñibles no navegador de ficheiros:

Ficheiro ó que Engadir polo finalFicheiro ó que Engadir polo PrincipioFicheiro a GravarO ficheiro foi modificado dende que o abriu, ¿continua gravando?FinalizadoRematou a corrección ortográficaFinalizou o formateadoPri FicheiroPrim liñaArranxa-lo problema de confusión Retroceso/BorrarSolucionar problema de confusión de teclado numéricoPor ncurses:FormateadorAdianteXustCompltA función '%s' non existe no menú '%s'Obter AxudIr ó DirectorioIr ó DirectorioIr á liñaTexto de Axuda de Ir á Liña

 Introduza o número da liña á que quere ir e prema Intro. Se hai menos liñas de texto que o número introducido, váiselle levar á derradeira liña do ficheiro.

 As seguintes teclas de función están dispoñibles no modo Ir Á Liña:

Ir a TextRecuar un carácterRecuar unha verbaAvanzar un carácterAvanzar unha verbaPasar xusto alén do parágrafo, entón ó seguinte parágrafoBaixar unha pantallaSubir unha pantallaPasar ó principio da liña actualPasar ó principio do parágrafo, entón ó parágrafo previoPasar ó directorioPasar ó final da liña actualIr ó navegador de ficheirosIr á columna á esquerdaIr á liña e columna númeroPasar ó seguinte bloque de textoPasar á seguinte liñaPasar á anterior mensaxe do analizadorPasar ó bloque de texto previoPasar á liña previaPasar á anterior mensaxe do analizadorIr á columna á dereitaPasar ó primeiro ficheiro da listaPasar á primeira liña do ficheiroPasar ó derradeiro ficheiro da listaPasar á derradeira liña do ficheiroPasar ó paréntese correspondentePasar ó seguinte ficheiro da listaPasar ó anterior ficheiro da listaAtopáronse 0 liñas analizables pola directiva: %sAcortado forte de liñas longasAxuda non dispoñibleModo de axudaInicio¡Non podo atopa-lo meu directorio de inicio! ¡Aaagh!Se o precisa, use nano coa opción -I se precisa axeita-la súa configuración no nanorc
Se vostede seleccionou texto con marca e fixo busca con substitución, só se substituirán correspondencias no texto seleccionado.

 As seguintes teclas de función están dispoñibles en modo Busca:

Se vostede precisa doutro buffer baleiro, non introduza un nome de ficheiro, ou escriba un nome de ficheiro inexistente na entrada do nome de ficheiro a inserir e prema Intro.

 As seguintes teclas de función están dispoñibles no modo de Inserción de Ficheiro:

In Selección:  SangrarTexto de Axuda de Inserción de Ficheiro

 Introduza o nome dun ficheiro a inserir no buffer de ficheiro actual na posición actual do cursor.

 Se compilou nano con soporte de múltiples buffers de ficheiro, e activa os buffers múltiples cos modificadores de liña de comando -F ou --multibuffer, co selector Meta-F ou cun ficheiro nanorc, a inserción dun ficheiro fará que se cargue nun buffer separado (empregue Meta-< e > para cambiar entre buffers de ficheiro).  Inserir unha nova liña na posición do cursorInserir unha lingüeta na posición do cursorInseri-la seguinte pulsación literalNúmero de liña ou columna non válidaChamar ó corrector ortográfico, se hai unChamar ó analizador de sintaxe, se hai unChamar ó corrector ortográfico, se hai unChamando ó formateador, por favor, agardeInvocando analizador de sintaxe, por favor, espereChamar ó corrector ortográfico, agarde, por favorXustificarXustifica-lo parágrafo actualXustificar todo o ficheiroTecla non válida no modo sen multibufferA tecla non é válida en modo vistaO nome de tecla %s non é válidoO nome da tecla é demasiado curtoO nome de tecla debe comenzar con "^","M", ou "F"Derrad FichUlt liñaColumna EsquerdaRexistrar e ler a posición do cursorGravar e le-la historia de cadeas a buscar/substituírFormato MacAxuda principal de nano

 O editor nano está deseñado para emula-la funcionalidade e facilidade de uso do editor de texto UW Pico. Hai catro seccións principais no editor: a liña superior amosa a versión do programa, o nome do ficheiro que se está a editar, e se o ficheiro foi modificado ou non. A seguinte é a fiestra principal do editor, que amosa o ficheiro que se edita. A liña de estado é a terceira liña dende o fondo e amosa mensaxes importantes.  Marca activadaMarcarMarca desactivadaMarcar texto comenzando na posición do cursorFalla o nome da corFalla o nome de teclaOpción non atopadaFalla a expresión regular despois da instrución '%s'Falla o nome da sintaxeModificadopermitir ratoDebe especifica-la función para asociar á teclaDebe especificar un menú (ou "all") no que asociar/liberar a teclaNovo bufferFicheiro NovoSeguinteBloque SegFicheiro SeguinteSeg LiñaMsg seg anlzrPáxina segVerba SegVerba Seguinte...HistSeguinNnNonNon SubstNon facer conversión de formato DOS/MacNon hai patrón de buscaNon hai nome de ficheiroNon hai definido analizador para este tipo de ficheirosNon hai parella do delimitadorNon hai máis erros en ficheiros pechados, cancelandoNon hai máis ficheiros abertosSe requiren caracteres non baleirosNon hai delimitadorBuffer para desfacer baleiroNada para refacerOpción		Opción longa GNU		Significado
A opción "%s" precisa dun argumentoA ruta %s non é un directorio e o necesita ser.
Nano será incapaz de cargar ou gravar o historial de busca ou posición do cursor
A ruta '%s' non é un directorioNon se pode chegar á ruta '%s'Ruta '%s': %sEngadir ó InicioEngadir a Selección ó Ficheiro polo PrincipioConserva-las teclas XON (^Q) e XOFF (^S)Bloque AntFicheiro AnteriorLiña AntMsg ant anlzrPáxina antVerba AntHistPreviaAnteriorAmosar información sobre a versión e saírLer FichLe-lo ficheiro nun novo buffer por defectoLendo o FicheiroLendo arquivo en buffer separadoRecupera-la seguinte cadea de busca/sustituciónRecupera-la anterior cadea de busca/sustituciónRecibiuse SIGHUP ou SIGTERM
A Acción (%s) refíxoseRefacerReface-la última operación desfeitaRecargarActualiza-la pantalla actualRefresca-la lista de arquivosAs cadeas de expresión regular deben comezar e rematar cun carácter " ExpRegRepeti-la última buscaSubstituirSubstituir unha cadea ou expresión regular¿Substituír?Substituír porO tamaño de recheo solicitado "%s" non é válidoO tamaño de lingüeta solicitado "%s" non é válidoModo restrinxidoReverti-la dirección da buscaColumna DereitaGravarGrava-lo arquivo por defecto en formato UnixGravar copias de seguridade dos ficheiros existentes¿Gravar ficheiro baixo NOME DIFERENTE? Gravar ficheiro sen confirmaciónGravar o buffer modificado antes da análiseGrava-lo buffer modificado?  (Respondendo "Non" descartará os cambios). Desprazar AbaixoDesprazar ArribaDesprazar liña a liña en vez de media pantallaBuscaTexto de Axuda do Comando de Busca

 Introduza as verbas ou caracteres que lle gustaría buscar, e entón prema Enter. Se hai coincidencia para o texto que introduciu, a pantalla será actualizada á localización da coincidencia máis preto da cadea de busca.

 A cadea previa de busca se mostrará entre corchetes despois do indicativo Busca:. Premendo Intro sen introducir ningún texto executará a busca previa.  Buscando dende o PrincipioBuscar cadeaProcura a seguinte ocurrencia cara atrásProcura a seguinte ocurrencia cara adianteBuscando...Establecer punto de corte forte na columna #colsEstablece-lo directorio de traballoEstablece-lo ancho de lingüeta a #cols columnasAmosar este texto de axuda e saírTecla de 'smart home'Desprazar mainamenteAcortado maino de liñas longasSíntoo, a combinación "%s" non se pode restablecerGracias en especial a:Texto de Axuda do Corrector Ortográfico

 O corrector ortográfico comproba a ortografía de todo o texto do ficheiro actual. Cando se atopa unha palabra descoñecida, resáltase e pódese editar unha que a substitúa. Despois vai preguntar se se cambian tódalas aparicións da palabra errada no ficheiro actual, ou, se vostede escolleu texto dentro da marca, no texto escollido.

 Existen as seguintes funcións no modo Corrector Ortográfico:

Fallou a revisión ortográfica: %sFallou a corrección ortográfica: %s: %sSuspenderSuspende-lo editor (se a suspensión está activada)SuspensiónSuspensión non activaCambiar ó seguinte ficheiroCambiar ó anterior ficheiroCambiouse a %sA sintaxe "%s" non ten directiva de corDefinición de sintaxe a empregar para corearLingüeta¡Gracias por usar nano!A sintaxe "default" non toma a expresión regular '%s'A sintaxe "default" non toma extensiónsA sintaxe "none" está reservadaA Free Software FoundationAs derradeiras días liñas amosan os atallos de teclado máis usados no editor.

 Os atallos de teclado escríbense como segue: As secuencias coa tecla de Control son nomeadas cun caret '^' e pode ser introducida usando a tecla Ctrl ou premendo a tecla Esc dúas veces. As secuencias coa tecla Meta son nomeadas co símbolo 'M-' e poden ser introducidas usando as teclas Alt, Cmd ou Esc, dependendo da configuración do seu teclado.  O editor de texto nanoEsta función está deshabilitada en modo restrinxidoEsta é a única apariciónEsta mensaxe é polo ficheiro pechado %s, ¿abrir nun novo buffer?Ó delimitadorA FicheirosAnalizadorOrtografíaSelector de engadir ó finalSelector de copiado de seguridade do ficheiro orixinalSelector de engadir previoSelector de sensibilidade a maiúsculas/minúsculas na buscaSelector de uso do formato DOSSelector de uso do formato MacSelector de uso dun novo bufferSelector de uso de expresións regulares¿Demasiados ficheiros de copia de seguridade?Se requiren dous caracteres de columna simpleEscriba '%s -h' para a lista de opcións dispoñibles.
Incapaz de crear directorio %s: %s
Requírese para gravar/cargar o historial de busca ou posición do cursor
Tecla non asociable: M-[Tecla non asociadaTecla non asociada: %cTecla non asociada: M-%cTecla non asociada: ^%cRepórTextoDesfacer corte do buffer de cortado na liña actualDesfíxose a acción (%s)DesfacerDesface-la última operaciónA palabra non se atopa: %sEntrada Unicode: %sDe-SangrarDeXustifOpción descoñecida "%s"Secuencia descoñecidaNome da sintaxe descoñecido: %sEmpregue "fg" para voltar a nano.
Usar ficheiros de bloqueo (estilo vim)Usar texto groso na vez de texto de video reversoUso dunha liña máis para editarUsar un ou máis liñas para editarEntrada LiteralEntrada LiteralVerModo visualización (só lectura)¿U-lo?U-lo SeguintQue outros caracteres son parte de palabrasAmosar espacios en brancoConta VerbasTexto de Axuda da Escritura de Ficheiro

 Escriba o nome co que quere garda-lo ficheiro actual e prema Intro para grava-lo ficheiro.

 Se seleccionou texto coa marca, preguntaráselle si grava só a parte seleccionada a un ficheiro separado. Para reduci-la posibilidade de sobrescribi-lo ficheiro actual con só unha parte del, o nome do ficheiro actual non é o nome por defecto neste modo.

 As seguintes teclas de función están dispoñibles no modo de Escritura de Ficheiro:

GravarGravar a Selección no FicheiroSiSsYye a todos os que esquencemos...comentariodesactivadoactivar/desactivaractivadoruptura de liñaunir liñafallou magic_file(%s): %sfallou magic_load(): %s¡A nano esgotóuselle a memoria!engadir textocortar textoborrar textoinserir textosubstituir textorepór textoos moitos tradutores e o TPdescomentarversiónPK�m�\�Y������LC_MESSAGES/parted.monu�[�����U�
�l���\p���
��2�<Yn��7��0
(>%g���,�, ,= 'j -�  � (� (
!3!O!o!�!��! "W$"|"<�"P�"]#H{#D�#�	$�$	�$L�$>�$+%!H%Gj%(�%<�%@&2Y&"�&B�&2�&%'],'=�'I�'(Z%(o�("�)*(1*Z*-w*�*�*�*'�*!+<+
I+T+c+g+l+�r+&K,r,$�,�,�,�,-:!-\\-=�-?�->7.v.�.&�.�.�.�.��.>�/*�/L0=N0;�0+�0H�0=1O1S1
Y1Kd1c�1?2T2`2�o2IK3G�4U�435:5F5c554�54�56$ 6E6W6)r6�6�6�6�6�6�6�7�7�7�7
�7�7�7�788+8G8e8l8o8+x8/�8/�8909D9T9.i9)�9.�9N�9@:U:)n:�:�:-�:�:"�:#;?;Z;q;w;�;�;�;�;�;H�;M<>Z<X�<>�<1=�M=��=R�><?<N?��?�
@F�@/�@^AhfAH�AHB*aBx�B�C,�C��C�vE@-F@nFR�F7Gp:G:�G��GUjH�H�H�H&I3I&8It_I(�I/�IA-JoJ3�J�J�J�J�JKK(K35K3iK/�K�K�K�K�L	�L�L�L�LH�L+FM�rM�MN;/N3kN/�N+�N'�N##OGOgO�O�O#�Ob�O~P�P�P�P�P�P�P	�P�P!�P
Q%Q*Q3Q?QTQoQ)xQ.�Q.�QRRO
RZR
aRlR�R$�R
�R�R�R+�RSSS.S7SQ?S�S9�S�S�S�SF�S#.TRTVT
YTdT}T)�T�T�T�T�T5�T�T
�T
U%US,U�U)�U�U@�U�U�UVBV_V	cVmVrVyV~V�V�V��V�EX#Y%/Y#UY!yY�Y
�Y*�Y<�YHZ^Z/yZ4�Z�ZI�ZE[5_[)�[7�[#�[%\!A\5c\6�\5�\,]63]#j]-�]-�]%�]%^%6^\^�_^�^T�^T_Ci_c�_y`R�`^�`�=ab
b_bVqb*�b(�bPc3mcO�cG�c=9d/wdX�dFeGebPe\�eRfcfvvf�f-mh1�h:�h*iA3i:ui/�i�i,�i-&j
Tjbjqj�j�j�j�j<�k"�k3l'8l*`l#�l �lN�lrmX�m[�mNGn�n�n<�n	�n	oo�-o]p9tpi�p\qUuqD�qQrbr�r
�r�r[�rs@�s
�s�s��sK�tAvNGv�v�v&�v#�v�v>wAQw'�w)�w�wx4!xVxsx%�x�x�x$�x��x�y�y�y�y�y�y!�y!z,3z3`z-�z�z�z	�z>�z9{BU{�{O�{�{|:'|1b|9�|h�|7}R}Bk}�}�}H�}"~*6~#a~"�~(�~
�~�~�~	#b<d�P�xU�U΀-$��R��ځv˂<B�9�����`�:�2'�lZ��DžJP�J��/������4J����r�@C�=��s‹86�o�4��$�eǍ!-�!O�q�5����2Ŏ���1��9��S�B�@]���1��ݐ���"�6�WE�Y��N�� F�g�#�����
X�c�!���[��0�}4���Ĕ:ڔ2�.H�*w�&��"ɕ��%�6�49�jn��ٖo�u�}�������	����'ė����!�3�	P�0Z�@��@̘
��@�Y�
`�(k���*��ߙ��H��H�P�T�	h�r�bz�ݚG�,�4�<�MA�*��������)қ��5�7�<�E�K�:P�����(��ɜ\М-�L4���G��̝ҝ�H��A�	E�O�[�b�g�o�-������v\>[ �A�0){h���]�	lJ�;#|��^�=8�K�����O:&ow��4��$@����+:�)S���E�6�����=�7���e/."-~�����MU�H�?n�@<F�,("1��QR�-Xm�}93BJ���zu	��GID����<�Hd�C4���pW ����%��r�2q��xZC��;fBL��YP�!U$��8�?I7������SR�>K�T��Lg0PDF�����yt21�NN��V�j��5O`G#�E5�(%Mk�!9T'�*�Q'&��
�A3,s6/b
����ic���
a��
.���+*�_
License GPLv3+: GNU GPL version 3 or later <http://gnu.org/licenses/gpl.html>.
This is free software: you are free to change and redistribute it.
There is NO WARRANTY, to the extent permitted by law.


Report bugs to %s

Report bugs to <%s>.

Report bugs to: %s
%0.f%%	(time left %.2d:%.2d)%s  %s%s  %s  %s%s : Couldn't write block %d
%s disk labels do not support extended partitions.%s disk labels don't support logical or extended partitions.%s during read on %s%s during seek for read on %s%s during seek for write on %s%s during write on %s%s has no extended partition (volume header partition).%s home page: <%s>
%s home page: <http://www.gnu.org/software/%s/>
%s is %dk, but it has %d clusters (%dk).%s is too small for a Mac disk label!%s trying to sync %s to disk%s%s argument '%s' too large%s: invalid option -- '%c'
%s: option '%c%s' doesn't allow an argument
%s: option '%s' is ambiguous; possibilities:%s: option '--%s' doesn't allow an argument
%s: option '--%s' requires an argument
%s: option '-W %s' doesn't allow an argument
%s: option '-W %s' is ambiguous
%s: option '-W %s' requires an argument
%s: option requires an argument -- '%c'
%s: unrecognised disk label%s: unrecognized option '%c%s'
%s: unrecognized option '--%s'
''mkpart' makes a partition without creating a new file system on the partition.  FS-TYPE may be specified to set an appropriate partition ID.
(C)A %s %s partition was found at %s -> %s.  Do you want to add it to the partition table?ATARAID ControllerAttempt to write sectors %ld-%ld outside of partition on %s.Bad FAT: cluster %d is cross-linked for %s.  You should run dosfsck or scandisk.Bad FAT: cluster %d outside file system in chain for %s.  You should run dosfsck or scandisk.Bad FAT: unterminated chain for %s.  You should run dosfsck or scandisk.Bad directory entry for %s: first cluster is the end of file marker.Both the primary and backup GPT tables are corrupt.  Try making a fresh table, and using Parted's rescue feature to recover partitions.BugCOMMANDs:Can't add a logical partition to %s, because there is no extended partition.Can't add another partition -- the partition map is too small!Can't add another partition.Can't create any more partitions.Can't have a logical partition outside of the extended partition on %s.Can't have a partition outside the disk!Can't have a primary partition inside an extended partition.Can't have logical partitions outside of the extended partition.Can't have more than one extended partition on %s.Can't have overlapping partitions.Can't have the end before the start! (start sector=%jd length=%jd)Can't write to %s, because it is opened read-only.CancelChanging the name of a root or swap partition will prevent Linux from recognising it as such.Checksum is wrong, indicating the partition table is corrupt.Cluster start delta = %d, which is not a multiple of the cluster size %d.Compaq Smart ArrayConflicting partition map entry sizes!  Entry 1 says it is %d, but entry %d says it is %d!Copyright (C) 1998 - 2006 Free Software Foundation, Inc.
This program is free software, covered by the GNU General Public License.

This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
GNU General Public License for more details.

Corrupted Sun disk label detected.Could not detect file system.Could not get identity of device %s - %sCould not read volume label.Could not retrieve disk geometry information.Could not stat device %s - %s.Could not write volume label.DAC960 RAID controllerDEVICE is usually /dev/hda or /dev/sda
Device verification failedDisk %s: %s
Disk ImageDisk is in useEndEnd?ErrorError informing the kernel about modifications to partition %s -- %s.  This means Linux won't know about any changes you made to %s until you reboot -- so you shouldn't mount it or use it in any way before rebooting.Error initialising SCSI device %s - %sError opening %s: %sError writing to the root directory.Expecting a disk label type.Expecting a file system type.Expecting a partition number.Expecting a partition type.Extended partitions cannot be hidden on msdos disk labels.FAT %d media %x doesn't match the boot sector's media %x.  You should probably run scandisk.FAT boot sector says clusters are 0 sectors.  This is weird. FAT boot sector says logical sector size is 0.  This is weird. FAT boot sector says there are no FAT tables.  This is weird. FLAG is one of: FS-TYPE is one of: Failed to write partition block at %d.FatalFatal errorFile systemFile system doesn't have expected sizes for Windows to like it.  Cluster size is %dk (%dk expected); number of clusters is %d (%d expected); size of FATs is %d sectors (%d expected).File system has an invalid cluster size for a FAT file system.File system has an invalid number of FATs.File system has an invalid number of reserved sectors for a FAT file system.File system has an invalid sector size for a FAT file system.File system has an invalid signature for a FAT file system.File system is FAT12, which is unsupported.File system is reporting the free space as %d clusters, not %d clusters.File system type?FixFlagsFree SpaceGNU Parted cannot resize this partition to this size.  We're working on it!GNU Parted was miscompiled: the FAT boot sector should be 512 bytes.  FAT support will be disabled.General help using GNU software: <http://www.gnu.org/gethelp/>
Generic IDEI2O ControllerIf you convert to FAT16, and MS Windows is installed on this partition, then you must re-install the MS Windows boot loader.  If you want to do this, you should consult the Parted manual (or your distribution's manual).If you convert to FAT32, and MS Windows is installed on this partition, then you must re-install the MS Windows boot loader.  If you want to do this, you should consult the Parted manual (or your distribution's manual).  Also, converting to FAT32 will make the file system unreadable by MS DOS, MS Windows 95a, and MS Windows NT.If you leave your file system as FAT16, then you will have no problems.If you leave your file system as FAT32, then you will not introduce any new problems.IgnoreInformationInvalid character class nameInvalid collation characterInvalid content of \{\}Invalid partition table - recursive partition on %s.Invalid partition table on %s -- wrong signature %x.Invalid partition table on %s.Invalid preceding regular expressionInvalid range endInvalid regular expressionInvalid signature %x for Mac disk labels.LABEL-TYPE is one of: Loopback deviceMemory allocation failedMemory exhaustedModel: %s (%s)
NAME is any word you want
NUMBER is the partition number used by Linux.  On MS-DOS disk labels, the primary partitions number from 1 to 4, logical partitions from 5 onwards.
NameNew device?New disk label type?New state?NoNo ImplementationNo device foundNo matchNo previous regular expressionNo room for partition info.No valid partition map found.NumberOKOPTIONs:Only logical partitions can be a boot file.Only primary partitions can be root partitions.Only primary partitions can be swap partitions.Out of memory.PART-TYPE is one of: primary, logical, extended
Packaged by %s
Packaged by %s (%s)
Partition %d has an invalid length of 0 bytes!Partition %d has an invalid signature %x.Partition %d is %s, but the file system is %s.Partition %d isn't aligned to cylinder boundaries.  This is still unsupported.Partition Table: %s
Partition doesn't exist.Partition map has no partition map entry!Partition name?Partition number?Partition too big/small for a %s file system.Partition type?Partition(s) on %s are being used.Premature end of regular expressionRegular expression too bigReport %s bugs to: %s
RetrySTATE is one of: on, off
SizeStartStart?SuccessSun disk label is full.Support for adding partitions to AIX disk labels is not implemented yet.Support for duplicating partitions in AIX disk labels is not implemented yet.Support for reading AIX disk labels is is not implemented yet.Support for setting system type of partitions in AIX disk labels is not implemented yet.Support for writing AIX disk labels is is not implemented yet.Syntax error in config fileThe FATs don't match.  If you don't know what this means, then select cancel, run scandisk on the file system, and then come back.The Whole Disk partition is the only available one left.  Generally, it is not a good idea to overwrite this partition with a real one.  Solaris may not be able to boot without it, and SILO (the sparc boot loader) appreciates it as well.The backup GPT table is corrupt, but the primary appears OK, so that will be used.The boot region doesn't start at the start of the partition.The data region doesn't start at the start of the partition.The device %s is so small that it cannot possibly store a file system or partition table.  Perhaps you selected the wrong device?The disk CHS geometry (%d,%d,%d) reported by the operating system does not match the geometry stored on the disk label (%d,%d,%d).The disk has %d cylinders, which is greater than the maximum of 65536.The disk label describes a disk bigger than %s.The driver descriptor says the physical block size is %d bytes, but Linux says it is %d bytes.The file %s is marked as a system file.  This means moving it could cause some programs to stop working.The file system can only be resized to this size by converting to FAT16.The file system can only be resized to this size by converting to FAT32.The file system is bigger than its volume!The format of the GPT partition table is version %x, which is newer than what Parted can recognise.  Please report this!The information sector has the wrong signature (%x).  Select cancel for now, and send in a bug report.  If you're desperate, it's probably safe to ignore.The location %s is outside of the device %s.The partition table cannot be re-read.  This means you need to reboot before mounting any modified partitions.  You also need to reinstall your boot loader before you reboot (which may require mounting modified partitions).  It is impossible do both things!  So you'll need to boot off a rescue disk, and reinstall your boot loader from the rescue disk.  Read section 4 of the Parted User documentation for more information.The partition table on %s cannot be re-read (%s).  This means the Hurd knows nothing about any modifications you made.  You should reboot your computer before doing anything with %s.The partition's boot region doesn't occupy the entire partition.The partition's data region doesn't occupy the entire partition.The primary GPT table is corrupt, but the backup appears OK, so that will be used.There are no possible configurations for this FAT type.There's not enough room in the root directory for all of the files.  Either cancel, or ignore to lose the files.This command does not make sense in non-interactive mode.
This file system has a logical sector size of %d.  GNU Parted is known not to work properly with sector sizes other than 512 bytes.This libparted doesn't have write support for %s.  Perhaps it was compiled read-only.Too many primary partitionsToo many primary partitions.Trailing backslashTry `%s --help' for more information.
TypeUnable to allocate a partition number.Unable to determine geometry of file/device %s.  You should not use Parted unless you REALLY know what you're doing!Unable to determine the size of %s (%s).Unable to determine the start and length of %s.Unable to open %s read-write (%s).  %s has been opened read-only.Unable to open %s.Unable to satisfy all constraints on the partition.UnknownUnknown file system type "%s".Unknown system errorUnmatched ( or \(Unmatched ) or \)Unmatched [ or [^Unmatched \{Unrecognised new style linux swap signature '%10s'.Unrecognised old style linux swap signature '%10s'.Unrecognised swsusp linux swap signature '%9s'.Unsupported disk formatUnsupported disk typeUsage: %s [OPTION] [DEVICE]...
Usage: parted [OPTION]... [DEVICE [COMMAND [PARAMETERS]...]...]
Apply COMMANDs with PARAMETERS to DEVICE.  If no COMMAND(s) are given, run in
interactive mode.
Using %s
Valid arguments are:Volume label is corruptedWarningWeird block size on device descriptor: %d bytes is not divisible by 512.Weird!  There are 2 partitions map entries!Without arguments, 'print' displays the entire partition table. However with the following arguments it performs various other actions.
Would you like to use FAT32?Written by %s and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, %s, and others.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
and %s.
Written by %s, %s, %s,
%s, %s, %s, and %s.
Written by %s, %s, %s,
%s, %s, and %s.
Written by %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
and %s.
Written by %s, %s, and %s.
Written by %s.
YesYou may need to update /etc/fstab.
You need %s of free disk space to shrink this partition to this size.  Currently, only %s is free.You should reinstall your boot loader before rebooting.  Read section 4 of the Parted User documentation for more information.^[nN]^[yY]`align-checkambiguous argument %s for %satvrecvbios_grubbootcannot create any more partitionschecking for bad blocksdiagdisk_setdisk_toggledisplays the versiondisplays this help messageextendedfat_table_alloc_cluster: no free clustersfat_table_get: cluster %ld outside file systemfat_table_set: cluster %ld outside file systemfreehelphelp [COMMAND]                           print general help, or help on COMMANDhiddenhp-serviceinvalid %s%s argument '%s'invalid argument %s for %sinvalid suffix in %s%s argument '%s'ioctl() errorlbalegacy_bootlists partition layout on all block deviceslogicallvmmemory exhaustedmetadatamklabelmklabel,mktable LABEL-TYPE               create a new disklabel (partition table)mkpartmkpart PART-TYPE [FS-TYPE] START END     make a partitionmktablemsftresnamename NUMBER NAME                         name partition NUMBER as NAMEnever prompts for user interventionoffonopen erroropening of device failedpaloped_device_new()  Unsupported device typeprepprimaryprintquitquit                                     exit programraidread errorreading from device failedrescuerescue START END                         rescue a lost partition near START and ENDresizeresizing %s file systems is not supportedrmrm NUMBER                                delete partition NUMBERrootsearching for file systemsselectselect DEVICE                            choose the device to editsetshrinkingswaptoggleunitversionwrite errorwriting to device failedProject-Id-Version: parted 3.1
Report-Msgid-Bugs-To: bug-parted@gnu.org
POT-Creation-Date: 2014-07-28 23:04-0400
PO-Revision-Date: 2012-11-11 15:50+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8-bit
Plural-Forms: nplurals=2; plural=(n != 1);

Licenza GPL3v+: GNU GPL versión3  ou posterior <http://gnu.org/licenses/gpl.html>
Isto é software libre: pode modificalo e redistribuílo.
Non hai NINGUNHA GARANTÍA, ata onde o permita a lei.


Envíe os informes de fallo a: %s

Envíe os informes de fallo a <%s>.

Envíe os informes de fallo a: %s
%0.f%%	(tempo restante %.2d:%.2d)%s  %s%s  %s  %s%s: non foi posíbel escribir o bloque %d
As etiquetas de disco %s non admiten particións estendidas.As etiquetas de disco %s non admiten particións lóxicas ou estendidas.%s durante a lectura en %s%s mentres se ía á posición na que ler en %s%s mentres se ía á posición na que escribir en %s%s durante a escritura en %s%s non ten unha partición estendida (partición de cabeceira de volume).Páxina web de %s: <%s>
Páxina web de %s: <http://www.gnu.org/software/%s/>
%s é de %dk, pero ten %d clusters (%dk).%s é pequeno de máis para unha etiqueta de disco Mac!%s tentando sincronizar %s no disco%s%s argumento «%s» demasiado longo%s: opción incorrecta -- «%c»
%s: a opción «%c%s» non permite ningún argumento
%s: a opción «%s» é ambigua; as posibilidades son:%s: a opción «--%s» non permite ningún argumento
%s: a opción «--%s» require un argumento
%s: a opción «-W %s» non permite ningún argumento
%s: a opción «-W %s» é ambigua
%s: a opción «-W %s» require un argumento
%s: a opción require un argumento -- «%c»
%s: etiqueta de disco non recoñecida%s: opción «%c%s» non recoñecida
%s: opción «--%s» non recoñecida
»«mkpart» crea unha partición sen crear un novo sistema de ficheiros na partición. Debe especificarse TIPO-SF para definir un ID de partición axeitado.
©Atopouse unha partición %s %s en %s -> %s. Quere engadila á táboa de particións?Controladora ATARAIDTentáronse escribir os sectores %ld-%ld fóra da partición en %s.FAT incorrecta: o cluster %d ten ligazóns cruzadas para %s. Debería executar dosfsck ou scandisk.FAT incorrecta: o cluster %d está fóra do sistema de ficheiros na cadea para %s. Debería executar dosfsck ou scandisk.FAT incorrecta: cadea non rematada para %s. Debería executar dosfsck ou scandisk.Entrada de directorio incorrecta para %s: o primeiro cluster é o marcador de fin de ficheiro.Ámbalas dúas táboas GPT, primaria e copia de seguridade, están danadas. Probe a crear unha táboa nova e a empregar a característica de rescate (rescue) de Parted para recuperar as particións.FalloORDEs:Non é posíbel engadir unha partición lóxica a %s, porque non hai unha partición estendida.Non é posíbel engadir outra partición -- o mapa de particións é pequeno de máis!Non é posíbel engadir máis particións.Non é posíbel crear máis particións.Non é posíbel ter unha partición lóxica fóra da partición estendida en %s.Non é posíbel ter unha partición fóra do disco!Non é posíbel ter unha partición primaria dentro dunha partición estendida.Non é posíbel ter particións lóxicas fóra da partición estendida.Non é posíbel ter máis de unha partición estendida en %s.Non é posíbel ter particións que se solapen.O final da partición non pode estar antes do comezo! (sector inicial=%jd lonxitude=%jd)Non foi posíbel escribir en %s, porque está aberto para só lectura.CancelarCambiar o nome dunha partición raíz ou de intercambio ha impedir que Linux a recoñeza coma tal.A suma de comprobación é incorrecta, o que indica que a táboa de partición está danada.Delta do comezo do cluster = %d, que non é un múltiplo do tamaño do cluster %d.Compaq Smart ArrayTamaños das entradas do mapa de particións conflitivos! A entrada 1 di que é de %d, pero a entrada %d di que é %d!Copyright (C) 1998 - 2006 Free Software Foundation, Inc.
Este programa é software libre, cuberto pola Licenza Pública Xeral de GNU.

Este programa distribúese coa esperanza de que sexa útil, pero
SEN NINGUNHA GARANTÍA; nin sequera a garantía implícita de
COMERCIABILIDADE ou APTITUDE PARA UN FIN EN PARTICULAR. Vexa a
Licenza Pública Xeral de GNU para obter máis detalles.

Detectouse unha etiqueta de disco Sun danada.Non é posíbel detectar un sistema de ficheiros.Non foi posíbel obter a identidade do dispositivo %s - %sNon foi posíbel ler a etiqueta de volume.Non foi posíbel recuperar a información da xeometría de disco.Non foi posíbel facer "stat" sobre o dispositivo %s - %s.Non foi posíbel escribir a etiqueta de volume.Controladora RAID DAC960DISPOSITIVO adoita ser /dev/hda ou /dev/sda
Produciuse un erro ao comprobar o dispositivoDisco %s: %s
Imaxe de discoO disco está en usoFinFin?ErroProduciuse un erro ao informar ao núcleo sobre as modificacións feitas na partición %s -- %s. Isto quere dicir que Linux non ha saber nada dos cambios que lle fixo a %s ata que reinicie -- así que non debería montala ou empregala de ningún xeito antes de reiniciar.Produciuse un erro ao inicializar o dispositivo SCSI %s - %sProduciuse un erro ao abrir %s: %sProduciuse un erro ao escribir no directorio raíz.Espérase un tipo de etiqueta de disco.Espérase un tipo de sistema de ficheiros.Espérase un número de partición.Espérase un tipo de partición.As particións estendidas non poden estar ocultas en etiquetas de disco msdos.Na FAT %d, o soporte %x non coincide co soporte do sector de arranque, %x. Seguramente debería executar scandisk.O sector de arranque de FAT di que os clusters teñen 0 sectores. Isto é moi estraño. O sector de arranque de FAT di que o tamaño lóxico de sector é 0. Isto é moi estraño. O sector de arranque de FAT di que non hai táboas FAT. Isto é moi estraño. MODIF é un destes: TIPO-SF é un destes: Produciuse un erro ao escribir o bloque de partición en %d.Moi graveErro moi graveSistema de ficheirosO sistema de ficheiros non ten os tamaños esperados para que a Windows lle guste. O tamaño do cluster é %dk (esperábase %dk); o número de clusters é %d (esperábanse %d); o tamaño das FATs é de %d sectores (esperábanse %d).O sistema de ficheiros ten un tamaño de bloque non válido para un sistema de ficheiros FAT.O sistema de ficheiros ten un número de FATs incorrecto.O sistema de ficheiros ten un número incorrecto de sectores reservados para un sistema de ficheiros FAT.O sistema de ficheiros ten un tamaño de sector incorrecto para un sistema de ficheiros FAT.O sistema de ficheiros ten unha sinatura incorrecta para un sistema de ficheiros FAT.O sistema de ficheiros é FAT12, para o cal non hai compatibilidade.O sistema de ficheiros di que o espacio libre é de %d clusters, non %d clusters.Tipo de sistema de ficheiros?ArranxarModificadoresEspazo libreGNU Parted non pode redimensionar esta partición a este tamaño. Estamos traballando niso!GNU parted compilouse incorrectamente: o sector de arranque FAT debería ter 512 bytes. Vaise desactivar a compatibilidade FAT.Axuda xeral ao usar software GNU: <http://www.gnu.org/gethelp/>
IDE xenéricoControladora I2OSe converte a FAT16, e MS Windows está instalado na partición, ha ter que reinstalar o cargador de arranque de MS Windows. Se quere facelo, debería consultar o manual de Parted (ou o manual da súa distribución).Se converte a FAT32, e MS Windows está instalado na partición, ha ter que reinstalar o cargador de arranque de MS Windows. Se quere facelo, debería consultar o manual de Parted (ou o manual da súa distribución). Ademais, a conversión a FAT32 fará o sistema de ficheiros ilexíbel para MS DOS, MS Windows 95a e MS Windows NT.Se deixa o sistema de ficheiros como FAT16, non ha ter problemas.Se deixa o sistema de ficheiros como FAT32, non ha introducir novos problemas.IgnorarInformaciónNome da clase de caracteres incorrectoCarácter de ordenación incorrectoContido de \{\} non válidoTáboa de particións incorrecta - partición recursiva en %s.Táboa de particións incorrecta en %s -- sinatura %x incorrecta.Táboa de particións incorrecta en %s.Expresión regular precedente non válidaFin de intervalo non válidaExpresión regular non válidaSinatura %x non válida para etiquetas de disco Mac.TIPO-ETIQUETA é un destes: Dispositivo de LoopbackProduciuse un erro ao asignar memoriaMemoria esgotadaModelo: %s (%s)
NOME é calquera palabra que queira
MENOR é o número de partición que usa Linux. Nas etiquetas de disco MS-DOS, as particións primarias teñen números de 1 a 4, e as lóxicas téñenos do 5 en diante.
NomeNovo dispositivo?Novo tipo de etiqueta de disco?Novo estado?NonSen implementaciónNon se atopou ningún dispositivoSen coincidenciasNon hai ningunha expresión regular anteriorNon hai espazo para a información das particións.Non se atopou un mapa de particións válido.NúmeroAceptarOPCIÓNs:Só as particións lóxicas poden ser un ficheiro de arranque.Só as particións primarias poden ser particións raíz.Só as particións primarias poden ser particións de intercambio.Memoria esgotada.TIPO-PARTICION é: primary (primaria), logical (lóxica), extended (estendida)
Empaquetado por %s
Empaquetado por %s (%s)
A partición %d ten unha lonxitude non válida de 0 bytes!A partición %d ten unha sinatura %x non válida.A partición %d é %s, pero o sistema de ficheiros é %s.A partición %d non está aliñada nos límites dos cilindros. Aínda non hai compatibilidade para isto.Táboa de particións: %s
A partición non existe.O mapa de particións non ten unha entrada do mapa de particións!Nome da partición?Número de partición?A partición é grande/pequena de máis para un sistema de ficheiros %s.Tipo de partición?Esta(n)se a usar a(s) partición(s) de %s.Fin prematura da expresión regularExpresión regular grande de máisEnvíe os informes de fallo en %s a %s.
ReintentarESTADO é un destes: on, off
TamañoInicioInicio?ÉxitoA etiqueta de disco Sun está chea.A compatibilidade para engadir particións a etiquetas de disco AIX aínda non está implementada.A compatibilidade para duplicar particións en etiquetas de disco AIX aínda non está implementada.A compatibilidade para ler etiquetas de disco AIX aínda non está implementada.A compatibilidade para definir o tipo de sistema de particións en etiquetas de disco AIX aínda non está implementada.A compatibilidade para escribir etiquetas de disco AIX aínda non está implementada.Erro de sintaxe no ficheiro de configuraciónAs FATs non coinciden. Se non sabe o que isto significa, escolla "Cancelar", empregue "scandisk" no sistema de ficheiros, e logo volva.A partición de Disco Completo é a única que queda dispoñíbel. Normalmente non é unha boa idea sobrescribir esta partición cunha de verdade. Solaris pode non arrancar sen ela, e SILO (o cargador de arranque de sparc) tamén a aprecia.A copia de seguridade da táboa GPT está danada, pero a primaria semella estar ben, así que é a que se ha empregar.A rexión de arranque non comeza no principio da partición.A rexión de datos non comeza no principio da partición.O dispositivo %s é tan pequeno que non é posíbel que almacene un sistema de ficheiros nin unha táboa de particións. Non seleccionaría un dispositivo equivocado?A xeometría CHS do disco (%d,%d,%d) indicada polo sistema operativo no coincide coa xeometría almacenada na etiqueta de disco (%d,%d,%d).O disco ten %d cilindros, o que supera o máximo de 65536.A etiqueta de disco describe un disco maior de %s.O descritor do controlador di que o tamaño do bloque físico é %d bytes, pero Linux di que é de %d bytes.O ficheiro %s está marcado como ficheiro de sistema. Isto significa que movelo podería facer que outros programas deixen de traballar.O sistema de ficheiros só pode alcanzar este tamaño convertendo a FAT16.O sistema de ficheiros só pode alcanzar este tamaño convertendo a FAT32.O sistema de ficheiros é maior que seu volume!O formato da táboa de partición GPT é da versión %x, que é máis recente do que Parted pode recoñecer. Por favor infórmenos!O sector de información ten unha sinatura incorrecta (%x). Escolla "Cancelar" polo de agora, e envíe un informe de fallo. Se está desesperado, pode que sexa seguro ignorar.A localización de %s está fóra do dispositivo %s.Non foi posíbel volver ler a táboa de particións, así que ten que reiniciar antes de montar calquera partición modificada. Tamén ten que reinstalar o cargador de arranque antes de reiniciar (o que pode precisar a montaxe de particións modificadas). É imposíbel facer ámbalas dúas cousas, así que ha ter que arrancar cun disco de rescate, e reinstalar o cargador de arranque desde o disco de rescate. Lea a sección 4 da documentación de Usuario de Parted para obter máis información.Non é posíbel volver ler a táboa de particións de %s (%s). Isto quere dicir que Hurd non sabe nada sobre as modificacións que vostede fixo. Debería reiniciar o seu computador antes de facer nada con %s.A rexión de arranque da partición non ocupa toda a partición.A rexión de datos da partición non ocupa toda a partición.A táboa GPT primaria está danada, pero a copia de seguridade semella estar ben, así que é a que se ha empregar.Non hai configuracións posíbeis para este tipo de FAT.Non hai espazo dabondo no directorio raíz para todos os ficheiros. Pode ou ben cancelar, ou ben ignorar e perder os ficheiros.Esta orde non ten sentido nun modo non interactivo.
Este sistema de ficheiros ten un tamaño de sector lóxico de %d. Sábese que GNU Parted non traballa correctamente con tamaños de sector distintos de 512 bytes.Esta versión de libparted non admite a escritura para %s. Se cadra está compilado para só lectura.Demasiadas particións primarias.Demasiadas particións primarias.Barra invertida ao finalExecute «%s --help» para obter máis información.
TipoNon foi posíbel asignar un número de partición.Non foi posíbel determinar a xeometría do ficheiro/dispositivo %s. Non debería usar Parted se non sabe DE VERDADE o que está a facer!Non foi posíbel determinar o tamaño de %s (%s).Non foi posíbel determinar o inicio e a lonxitude de %s.Non foi posíbel abrir %s para lectura-escritura (%s). Abriuse %s para só lectura.Non foi posíbel abrir %s.Non foi posíbel satisfacer todas as restricións da partición.DescoñecidoTipo de sistema de ficheiros «%s» descoñecido.Erro de sistema descoñecido( ou \( sen parella) ou \) sen parella[ ou [^ sen parella\{ sen parellaSinatura «%10s» da partición de intercambio de linux de novo estilo non recoñecida.Sinatura «%10s» da partición de intercambio de linux de antigo estilo non recoñecida.Sinatura «%9s» da partición de intercambio de linux swsusp non recoñecida.Formato de disco non compatíbelTipo de disco non compatíbelUso: %s [OPCIÓN] [DISPOSITIVO]...
Uso: parted [OPCIÓN]... [DISPOSITIVO [ORDE [PARÁMETROS]...]...]
Aplica a ORDE cos PARÁMETROS ao DISPOSITIVO. Se non se indica ningunha
ORDE, funciona en modo interactivo.
Usando %s
Os argumentos válidos son:A etiqueta do volume está danadaAvisoTamaño de bloque estraño no descritor do dispositivo: %d bytes non é divisíbel por 512.Estraño! Hai 2 entradas de mapa de particións!Sen argumentos, «print» mostra toda a táboa de particións. Aínda así cos seguintes argumentos realiza outras accións.
Quere usar FAT32?Escrito por %s e %s.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
%s, %s, e outros.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
%s, e %s.
Escrito por %s, %s, %s,
%s, %s, %s, %s,
e %s.
Escrito por %s, %s, %s,
%s, %s, %s, e %s.
Escrito por %s, %s, %s,
%s, %s, e %s.
Escrito por %s, %s, %s,
%s, e %s.
Escrito por %s, %s, %s,
e %s.
Escrito por %s, %s e %s.
Escrito por %s.
SiNon esqueza actualizar /etc/fstab, se é necesario.
Precisa %s de espazo libre para reducir esta partición a este tamaño (actualmente ten só hai %s libres)Debería reinstalar o cargador de arranque antes de reiniciar. Lea a sección 4 da documentación de Usuario de Parted para obter máis información.^[nN]^[sSyY]«align-checkargumento %s ambiguo para %satvrecvbios_grubarranquenon é posíbel crear máis particiónsbuscando bloques erróneosdiagdisk_setdisk_togglemostra a versiónmostra esta mensaxe de axudaestendidafat_table_alloc_cluster: non hai clusters libresfat_table_get: o cluster %ld está fóra do sistema de ficheirosfat_table_set: o cluster %ld está fóra do sistema de ficheiroslibrehelphelp [ORDE]           mostrar axuda xeral, ou axuda sobre a ORDEocultahp-serviceo argumento «%s» de %s%s é incorrectoargumento incorrecto %s para %ssufixo incorrecto %s%s no argumento «%s»erro de ioctl()lbalegacy_bootlista a disposición das particións de todos os dispositivos de bloqueslóxicalvmesgotouse a memoriametadatosmklabelmklabel, mktable TIPO-ETIQUETA           crear unha nova etiqueta de disco (táboa de particións)mkpartmkpart TIPO-PARTICION [TIPO-FS] INICIO FIN        crear unha particiónmktablemsftresnamename NÚMERO NOME                         ponlle o NOME á partición NÚMEROnon pedir nunca a intervención do usuariooffonerro de aperturaproduciuse un erro ao abrir o dispositivopaloped_device_new()  Tipo de dispositivo non compatíbelprepprimariaprintquitquit                                     saír do programaraiderro de lecturaproduciuse un erro ao ler do dispositivorescuerescue INICIO FIN                        recupera unha partición perdida entre INICIO e FINresizenon hai compatibilidade para o redimensionamento de sistemas de ficheiros %srmrm NÚMERO                                eliminar a partición NÚMEROraízbuscando sistemas de ficheirosselectselect DISPOSITIVO                       escoller o dispositivo a editarsetreducindointercambiotoggleunitversionerro de escrituraproduciuse un erro ao escribir no dispositivoPK�m�\� \$\$LC_MESSAGES/firewalld.monu�[�����m���@		A	K	
\	j	s		�	�	�	�	�	�	
4!
V
j
$�
�
�
#�
��
�
����
�"4	CM	Zdy������	


!
'
,
	2
m<
��
J
Q\i�z
&',T e�)�'�$�!
I/y~����	�����"1=\dmt{���?
�����&�+ )LMv0�^�AT���	�����"����(G(_#� � �D�3"O)r!�
�$�����%�
"$3!Xz
��
������(D]ly�����q���
�������*��.:#K+o(�"�D�,2Oi{	�
����"��  & &5 \ d m t z �� �m!""	 "*"0"/5":e"5�"]�";4#np#L�#	,$6$	=$G$P$S29@NDU^`[*GPf#_=;M.!YC,$c14e>'I R75k
\<Vl"&H3WZa?J]Qi-bhL:)KgXT
A(680j	E/dOFB%m+Add EntryAdd Forward PortAdd ICMP TypeAdd PortAdd ServiceAdd ZoneAddressAll network traffic is blocked.Authorization failed.Base ICMP Type SettingsBase Service SettingsBase Zone SettingsBlock all network trafficBold entries are mandatory, all others are optional.Change Default ZoneChange Zones of Connections...Connection to FirewallD established.Connection to FirewallD lost.ConnectionsCurrent default zone of the system.Currently visible configuration. Runtime configuration is the actual active configuration. Permanent configuration will be active after service or system reload or restart.Default TargetDefault Zone:Default zone changed to '%s'.Description:DestinationEdit EntryEdit Firewall Settings...Edit Forward PortEdit ICMP TypeEdit PortEdit ServiceEdit ZoneEnable NotificationsErrorFailed to load icons.FirewallFirewall AppletFirewall ConfigurationFirewallD has been reloaded.Forward to another portICMP FilterICMP TypeIP address:IPv4IPv4:IPv6IPv6:Icmp TypeIf you enable local forwarding, you have to specify a port. This port has to be different to the source port.If you specify destination addresses, the service entry will be limited to the destination address and type. If both entries are empty, there is no limitation.IgnoreInterfacesInvalid nameLocal forwardingMark the ICMP types in the list, which should be rejected. All other ICMP types are allowed to pass the firewall. The default is no limitation.ModulesName already existsName:Network traffic is not blocked anymore.No Active Zones.No connection to firewall daemonOther Protocol:Please configure base ICMP type settings:Please configure base service settings:Please configure base zone settings:Please enter a port and protocol.Please select the source and destination options according to your needs.PortPort / Port Range:Port ForwardingPort and ProtocolPortsProtocolProtocol:Reload FirewalldRemoveRemove EntryRemove Forward PortRemove ICMP TypeRemove PortRemove ServiceRemove ZoneSelect zone for interface '%s'ServiceServicesShort:SourceTarget:The Internet Control Message Protocol (ICMP) is mainly used to send error messages between networked computers, but additionally for informational messages like ping requests and replies.This feature is useful for people using the default zones mostly. For users, that are changing zones of connections, it might be of limited use.To AddressTo PortVersion:WarningZoneZone '%s' activated for interface '%s'Zone '%s': ICMP type '%s' is not available.Zone '%s': Service '%s' is not available.Zone '{zone}' active for connection '{connection}' on interface '{interface}'Zone '{zone}' active for interface '{interface}'Zone '{zone}' {activated_deactivated} for connection '{connection}' on interface '{interface}'Zone '{zone}' {activated_deactivated} for interface '{interface}'_File_Help_OptionsactivateddeactivatedProject-Id-Version: PACKAGE VERSION
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2021-05-25 10:54-0400
PO-Revision-Date: 2015-02-26 09:45+0000
Last-Translator: Copied by Zanata <copied-by-zanata@zanata.org>
Language-Team: Galician (http://www.transifex.com/projects/p/firewalld/language/gl/)
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=(n != 1);
X-Generator: Zanata 4.6.2
Engadir unha entradaEngadir un porto de encamiñamentoEngadir un tipo de ICMPEngadir un portoEngadir un servizoEngadir unha zonaEnderezoTodo o tráfico da rede está bloqueado.Fallou a autorización.Configuración dos tipos de ICMP de baseConfiguración dos servizos de baseConfiguración das zonas de baseBloquear todo o tráfico da redeA entradas en negra son obrigatorias; todas as demais son opcionais.Cambiar a zona por omisiónCambiar as zonas das conexións...Estabeleceuse unha conexión a FirewallD.Perdeuse a conexión a FirewallD.ConexiónsZona por omisión actual do sistema.Configuración visíbel actualmente. A configuración do tempo de execución é a configuración activa real. A configuración permanente estará activa despois de recargar ou reiniciar o servizo ou o sistema.Destino por omisiónZona por omisiónA zona por omisión cambiou a «%s».Descrición:DestinoEditar a entradaEditar a configuración da devasa...Editar un porto de encamiñamentoEditar o tipo de ICMPEdita o portoEditar o servizoEditar a zonaActivar as notificaciónsErroFallou a carga das iconas.DevasaApplet de devasaConfiguración da devasaCargouse FirewallD de novo.Encamiñar a outro portoFiltro de ICMPTipo de ICMPEnderezo de IP:IPv4IPv4:IPv6IPv6:Tipo de ICMPPara activar o encamiñamento local hai que indicar un porto. Este porto ten que ser diferente do porto de orixe.Se se indican enderezos de destino, a entrada do servizo limítase ao enderezo e tipo de destino. Se ambas as dúas entradas estiveren baleiras non hai limitación.IgnorarInterfacesO nome non é válidoEncamiñamento localMarque os tipos de ICMP da lista que desexe que sexan rexeitados. O resto dos tipos de ICMP terán permitido pasar a devasa. Por omisión non hai limitación.MódulosXa existe ese nomeNome:O tráfico da rede xa non está bloqueado.Non hai ningunha zona activa.Non hai ningunha conexión co daemon da devasaOutro protocolo:Configure os tipos de ICMP de base:Configure as opcións dos servizos de base:Configure as opcións das zonas de base:Introduza un porto e un protocolo.Escolla as opcións de orixe e destino segundo as súas necesidades.PortoPorto / Intervalo de portos:Encamiñamento dos portosPorto e protocoloPortosProtocoloProtocolo:Cargar Firewalld de novoRetirarRetirar a entradaRetirar un porto de encamiñamentoRetirar o tipo de ICMPRetirar o portoRetirar o servizoRetirar a zonaEscolla a zona para a interface «%s»ServizoServizosCurto:OrixeDestino:O Protocolo de Mensaxes de Control da Internet (ICMP) emprégase principalmente para enviar mensaxes de erro entre os computadores dunha rede, mais, alén disto, tamén para mensaxes informativos como solicitudes e respostas de ping.Esta funcionalidade é útil para quen empregue principalmente as zonas por omisión. Par quen ande a cambiar as zonas das conexións podería ter pouco uso.Ao enderezoAo portoVersión:AvisoZonaA zona «%s» está acivada na interface «%s»Zona «%s»: O tipo de ICMP «%s» non está dispoñíbel.Zona «%s»: O servizo «%s» non está dispoñíbel.A zona «{zone}» está activa para a conexión «{connection}» na interface «{interface}»A zona '{zone}' está activa para a interface '{interface}'A zona «{zone}» está {activated_deactivated} para a conexión «{connection}» na interface «{interface}»A zona «{zone}» está {activated_deactivated} na interface «{interface}»_FicheiroA_xuda_OpciónsactivadodesactivadoPK�m�\]I`���LC_MESSAGES/libpaper.monu�[�����/�C%,/�7�������	!'-0369<?BIP	Wafk
q
�����	��U�%(�0(����

%+17:=@CFILSZ	akpu{��������,"$- %*	&'+
/#(!).
10x1411x17Comm10DLMonarchPlease select the default paper size for the system. Various programs on the system will use this configuration option to determine how to print output.System's default paper size:a0a1a10a2a3a4a5a6a7a8a9archAarchBarchCarchDarchEb0b1b2b3b4b5c5csheetdsheetesheetexecutiveflsaflsefoliohalfexecutivehalfletterledgerlegalletternotequartostatementtabloidProject-Id-Version: libpaper
Report-Msgid-Bugs-To: eppesuig@debian.org
POT-Creation-Date: 2007-07-18 19:50+0200
PO-Revision-Date: 2007-07-23 03:09+0100
Last-Translator: Jacobo Tarrio <jtarrio@debian.org>
Language-Team: Galician <trasno@ceu.fi.udc.es>
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
10x1411x17Comm10CLMonarchEscolla o tamaño de papel por defecto para o sistema. Varios programas do sistema han empregar esta opción de configuración para determinar como imprimir.Tamaño de papel por defecto do sistema:a0a1a10a2a3a4a5a6a7a8a9archAarchBarchCarchDarchEb0b1b2b3b4b5c5csheetdsheetesheetexecutivoflsaflsefoliomedio executivomedia cartalibrolegalcartanotaquartodeclaracióntabloidePK�m�\�_�$9W9WLC_MESSAGES/make.monu�[������3��&�)!2T f�'�#��
",O kt�LPNM�@�o.o�FJU��9!C[f�_;fO�J�}=~�>:CyF�I;N	�"���
�
��	,6EN%_�
�7����)C(a�&�*��##*)N-x�$�9� 3= q � !� =� "�  !)!"0!;S!!�!�!+�!�!"&-".T"�"�"��"&v#%�#�##�#>�#	2$<$1D$2v$�$"�$*�$%%"%	.%8%P%p%}%%�%�%$�%�%	&+&E&!b&�&�&
�&�&�&�&)�&'4';'H'Q'e'y'	�'�'�'�'�'-�'-(9(
<(*G("r(	�(6�(
�(-�())))"?)#b)�)"�)'�)�)"�)# *
D*R*[*c*v*~*�*�*
�*�*�*�*++!2+T+`+v+�+�+	�+9�+�+3,E,R,e,m,!�,�,�,�,8�,0-K-b-z-�-)�-;�-3.F.O.f.'�.�.�.0�.�.
/,'/T/c/}/=�/9�/10/G0�w023+2_2o2(|2�2)�2�2+3003a3z30�30�3 �3%4�24S�4t	5~~5L�5qJ6��6QT7J�7��7<�8I�8p9p�9<�9x/:v�:�;��;GK<M�<J�<M,=;z=	�="�=�=�=	>>$> C>d>	>�>�>�>!�>�>
�>D�>2?D?$d?�?�?"�?-�?@)0@-Z@�@/�@/�@-A24AgA)�AA�A#�A;B3NB�B:�BX�B*-CXCaC)hCO�C(�C4D3@DtD�D)�D1�DE#E�=E-F,5FbF-uFE�F
�F�F=�F?;G{G-�G0�G�G�GH'H#3H,WH�H�H.�H)�H)I-I
GI/RI(�I*�I�I�I�I
JJ*/J6ZJ�J�J�J
�J�J�JKK(K%/KUKlKB{K5�K�K�KCL4OL
�L>�L$�L4�L(M.MAM2`M2�M�M4�M0N&8N{_N9�NO%O.O6OHOOO^OzO	�O%�O�O$�O&�O&P#@PdPvP�P�P�P�PD�P.2QBaQ�Q$�Q�Q"�Q4R<RVR_RCqR2�R�RS4S"RS4uSU�SHTITZT'uT5�T �T�T?�T%8U'^UH�U�U�U#�UT!VLvV9�V;�V��Y6������kC
}I�_�>e��avrZ#�85'�V��N��
��q-$t��dO������2Kw�~��Ss���QR���3�gT���x�	�)�]\G�*�h�[�<f�7�{J +9X�%�j/AB1��&M4oWb0`c���py(��L����������UD"?����i�;P=����!n���|�:.ml�,��zu��F�������E�H@^�
# %u implicit rules, %u
# %u pattern-specific variable values
# Directories

# Files
# Finished Make data base on %s

# Implicit Rules
# Make data base, printed on %s
# No implicit rules.
# No pattern-specific variable values.
# Pattern-specific Variable Values
# VPATH Search Paths

# Variables

# files hash-table stats:
# 
Counted %d args in failed launch

This program built for %s

This program built for %s (%s)

Unhandled exception filter called from program %s
ExceptionCode = %lx
ExceptionFlags = %lx
ExceptionAddress = 0x%p
  --debug[=FLAGS]             Print various types of debugging information.
  --no-print-directory        Turn off -w, even if it was turned on implicitly.
  --warn-undefined-variables  Warn when an undefined variable is referenced.
  -B, --always-make           Unconditionally make all targets.
  -C DIRECTORY, --directory=DIRECTORY
                              Change to DIRECTORY before doing anything.
  -I DIRECTORY, --include-dir=DIRECTORY
                              Search DIRECTORY for included makefiles.
  -R, --no-builtin-variables  Disable the built-in variable settings.
  -S, --no-keep-going, --stop
                              Turns off -k.
  -W FILE, --what-if=FILE, --new-file=FILE, --assume-new=FILE
                              Consider FILE to be infinitely new.
  -b, -m                      Ignored for compatibility.
  -d                          Print lots of debugging information.
  -e, --environment-overrides
                              Environment variables override makefiles.
  -f FILE, --file=FILE, --makefile=FILE
                              Read FILE as a makefile.
  -h, --help                  Print this message and exit.
  -j [N], --jobs[=N]          Allow N jobs at once; infinite jobs with no arg.
  -k, --keep-going            Keep going when some targets can't be made.
  -l [N], --load-average[=N], --max-load[=N]
                              Don't start multiple jobs unless load is below N.
  -o FILE, --old-file=FILE, --assume-old=FILE
                              Consider FILE to be very old and don't remake it.
  -p, --print-data-base       Print make's internal database.
  -r, --no-builtin-rules      Disable the built-in implicit rules.
  -t, --touch                 Touch targets instead of remaking them.
  -v, --version               Print the version number of make and exit.
  -w, --print-directory       Print the current directory.
  Date %s  uid = %d, gid = %d, mode = 0%o.
 (built-in): (core dumped) (don't care) (ignored) (name might be truncated) (no default goal) (no ~ expansion) (remote) (search path) files,  impossibilities impossibilities in %lu directories.
 so far. terminal.#  A default, MAKEFILES, or -include/sinclude makefile.#  Also makes:#  Command line target.#  Failed to be updated.#  File does not exist.#  File has been updated.#  File has not been updated.#  File is an intermediate prerequisite.#  File is very old.#  Implicit rule search has been done.#  Implicit rule search has not been done.#  Last modified %s
#  Modification time never checked.#  Needs to be updated (-q is set).#  Phony target (prerequisite of .PHONY).#  Precious file (prerequisite of .PRECIOUS).#  Successfully updated.# %s (device %d, inode [%d,%d,%d]): # %s (device %d, inode [%d,%d,%d]): could not be opened.
# %s (device %ld, inode %ld): # %s (device %ld, inode %ld): could not be opened.
# %s: could not be stat'd.
# Not a target:# variable set hash-table stats:
%s (line %d) Bad shell context (!unixy && !batch_mode_shell)
%s is suspending for 30 seconds...%s%s: %s%s: %s%s: Entering an unknown directory
%s: Interrupt/Exception caught (code = 0x%lx, addr = 0x%p)
%s: Leaving an unknown directory
%s: Shell program not found%s: Timestamp out of range; substituting %s%s: illegal option -- %c
%s: invalid option -- %c
%s: option requires an argument -- %c
%s: user %lu (real %lu), group %lu (real %lu)
%sBuilt for %s
%sBuilt for %s (%s)
%sLicense GPLv3+: GNU GPL version 3 or later <http://gnu.org/licenses/gpl.html>
%sThis is free software: you are free to change and redistribute it.
%sThere is NO WARRANTY, to the extent permitted by law.
%s[%u]: Entering an unknown directory
%s[%u]: Leaving an unknown directory
*** Break.
*** Waiting for unfinished jobs....-warning, you may have to re-enable CTRL-Y handling from DCL.
.  Stop.
AbortedAccess violation: read operation at address 0x%p
Access violation: write operation at address 0x%p
Alarm clockAvoiding implicit rule recursion.
BUG: num_pattern_rules is wrong!  %u != %uBUILTIN CD %s
Bad system callBroken pipeBus errorCPU time limit exceededCannot create a temporary file
Child accessChild exitedCircular %s <- %s dependency dropped.Cleaning up temp batch file %s
Cleaning up temporary batch file %s
Collisions=%ld/%ld=%.0f%%ContinuedCouldn't change back to original directory.CreatePipe() failed (e=%ld)
Creating temporary batch file %s
Current timeCustoms won't export: %s
Danger signalEMT trapExecuting %s instead
File size limit exceededFloating point co-processor not availableFloating point exceptionHangupI/O possibleIOT trapIllegal InstructionInformation requestInitialized accessInterruptKilledLive child %p (%s) PID %s %s
Load=%ld/%ld=%.0f%%, Make accessMakefile from standard input specified twice.Malformed target-specific variable definitionNoNo targetsNo targets specified and no makefile foundObtained token for child %p (%s).
Options:
Parallel jobs (-j) are not supported on this platform.Power failurePutting child %p (%s) PID %s%s on the chain.
QuitRe-executing[%u]:Reading makefiles...
Reaping losing child %p PID %s %s
Reaping winning child %p PID %s %s
Rehash=%d, Released token for child %p (%s).
Removing child %p PID %s%s from chain.
Removing intermediate files...
Report bugs to <bug-make@gnu.org>
Resetting to single job (-j1) mode.Resource lostSIGPHONESIGWINDSegmentation faultStoppedStopped (signal)Stopped (tty input)Stopped (tty output)TerminatedTrace/breakpoint trapUnknown error %dUpdating goal targets....
Updating makefiles....
Urgent I/O conditionUsage: %s [options] [target] ...
User accessUser defined signal 1User defined signal 2Virtual timer expiredWindow changedautomaticcan't allocate %lu bytes for hash table: memory exhaustedcannot enforce load limit: cannot enforce load limits on this operating systemcommand linecreating jobs pipedefaultdone sleep(30). Continuing.
empty string invalid as file nameempty variable nameenvironmentenvironment under -efind_and_set_shell() path search set default_shell = %s
find_and_set_shell() setting default_shell = %s
fopen (temporary file)fwrite (temporary file)init jobserver pipeinvalid syntax in conditionallbr$ini_control() failed with status = %dlbr$set_module() failed to extract module info, status = %dmake reaped child pid %s, still waiting for pid %s
makefilemissing target patternmixed implicit and normal rulesmixed implicit and static pattern rulesmultiple target patternsnoprocess_easy() failed to launch process (e=%ld)
read jobs pipesys$search() failed with %d
touch archive member is not available on VMSunknown signalunlink (temporary file): unterminated variable referencewarning:  Clock skew detected.  Your build may be incomplete.warning: -jN forced in submake: disabling jobserver mode.warning: NUL character seen; rest of line ignoredwindows32_openpipe(): process_init_fd() failed
Project-Id-Version: make 3.82
Report-Msgid-Bugs-To: bug-make@gnu.org
POT-Creation-Date: 2016-06-10 19:03-0400
PO-Revision-Date: 2012-11-12 16:40+0100
Last-Translator: Leandro Regueiro <leandro.regueiro@gmail.com>
Language-Team: Galician <proxecto@trasno.net>
Language: gl
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8-bit
Plural-Forms: nplurals=2; plural=(n != 1);

# %u regras implícitas, %u
# %u valores de variábeis específicos do patrón
# Directorios

# Ficheiros
# Base de datos de Make rematada en %s

# Regras implícitas
# Base de datos de Make, imprimida en %s
# Non hai regras implícitas.
# Non hai valores específicos do patrón.
# Valores de variábeis específicas do patrón
# Rutas de busca VPATH

# Variábeis

# estatísticas da táboa hash de ficheiros:
# 
Contáronse %d argumentos no inicio que fallou

Este programa compilou para %s

Este programa compilou para %s (%s)

Filtro de excepcións non manexadas chamado desde o programa %s
ExceptionCode = %lx
ExceptionFlags = %lx
ExceptionAddress = 0x%p
  --debug[=MODIFICADORES]     Mostrar varios tipos de información de depuración.
  --no-print-directory        Desactivar -w, incluso se se activou
                                 implicitamente.
  --warn-undefined-variables  Avisar cando se faga referencia a
                                 unha variábel non definida.
  -B, --always-make           Facer todos os obxectivos incondicionalmente.
  -C DIRECTORIO, --directory=DIRECTORIO
                              Cambiar ao DIRECTORIO antes de facer nada.
  -I DIRECTORIO, --include-dir=DIRECTORIO
                              Buscar os makefiles incluídos
                                 no DIRECTORIO.
  -R, --no-builtin-variables  Desactivar os valores das variábeis incorporadas.
  -S, --no-keep-going, --stop
                              Desactiva -k.
  -W FICHEIRO, --what-if=FICHEIRO, --new-file=FICHEIRO, --assume-new=FICHEIRO
                              Tratar o FICHEIRO como infinitamente novo.
  -b, -m                      Ignorado por compatibilidade.
  -d                          Mostrar moita información de depuración.
  -e, --environment-overrides
                              As variábei de ambiente substitúen aos makefiles.
  -f FICHEIRO, --file=FICHEIRO, --makefile=FICHEIRO
                              Ler o FICHEIRO como makefile.
  -h, --help                  Mostrar esta mensaxe e saír.
  -j [N], --jobs[=N]          Permitir N traballos á vez; infinitos sen
                                 un argumento.
  -k, --keep-going            Continuar cando no se poidan facer
                                 algúns obxectivos.
  -l [N], --load-average[=N], --max-load[=N]
                              Non iniciar varios traballos con carga
                                superior a N.
  -o FICHEIRO, --old-file=FICHEIRO, --assume-old=FICHEIRO
                              Tratar o FICHEIRO como moi antigo e non refacelo.
  -p, --print-data-base       Mostrar a base de datos interna de make.
  -r, --no-builtin-rules      Desactivar as regras implícitas incorporadas.
  -t, --touch                 Tocar os obxectivos no canto de os refacer.
  -v, --version               Mostrar o número de versión de make e saír.
  -w, --print-directory       Mostrar o directorio actual.
  Data %s  uid = %d, gid = %d, modo = 0%o.
 (incorporadas): (memoria envorcada) (non importa) (ignorado) (o nome pode quedar truncado) (non hai unha meta por defecto) (non hai expansión de ~) (remoto) (ruta de busca) ficheiros,  imposíbeis imposíbeis en %lu directorios.
 ata aquí. terminal.#  Un ficheiro de make por defecto, MAKEFILES, ou -include/sinclude.#  Tamén se fai:#  Obxectivo da liña de ordes.#  Produciuse un erro ao actualizar.#  O ficheiro non existe.#  O ficheiro foi actualizado.#  O ficheiro non foi actualizado.#  O ficheiro é un prerrequisito intermedio.#  O ficheiro é moi antigo.#  Fíxose a busca de regras implícitas.#  Non se fixo a busca de regras implícitas.#  Última modificación: %s
#  Nunca se comprobou o tempo de modificación.#  Ten que ser actualizado (-q está definido).#  Obxectivo falso (prerrequisito de .PHONY).#  Ficheiro precioso (prerrequisito de .PRECIOUS).#  Actualizado con éxito.# %s (dispositivo %d, inodo [%d,%d,%d]): # %s (dispositivo %d, inodo [%d,%d,%d]): non foi posíbel abrir.
# %s (dispositivo %ld, inodo %ld): # %s (dispositivo %ld, inodo %ld): non foi posíbel abrir.
# %s: non foi posíbel facer a operación de stat.
# Non é un obxectivo:# estatísticas da táboa hash de conxunto de variábeis:
%s (liña %d) Contexto do intérprete de ordes incorrecto (!unixy && !batch_mode_shell)
%s está suspendido durante 30 segundos...%s%s: %s%s: %s%s: Entrando nun directorio descoñecido
%s: Atrapouse unha Interrupción/Excepción (código = 0x%lx, enderezo = 0x%p)
%s: Saíndo dun directorio descoñecido
%s: Programa para o intérprete de ordes non atopado%s: Marca de tempo fóra de rango; substituíndo %s%s: opción inaceptábel -- %c
%s: opción incorrecta -- %c
%s: a opción require un argumento -- %c
%s: usuario %lu (real %lu), grupo %lu (real %lu)
%sCompilado para %s
%sCompilado para %s (%s)
%sLicenza GPLv3+: GNU GPL versión 3 ou posterior <http://gnu.org/licenses/gpl.html>
%sIsto é software libre: pode modificalo e redistribuílo.
%sNon hai NINGUNHA GARANTÍA, ata onde o permita a lei.
%s[%u]: Entrando nun directorio descoñecido
%s[%u]: Saíndo dun directorio descoñecido
*** Interrompido.
*** Agardando por traballos non rematados....-aviso, pode que teña que reactivar o manexo de CTRL-Y desde o DCL.
. Detido.
AbortadoViolación de acceso: operación de lectura no enderezo 0x%p
Violación de acceso: operación de escritura no enderezo 0x%p
TemporizadorEvitando a recursión de regras implícitas.
FALLO: num_pattern_rules é incorrecto! %u != %uBUILTIN CD %s
Chamada ao sistema incorrectaCanalización rotaErro do busExcedeuse o límite de tempo de CPUNon foi posíbel crear un ficheiro temporal
Acceso de filloO proceso fillo saíuA dependencia circular %s <- %s foi eliminada.Limpando o ficheiro de lotes temporal %s
Limpando o ficheiro de lotes temporal %s
Colisións=%ld/%ld=%.0f%%ContinuadoNon foi posíbel volver ao directorio orixinal.A chamada a CreatePipe() fallou (e=%ld)
Creando un ficheiro por lotes temporal %s
Hora actualA Aduana non exporta: %s
Sinal de perigoTrampa EMTExecutando %s no canto
Excedeuse o límite de tamaño do ficheiroO coprocesador de coma flotante non está dispoñíbelExcepción de coma flotanteColgarA E/S é posíbelTrampa de IOTInstrución inaceptábelPetición de informaciónAcceso inicializadoInterrompidoMatadoProceso fillo vivo %p (%s) PID %s %s
Carga=%ld/%ld=%.0f%%, Acceso de makeO ficheiro de make da entrada estándar especificouse dúas veces.Definición dunha variábel por obxectivo mal formadaNonNon hai obxectivosNon se especificaron obxectivos e non se atopou un ficheiro de makeObtívose un elemento para o proceso fillo %p (%s).
Opcións:
Non se admiten os traballos en paralelo (-j) nesta plataforma.Fallo de subministración eléctricaPoñendo o proceso fillo %p (%s) PID %s%s na cadea.
SaírRe-executando[%u]:Lendo os ficheiros de make...
Colleitando o proceso fillo perdedor %p PID %s %s
Colleitando o proceso fillo gañador %p PID %s %s
Rehash=%d, Liberouse un elemento para o proceso fillo %p (%s).
Retirando o proceso fillo %p PID %s%s da cadea.
Retirando os ficheiros intermedios...
Envíe informes de fallo no programa a <bug-make@gnu.org>.
Envíe informes de fallo na tradución a <proxecto@trasno.net>.
Reiniciando para entrar no modo de traballo único (-j1).Recurso perdidoSIGPHONESIGWINDFallo de segmentoDetidoDetido (sinal)Detido (entrada de consola)Detido (saída de consola)TerminadoTrampa de trazado/punto de detenciónErro %d descoñecidoActualizando os obxectivos meta....
Actualizando os ficheiros de make....
Condición de E/S urxenteUso: %s [opcións] [obxectivo] ...
Acceso de usuarioSinal definido polo usuario 1Sinal definido polo usuario 2Temporizador virtual esgotadoA xanela cambiouautomáticonon se poden reservar %lu bytes para a táboa hash: memoria esgotadanon é posíbel impoñer un límite de carga: non é posíbel impoñer límites de carga neste sistema operativoliña de ordescreando a canalización de traballospor defectorematouse sleep(30). Continuando.
a cadea baleira non é válida como nome de ficheironome de variábel baleiroambienteambiente baixo -eA busca de rutas de find_and_set_shell() define default_shell = %s
find_and_set_shell() definindo default_shell = %s
fopen (ficheiro temporal)fwrite (ficheiro temporal)inicializar a canalización do servidor de traballossintaxe non válida no condicionala chamada a lbr$ini_control() fallou con estado = %da chamada a lbr$set_module() fallou ao extraer a información do módulo, estado = %dmake colleitou un proceso fillo de pid %s, aínda se agarda polo pid %s
ficheiro de makefalta un patrón obxectivoregras implícitas e normais mesturadasregras de patrón implícitas e estáticas mesturadaspatróns de obxectivo múltiplesnonproduciuse un erro ao iniciar process_easy() o proceso (e=%ld)
lectura da canalización de traballosa chamada a sys$search() fallou con %d
a operación de tocar un membro do arquivo non está dispoñíbel en VMSsinal descoñecidounlink (ficheiro temporal)referencia a variábel non rematadaaviso: Detectáronse inconsistencias de reloxo. A operación pode quedar incompleta.aviso: -jN forzado no submake: desactivando o modo de servidor de traballos.aviso: viuse un carácter NUL; ignórase o resto da liñawindows32_openpipe(): a chamada a process_init_fd() fallou
PK�m�\1,{yAyALC_MESSAGES/util-linux.monu�[���PK�m�\(A�M���ALC_MESSAGES/iso_15924.monu�[���PK�m�\w��c�K�K�aLC_MESSAGES/shadow.monu�[���PK�m�\:��**ͭLC_MESSAGES/cpio.monu�[���PK�m�\�q�\\.�LC_MESSAGES/iso_3166-1.monu�[���PK�m�\��@�����4LC_MESSAGES/grub.monu�[���PK�m�\�vT!Y�LC_MESSAGES/Linux-PAM.monu�[���PK�m�\Q�,�������LC_MESSAGES/gtk20.monu�[���PK�m�\��U�."."��LC_MESSAGES/grep.monu�[���PK�m�\�7(]��_�LC_MESSAGES/libsecret.monu�[���PK�m�\u��d�2�2#h�LC_MESSAGES/gst-plugins-base-1.0.monu�[���PK�m�\����)�)KLC_MESSAGES/tar.monu�[���PK�m�\�����RILC_MESSAGES/passwd.monu�[���PK�m�\���@��"~KLC_MESSAGES/gst-plugins-bad-1.0.monu�[���PK�m�\Y.b��j�j]RLC_MESSAGES/findutils.monu�[���PK�m�\r��*�*y�LC_MESSAGES/diffutils.monu�[���PK�m�\I�R�����|�LC_MESSAGES/bash.monu�[���PK�m�\��ϡ
�
���LC_MESSAGES/iso_639-3.monu�[���PK�m�\^m�4ƆƆ��
LC_MESSAGES/gstreamer-1.0.monu�[���PK�m�\\�(X	LC_MESSAGES/iso_3166-3.monu�[���PK�m�\_�)˨T�Tq(LC_MESSAGES/wget.monu�[���PK�m�\���XNONO\}LC_MESSAGES/mc.monu�[���PK�m�\�x��cc��LC_MESSAGES/acl.monu�[���PK�m�\�Y�������LC_MESSAGES/dpkg.monu�[���PK�m�\���$�$��
LC_MESSAGES/gettext-runtime.monu�[���PK�m�\ԊhM]]��
LC_MESSAGES/man-db-gnulib.monu�[���PK�m�\���(Y(Y��
LC_MESSAGES/iso_639-2.monu�[���PK�m�\��vˠ��BLC_MESSAGES/initscripts.monu�[���PK�m�\�#2���ULC_MESSAGES/iso_4217.monu�[���PK�m�\=����D�D�aLC_MESSAGES/sudo.monu�[���PK�m�\t)5Œ���LC_MESSAGES/usermode.monu�[���PK�m�\Z���3 3 ��LC_MESSAGES/p11-kit.monu�[���PK�m�\���ܵo�o�LC_MESSAGES/coreutils.monu�[���PK�m�\��+i$$PLC_MESSAGES/elinks.monu�[���PK�m�\�*����ntLC_MESSAGES/pulseaudio.monu�[���PK�m�\���eBBTrLC_MESSAGES/newt.monu�[���PK�m�\���>�>�tLC_MESSAGES/xkeyboard-config.monu�[���PK�m�\=�UT,T,"�LC_MESSAGES/recode.monu�[���PK�m�\0�V�))��LC_MESSAGES/atk10.monu�[���PK�m�\�������
LC_MESSAGES/NetworkManager.monu�[���PK�m�\?�����LC_MESSAGES/gnupg2.monu�[���PK�m�\&B��vxvx&LLC_MESSAGES/rhn-client-tools.monu�[���PK�m�\�6����LC_MESSAGES/policycoreutils.monu�[���PK�m�\M�:)��1�LC_MESSAGES/sysstat.monu�[���PK�m�\M7�A�A �LC_MESSAGES/systemd.monu�[���PK�m�\�D;��&�&LC_MESSAGES/chkconfig.monu�[���PK�m�\���?LC_MESSAGES/popt.monu�[���PK�m�\(ّ�D^D^MFLC_MESSAGES/gdk-pixbuf.monu�[���PK�m�\8F@9�9�ڤLC_MESSAGES/glib20.monu�[���PK�m�\8.^��%�%X�LC_MESSAGES/sed.monu�[���PK�m�\�y���\�\��LC_MESSAGES/gettext-tools.monu�[���PK�m�\[Ѧ��� LC_MESSAGES/nano.monu�[���PK�m�\�Y��������LC_MESSAGES/parted.monu�[���PK�m�\� \$\$�hLC_MESSAGES/firewalld.monu�[���PK�m�\]I`���j�LC_MESSAGES/libpaper.monu�[���PK�m�\�_�$9W9W|�LC_MESSAGES/make.monu�[���PK88��